Mapoly0001s0021



Description

X-BOX TRANSCRIPTION FACTOR-RELATED

Reference DB

Database ID Description
GO GO:0003700 Sequence-specific DNA binding transcription factor activity
GO GO:0006355 Regulation of transcription, DNA-dependent
GO GO:0043565 Sequence-specific DNA binding
OrthoMCL OG5_136801
PFAM PF00170 BZIP transcription factor
PANTHER PTHR13301 X-BOX TRANSCRIPTION FACTOR-RELATED

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpBZIP1 transcription factor, bZIP Mapoly0001s0021.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0001s0021.1 scaffold_1:252382..257257  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0001s0021.1  

Gene structure:

mRNA scaffold_1:252382..257257  ( + strand )
five_prime_UTR scaffold_1:252382..254049  ( + strand )
CDS scaffold_1:254050..254209  ( + strand )
CDS scaffold_1:255288..255560  ( + strand )
CDS scaffold_1:255808..255967  ( + strand )
CDS scaffold_1:256220..256376  ( + strand )
CDS scaffold_1:256584..256643  ( + strand )
three_prime_UTR scaffold_1:256644..257257  ( + strand )

Sequences:

Gene

>Mapoly0001s0021.1
CTCGCATCCTTTTCGGTAGTCGTGCCGCGCCTGACGGGGTCCGAACTCTCGCGACGGACATCGGTCGCGAGAGTTCGGACCCTAACGGGCGTGGCCTCACCCCGTCAGTTCGACTCACCCATGTTTGACTTTTGACAGACGGTAAAGCCCATGACCGGCTGTTGCTTGCCCGCTCCTCCTCGGAAAGTTAGTCAGAGGGAAAAGTGAAAGCATGAAAAGATCTCGGCCGATCGACGCGCTTGCGAGCGCCACGCCTCCCTCTCGCTGATTGGCTCCCATGCTCGCATTGTTCCCCGGGGCATCAGGTGTCGCCGAGAATCCTCGTCATCGGATTTGGCCTCTATTTTCCTTCCTCACCTTTCGGTCCGGCTGTGCCATGTCGAATTTCGCTGCTCCTGTAAACGAGCGTGAGGAGCGAATCCGAGCGGATCCGAGCTTTGTGCAGGGTTCGCTGAATCTTATTATTTCCACTGGAGAGCCGTAGTGGTTGGTTGGCAGCTGGATCCTTGCCCAGGGCCGAAGAGTAAAGGGACGGACGTTTACCTCCTAGTCGACCACGGATCGGCACATTATGCCGACTCTCTTATGCTTCCTGAGCGTACAGGAGACATAAGTGCGCCAGCCATTGGGGACAGCGGCAAGTAGTAGAGCAGGCCGGGCAAGATTCGCCTTTTGTTCGAGGAGGAGGAGGAGGAGGAGGAGGAAGGAAGGAAGGAAGGAAGGGAAGGGAAGGGAAGGGAAGGGAAGCGAAGTTGTAGCTCTCAGCTTTCCGTGGAGCCGAGCACGGTCCAAAGGTCTTTTGGCCACCGATGACGGCAAAAGTGTGATCCTGTCTTTACCTAGAGGACTGTAGGGCCGCTACTCTCGGTTGGCTGGCCGCATTTTGCTTTCGTCGTCGTCATTGGAAGTGTCACTGTTTTGTGCTCACGTAGGCGGTTCATGTTCTCAATGCTCTGCCGTGGCTTCTTCTTCTTCCATCCCGTCCCCTCCTCGCCTATTCTGTCCAGCTGCGACCGGTTGTCCGCTAGGACGCTCAGCTCTGCTGCAGCTCGTCTTCTCATGACCATATGCCTCGGCCTGGAATTCGTATAGTAGGCTGACTTGTCTCTCTCTACGTCTCTTCTTGTACCTCTGGTGGATAGAATTTCTCCTCTCAAGGAGCTTAGCAGGTCCCATCGGCAGAATTCGCTACTGCCTCTGTGAGATTCTAATTCTTTCTCCGACGAGAGGCGAGTTCAATCAATCAATCTGCGCAATTCCGCCCATTACAGCTGATTATCAGTTTCTTGCCCTCGAGAGCCCTTCGTGAATTCATATCCTGAACAGGGTTTTACTTCACCTGTAAATTATTCTGTTATATTTCAGATGTTTTGACCTGTCCGCAAGTTCCCGAATCATTTCAACCCGACCACTGAAAGCGTCTGGTCCCGTGTCGGGTCCCGGGAGAAGGTGGGAAGACTGGGGCTTGTAGCTCCAAGGCTTGCTCTGGCCAAGCTCAGAAGCGACGAGAGCGGGCTGTGGATCTGAAGTCGGTGAAGAAGAAGTGAACGGGACTGGAGCTGACCAGCAGCGGTAAAGTGTGGTATTGACGAGAGTTCGAGGAGTCGCCAATCGAGGCAGTCGAAGGCTTTCTACAACGAGCATTGTTTGTGCCTCTCGAACACATTCATGAATGAAGTGGAGTCTCAAGAAGCGGAGATTCAGTGGGTCGACTCGGACGTAGACAATGATTCAGACGCTTCAGATAGCGATGGGACAGACGGAGAAGTTCCGGATGTGACGGACGACACCCCGCAGACTAATCTCACCAACAACCCACTACCACCAGGTCGGTCTCGAATTCCTCACCTGAATCCCCCTCGTATGTTTCAATCTGACTCTACCAGTGGTTATCTTGTCTTCACCGAAGTGCAATTGTGATTGCTACAAAGAATCCCAGAGCTCAGCAGCTGTAATCACAACTTCTCCAGAGGTTTTGGAGCCCTAAATCTGGTTGTACGATGGAATTGGACGTGCACCGAAGCCTGTCTCGGAGACCCGTTTCAAGGCTTTCGCCTTCTTACCGAGTCCTTAGTAGTTAAGGCTAGTCGCGATATGAATTAAAGCTTAGGAGGCTGGTCACTGGTGAACCTTTTAAGCCAAGTAGAGCTTGCAGGTTTGAGACGTCTCTGTTGGCCATTCTGACGCAAAGCCTTCGGTCGCTACCACGGCTTCCGCAGTGCTCCGTACCATGGAGCAGAAACTTTCGATCCGTATTGCAGCTGTAAACTTTGGAGGGTCGGTTTGTCCCAATTCCAATTATCTGCAACCTTGTACGTCGTCGCACCATTGACTTTTGCATGGTCATTAGCCTGACTCGCTGTCAACCTAGAGCTTGCAAATGAATAGCGGTGGCTCTCTCTTTTCTAGAACGGCCTCACTGCAAGATTACGGAGTACAGTCGTTTTTCTCAGTTCATCGCCTTCTGTCGGGTCTCGCGCAGGCGGGAATATACAGTAAAATGCTTACGACAGTGGTTCTTCTTGTTTCACCACAATCTAATGTGAACCTCGAGGCACGGTGTAACTTGATATTCCGGACCCTTTGAGTGCTTGAAACATGCTAAGCATTGGCTAGCACTGTATCCATGCACGAACTCCAATTGCGAACGACCCCATATTTCATCCAGTTAGTGCCCAACTCAACCGTCACAGCAGAGATCGAATCCTTCTGAGTTTTGCTCTTACTATCATCAGGGTGATTTCTAGAACCTCAGTTTGGTGTTTGGTTATGGGAATACGTCGGGGAGTTTTGCATTTCTAGAAGCCAAGAGTATCGAACGAAACCCTACATCGAGCAGAGGAGGGCAGTGTGTTGGTTGTTGACTGAACTGAAGGGTGTGTACAACTTGGACTATGGTGGTGCAGGAGCTGTTCGTCTGTATTCAAAACCTCTTAATTCTTGGAATCCGAAATCGCCAATCATTGCGACCTCAACTTCAAAAGAAAGCCCCTTCGCGGGCGGCTGGAAACCTGTCATTGACGGGAAAATCCAGGTCGGTGGAGAGGGTGCTGTCCACAAAGGTCGTAGCTCACCAATGCAAGTAGCGTCTGCTGGTGGTTCCTCTCAAAAGCAATCCAGTTCAGATGGAGCCTCTCCGTCTCCTGCCGCAACCGGAACATCTGAGCCGAAGAAAGACGGTGAGTTTCTTCGGTGGGCCGGCTCGTATAGAGTCAGATAGAAGTTCCCGCATCGGTTATTCGGATATATTCGTGTATCTAGTATCTTGCGGACTATCCCCAGTGCCGTGGCACTTCCAATTATCTCCATGTACATTTCACAGTGTTGTGAACGTATCGTACCCGACTCAGTGAGGTTCGACACCTCTACAGATAGCAGGTCCTCGCACTCTTCAGGAAGACACTGATTTATCGGCTGTTCCTGCAGGTAATGAAAGCGACTCCGATGTCAGACGAGTACCTGAACTGATGGGGAAAAGTGGAGTTTTGGGTGCAACTTCAGCTCAACCGCAAGGGCAGACTTCAGGAACCAGAACTAGAAAGAGGGGAGGAGCCTCAGCAGATAAAGAGCACAAGCGATTGAAAAGGTACCAATTGTTGTGGTGGAAACCTTGATAGCTTCTAGAGGGTGTTAATCATGAACCATGATGGGCGGAAGTTATTGTCCATGACGTTCGTGTTTAGTAGTTCTCTAAGTTGGCGATTTCACGAGGTTTATCGCCTGATTTAAGCAGGCAATGAGCTGTTGACGGTGTCCGAGGAGGCCGGGTGTGGAGCAAGTCCATTTACCGTCGCTTAACATGGCAAGTGTCTGATTGTTTATTTGCGCACAAATGCAGGCTGTTAAGGAATAGAGTCTCTGCTCAACAAGCTAGAGAAAGAAAGAAAGCTTACCTCAGTGACCTGGAAGTGAGATCTAAGGAGCTACAACAGCGTAACGAAGAGTTGGAGGAGAAAGTATCTACTTTGCAAAGAGAAAACTACATGCTACGACAGGTTAGTCTTTGTCGCCGAAGGCGTCTTCCTCCATTTTGCTTTGAACCTGAATATACTACTTCTTACAGTTACTTTTTTAAGAGACTGACGTTGCCATGCCACATGTGGATACACAAATTTATTTCTTGTAGACCGTTCACCTTATTTGAATTATCCCGTCATTGTTAAACATCTATGCTGATCATGATCTTTTCTATGTTGGTGCAGATTGTGAAGAACACCGCCTTGAAGAAGACTGGAGGTGACGGTCCAACAGGCATGCAATAAAACGTAGTCATTTTTATTGAGTAGGCTTCGACAAGGTTTAGGTAGCTTCCTTCCTTGATTAGTATGTAGCACAAAATTCCAGTTAGACCCATTCTGTCACAACCGTTCTGTCAGAATTGAAGCTTAAGTCCTGGCACCAATGCGCTTGGGGTATTTTATGTCCATAGTTTCGCCTTCACTTGACTCGTAGATCTATGGCACAGGTCTAGTCATTTCGATTGCTCAGATTATCCCTAGCGAAGCCCTGCACTTACCGAGCCGCAACTTCTTAGTTTACTTCTTCACTGTACGTTCATGCCAGCATGGGCTATTGTTCCTTCAATTAAGATCCGATGCTGTCCAAGCACGAGGTATTGACCGTGGGTCAGTGGAGTCAATTTGGTTCCAAATGGTAGCTCTTGAAGTGGTAGTTAGAGTTGTGAGTTAAAGTTTCAGTGTTAGATCAAATCAATATGTTCTCCTTGTCACTGATGTATTTGCTTACGAAGCAACAACTGCCTCAGTGAATGGAGCAAGAAACCTGGCGAATATCAGCACTGTTTCACCTGAAGGAGGTCTTACGTTCAAATGGTTATCGATGAACAGTGGAAGAGGTTTAGTACTCAGAAGAGCGT

mRNA

>Mapoly0001s0021.1
CTCGCATCCTTTTCGGTAGTCGTGCCGCGCCTGACGGGGTCCGAACTCTCGCGACGGACATCGGTCGCGAGAGTTCGGACCCTAACGGGCGTGGCCTCACCCCGTCAGTTCGACTCACCCATGTTTGACTTTTGACAGACGGTAAAGCCCATGACCGGCTGTTGCTTGCCCGCTCCTCCTCGGAAAGTTAGTCAGAGGGAAAAGTGAAAGCATGAAAAGATCTCGGCCGATCGACGCGCTTGCGAGCGCCACGCCTCCCTCTCGCTGATTGGCTCCCATGCTCGCATTGTTCCCCGGGGCATCAGGTGTCGCCGAGAATCCTCGTCATCGGATTTGGCCTCTATTTTCCTTCCTCACCTTTCGGTCCGGCTGTGCCATGTCGAATTTCGCTGCTCCTGTAAACGAGCGTGAGGAGCGAATCCGAGCGGATCCGAGCTTTGTGCAGGGTTCGCTGAATCTTATTATTTCCACTGGAGAGCCGTAGTGGTTGGTTGGCAGCTGGATCCTTGCCCAGGGCCGAAGAGTAAAGGGACGGACGTTTACCTCCTAGTCGACCACGGATCGGCACATTATGCCGACTCTCTTATGCTTCCTGAGCGTACAGGAGACATAAGTGCGCCAGCCATTGGGGACAGCGGCAAGTAGTAGAGCAGGCCGGGCAAGATTCGCCTTTTGTTCGAGGAGGAGGAGGAGGAGGAGGAGGAAGGAAGGAAGGAAGGAAGGGAAGGGAAGGGAAGGGAAGGGAAGCGAAGTTGTAGCTCTCAGCTTTCCGTGGAGCCGAGCACGGTCCAAAGGTCTTTTGGCCACCGATGACGGCAAAAGTGTGATCCTGTCTTTACCTAGAGGACTGTAGGGCCGCTACTCTCGGTTGGCTGGCCGCATTTTGCTTTCGTCGTCGTCATTGGAAGTGTCACTGTTTTGTGCTCACGTAGGCGGTTCATGTTCTCAATGCTCTGCCGTGGCTTCTTCTTCTTCCATCCCGTCCCCTCCTCGCCTATTCTGTCCAGCTGCGACCGGTTGTCCGCTAGGACGCTCAGCTCTGCTGCAGCTCGTCTTCTCATGACCATATGCCTCGGCCTGGAATTCGTATAGTAGGCTGACTTGTCTCTCTCTACGTCTCTTCTTGTACCTCTGGTGGATAGAATTTCTCCTCTCAAGGAGCTTAGCAGGTCCCATCGGCAGAATTCGCTACTGCCTCTGTGAGATTCTAATTCTTTCTCCGACGAGAGGCGAGTTCAATCAATCAATCTGCGCAATTCCGCCCATTACAGCTGATTATCAGTTTCTTGCCCTCGAGAGCCCTTCGTGAATTCATATCCTGAACAGGGTTTTACTTCACCTGTAAATTATTCTGTTATATTTCAGATGTTTTGACCTGTCCGCAAGTTCCCGAATCATTTCAACCCGACCACTGAAAGCGTCTGGTCCCGTGTCGGGTCCCGGGAGAAGGTGGGAAGACTGGGGCTTGTAGCTCCAAGGCTTGCTCTGGCCAAGCTCAGAAGCGACGAGAGCGGGCTGTGGATCTGAAGTCGGTGAAGAAGAAGTGAACGGGACTGGAGCTGACCAGCAGCGGTAAAGTGTGGTATTGACGAGAGTTCGAGGAGTCGCCAATCGAGGCAGTCGAAGGCTTTCTACAACGAGCATTGTTTGTGCCTCTCGAACACATTCATGAATGAAGTGGAGTCTCAAGAAGCGGAGATTCAGTGGGTCGACTCGGACGTAGACAATGATTCAGACGCTTCAGATAGCGATGGGACAGACGGAGAAGTTCCGGATGTGACGGACGACACCCCGCAGACTAATCTCACCAACAACCCACTACCACCAGGAGCTGTTCGTCTGTATTCAAAACCTCTTAATTCTTGGAATCCGAAATCGCCAATCATTGCGACCTCAACTTCAAAAGAAAGCCCCTTCGCGGGCGGCTGGAAACCTGTCATTGACGGGAAAATCCAGGTCGGTGGAGAGGGTGCTGTCCACAAAGGTCGTAGCTCACCAATGCAAGTAGCGTCTGCTGGTGGTTCCTCTCAAAAGCAATCCAGTTCAGATGGAGCCTCTCCGTCTCCTGCCGCAACCGGAACATCTGAGCCGAAGAAAGACGGTAATGAAAGCGACTCCGATGTCAGACGAGTACCTGAACTGATGGGGAAAAGTGGAGTTTTGGGTGCAACTTCAGCTCAACCGCAAGGGCAGACTTCAGGAACCAGAACTAGAAAGAGGGGAGGAGCCTCAGCAGATAAAGAGCACAAGCGATTGAAAAGGCTGTTAAGGAATAGAGTCTCTGCTCAACAAGCTAGAGAAAGAAAGAAAGCTTACCTCAGTGACCTGGAAGTGAGATCTAAGGAGCTACAACAGCGTAACGAAGAGTTGGAGGAGAAAGTATCTACTTTGCAAAGAGAAAACTACATGCTACGACAGATTGTGAAGAACACCGCCTTGAAGAAGACTGGAGGTGACGGTCCAACAGGCATGCAATAAAACGTAGTCATTTTTATTGAGTAGGCTTCGACAAGGTTTAGGTAGCTTCCTTCCTTGATTAGTATGTAGCACAAAATTCCAGTTAGACCCATTCTGTCACAACCGTTCTGTCAGAATTGAAGCTTAAGTCCTGGCACCAATGCGCTTGGGGTATTTTATGTCCATAGTTTCGCCTTCACTTGACTCGTAGATCTATGGCACAGGTCTAGTCATTTCGATTGCTCAGATTATCCCTAGCGAAGCCCTGCACTTACCGAGCCGCAACTTCTTAGTTTACTTCTTCACTGTACGTTCATGCCAGCATGGGCTATTGTTCCTTCAATTAAGATCCGATGCTGTCCAAGCACGAGGTATTGACCGTGGGTCAGTGGAGTCAATTTGGTTCCAAATGGTAGCTCTTGAAGTGGTAGTTAGAGTTGTGAGTTAAAGTTTCAGTGTTAGATCAAATCAATATGTTCTCCTTGTCACTGATGTATTTGCTTACGAAGCAACAACTGCCTCAGTGAATGGAGCAAGAAACCTGGCGAATATCAGCACTGTTTCACCTGAAGGAGGTCTTACGTTCAAATGGTTATCGATGAACAGTGGAAGAGGTTTAGTACTCAGAAGAGCGT

CDS

>Mapoly0001s0021.1
ATGAATGAAGTGGAGTCTCAAGAAGCGGAGATTCAGTGGGTCGACTCGGACGTAGACAATGATTCAGACGCTTCAGATAGCGATGGGACAGACGGAGAAGTTCCGGATGTGACGGACGACACCCCGCAGACTAATCTCACCAACAACCCACTACCACCAGGAGCTGTTCGTCTGTATTCAAAACCTCTTAATTCTTGGAATCCGAAATCGCCAATCATTGCGACCTCAACTTCAAAAGAAAGCCCCTTCGCGGGCGGCTGGAAACCTGTCATTGACGGGAAAATCCAGGTCGGTGGAGAGGGTGCTGTCCACAAAGGTCGTAGCTCACCAATGCAAGTAGCGTCTGCTGGTGGTTCCTCTCAAAAGCAATCCAGTTCAGATGGAGCCTCTCCGTCTCCTGCCGCAACCGGAACATCTGAGCCGAAGAAAGACGGTAATGAAAGCGACTCCGATGTCAGACGAGTACCTGAACTGATGGGGAAAAGTGGAGTTTTGGGTGCAACTTCAGCTCAACCGCAAGGGCAGACTTCAGGAACCAGAACTAGAAAGAGGGGAGGAGCCTCAGCAGATAAAGAGCACAAGCGATTGAAAAGGCTGTTAAGGAATAGAGTCTCTGCTCAACAAGCTAGAGAAAGAAAGAAAGCTTACCTCAGTGACCTGGAAGTGAGATCTAAGGAGCTACAACAGCGTAACGAAGAGTTGGAGGAGAAAGTATCTACTTTGCAAAGAGAAAACTACATGCTACGACAGATTGTGAAGAACACCGCCTTGAAGAAGACTGGAGGTGACGGTCCAACAGGCATGCAATAA

Protein

>Mapoly0001s0021.1
MNEVESQEAEIQWVDSDVDNDSDASDSDGTDGEVPDVTDDTPQTNLTNNPLPPGAVRLYSKPLNSWNPKSPIIATSTSKESPFAGGWKPVIDGKIQVGGEGAVHKGRSSPMQVASAGGSSQKQSSSDGASPSPAATGTSEPKKDGNESDSDVRRVPELMGKSGVLGATSAQPQGQTSGTRTRKRGGASADKEHKRLKRLLRNRVSAQQARERKKAYLSDLEVRSKELQQRNEELEEKVSTLQRENYMLRQIVKNTALKKTGGDGPTGMQ

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>