Mapoly0002s0103



Description

blocked early in transport 1

Reference DB

Database ID Description
GO GO:0005515 Protein binding
KEGGORTH K08504 Blocked early in transport 1
KOG KOG3385 V-SNARE
OrthoMCL OG5_128879
PFAM PF05739 SNARE domain
PANTHER PTHR12791 GOLGI SNARE BET1-RELATED
PANTHER PTHR12791:SF5 BET1-LIKE SNARE 1

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpBET1 Ortholog of Arabidopsis BET1 genes Published

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0002s0103.1 scaffold_2:1248527..1252683  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0002s0103.1  

Gene structure:

mRNA scaffold_2:1248527..1252683  ( - strand )
three_prime_UTR scaffold_2:1248527..1249127  ( - strand )
three_prime_UTR scaffold_2:1250453..1250487  ( - strand )
CDS scaffold_2:1250488..1250577  ( - strand )
CDS scaffold_2:1250692..1250751  ( - strand )
CDS scaffold_2:1251105..1251161  ( - strand )
CDS scaffold_2:1251373..1251520  ( - strand )
CDS scaffold_2:1252281..1252297  ( - strand )
five_prime_UTR scaffold_2:1252298..1252683  ( - strand )

Sequences:

Gene

>Mapoly0002s0103.1
GCAACGGGACGGGAAGAGGAGCTCGATCGTATTTGGCTCGCGAGGCGCGGCCACTCTCTCGCACTGTTCGAGCTGTGGCTCCATCGCTGCTGCTGCTGCTGCTTCTTCCTCCTCTTCTTCTTCATAATCTGCGGAGTCAAGAATCGTGATTCGGATTCTTCGACGCGGTTCTTAAATGATTTCGGATATCGAGGACTCAGTGCAGCGCGGAGGCGAAGGCCGAGCGAGGGCGTCCGGCGAATTCGGCTCGGTGACGATGCGAAGTGGTCAAATTTGAGCAGATCTGGTGGTCGGTTTTGTGGTATGTCCGCCTGAGAGTGCAGGAGGCATTCTGAGAGCTCCACTCTGTCGGGTTGGCGTCACATGCGGGAGGACGGCCGCGAATCATGATGAACACTCGCCGGTGCGTGTTGATTTTGCGGGCGTCGACTTTTGTTTGTGGGAGCTTGGTGTCGCGGATCCGCGTAGGATGCGTCTATGATCAGTCTTGGAATTTTGTGACGAATTTTTACATCGGGAATTATGCGACGATTGTTTTCTCTTGTGTGTTTGCGTAATGTCTGAATTCCCGGACGAGGCGTCCGAATGGGTTCAAATATCATAATCTTTGAGAAAGTTCACCCCTGTCTTGCTCTGAAAAATTTTGCCTCTCAGGTTAGGTTAAGTTGCCTATGTTCTTGACCAGTAGAACGCTGCCTCGTGGATTGCCGAGCTATTAGCGTATGTTGTAGTAGAGGGTATAGTTGAAGAATTCAAAGCTCTATGTATCTGCCGATGAGTCATGGAGCTGCGTCCCATCTTAGATTGATTTTGCAAGCACAGTTTGGAAGGTGTTTTCTTCCAAGAAGTAGGACATGTCGATCTGCTCAATTGGTCCTCTTTTGAGTGCTATTCTCTGTGTCTGGCTTGCTGCATATTTTCATAATCTTGGCCTTTCGGAAATACTGCACTCTGGCTACGTTTCCTGTTTTATCGTTCTGGTCTTGGAGACTTTGTTCGCGGGAGTGATTAGTGGCCGGTCTTTCCTGCTTCTTGTCCTGCTCTTGGGTTCGGGCAATTCTTCACGGTACAGAGTAGTTCTCAGTACCCTTCTCCTTGTCATGGCTCTAAGAGTGTACGAATGTTTGGTATGTAAACTGTTTATGGTGACATTTTCCATGCAGAGATTACCGCAATCGCAATTCTCTGTTCGACAGTTTGGAGGAAGGTGGCTTGAGACCAGCTTCCTCATACTCGACCAGCGAAATTGCAGAACAGGAGAATGACCGGGGAATAGATGATCTCAGTGATAGAGTGAACGTGCTGAAGAGGGTGAGCATCAGACATATTTTCCTAGGGTTCCAATGTAGTAGAGTTGTGTTTTCAGGCCGACTTTGTACGGTTATTTTCCTTTGCATCTCGTAATAAATTATATCAAGTTTGCGTCGGTATGCTTCACAGTGACTTACTTGCTGGGCTCGTTCTTATGAATCCTGTTTGTTGAAAATATTCAGTTCTCTAAAATGTTGGGGTATTTGTGTAGCTGACATCTGATATCCATGGCGAGGTGGATACTCACAATCGGCTGCTGGAGCGCATGGTATATTTCGCCATATCAACTTTGACTTACTCGTATACTACGATGAGTATTTTGTATAATAGAACTATTTAGAACCGTGAGAGGATGATTGCTGGATCACAATGCATAACGGGAGGTCTTTGTATCGTCGTTCTCATTTTGGCCCAGACATTTATCCTTTGTTAAGTAGGCGATTTGTTTCAGATGCAGTCGTTGCGTTTCCCGACAGGAAGGGTTGAGTGCTGAGGCTTGGTGCAGCTTGGACTCTGTTGAGTGGACATGCAAATTCGGCTAACTCGACCCTATCAACTGCAGAAGCTTGTGATTAGGGTTTGAGCTCATCAAAAAGAGATTATGCTCTTGGTTGGTTTCAGGAACAAGATATGGATTCTTCAAGAGGAATGCTCTCTGGAACAATGGATCGCTTCACAAGGGTGAGTCCTACGTAGCAATTGAGTGTTCGTTTCTATCTGAGTTGAAGGACTGATTCTGAATGTACTTGGACAGTGTCAGGATTCTTATTTGTTCTTGGTGGCTGTCTTTTGCAGGTCTTCGAAACGAAGTCAGGGAGAAACGTTGTCACTATAGTTGGATCTTTGGTGATTGTGTTTCTTCTAGTTTACTACTTGACAAAGTGAAAAGGGAGTCCCATTGGTTTGTGTTATTATAACAGGTATGTCGATGAAGCCTTGTATCCACTCAAATCATATATAAAATCCGCATGTAGAATTGTTCATCAATCGAGCTGTCTAATATGATACTATTATTATAATCACTTATCAGTCAAAATCCTGATGTGATGACGATTATCAGTCAAAATCCTGTAATTCAGGTTTTGTGGATTAGAACTTATAGTAATGGACTACTTAGTGCTAATATCAAGGCACGGGTCAGTGGCAGCTTCAATGTGCTCGAGTTATGGTCATAGAAATGTTAACCGTAGAAACGATCTCTGTCGATTCTGTTGGGGTTAAGGTGGCTACGTTTTGTCTTTTTCCGCCTCCCTCTTTACCCATATCAGTTCTTCACTAGCACCGTTCAGCCACACCACGGTGTCTATGGTCTTTAGGCTGTGACAGGAAAATGTTAATGATCATAGTTTATTTGGGTTAAGGTGGGCATACAAGGGACTCATGGAGCAGTCTTCTATTTACTTTTTTATATGGATACGTGGAGAGGGGATATCTACTACCTTCAAGGTTACAGAACAAGCTTCATTGTCATGGAGGAGTCCGAGGTTTCAAAGGAACCTTTCAGATCTCTGAATCTGCTATGAGTTCGGAGGTGATTTGTACTTCTGGTCTTGAGCTAGATAAGGAGAAGACTAATAATCTGCTTGAACAAATGTTCAAGCCGGGTCATGTCCAGAAAGATGGGGTTTTGTAATTAAGTTGATTATGTGAGGGATAAAGATTTTCACTTTGCGGGGTATTTCTTGTATCAAGTTATATGGATTATTCATATTTGTGGACTGACGTGCTGAAAGTGGGCAGACCACTCAGTCGTCAGTCTCTGTCACTTCTTTTTGGTTGCCTACCTGATCGTGACAAGTGTATTTAGAGATTTGATTGCGCTCTTTGTCCTTAGATAGTTTAGGTGGTCCGAAAAGGTTTGCCTAGCACATGGATGTGGATCAACCGGTCAATAAGCAATCATTGTAAAGTTCGTAGATGAATTCTCGTCTGCCACAAGATGCCACAAGGCATCATAAGAGTTTGCAGCAAAAGTCCACCAGTCGAATTGCGGTGATGGTAGCTTCATAAAAAAATCTTCCAGACTTTTGGAAGTCCAAGAAGAAGGAAGGTTTGTGCTAGACTTCGAAATGTACACGCAGTTTGGGCTGTCTATAAATCTGAAGTGCCTAAAGAGCGCTCTTAGTTTTGAGGAACTTCATTGACTAAGTTTCCACCGTGTTGTTGTCCTTTATCTTAGTGAAAATTTTGACCTTCTGGAAAACGATCGCGTGTGCTTATACCTGTCATCTGGAATATGGTGCAGGGAACTTGTTTCTGTAGGGCTGCTTTTAGCCACAACGGCAGTAACAATGAATTGATGTGTGAACAAAGTACCTACTTAAAGGGCAGAACTTTGGAGTACATCTACATGCGTTGGCAATAGATATGAAAGATCAATTAATTATCTGCTGATTTCATTTCTTCCTAACCACTGACTCACCGTACCGTCGTCACTCAGTGTGATCGAAGATTGATGGTTACTAGGAGCGATACAAGAACAAGTGACGATATGTAGGCTAATTTTGGCAATGTCAGTTGAACCACGTTCCAAAGGGACGGTGTTGAGATTTCTACTGTAGGTGCGTATGTGTTTCGGCCGCTGATGTACCCGATGTCCGTTCTTAATGTAAAACGGAAACAAACGACTTAATATTATTACAGAAGTCAAATGCTCATCATACTAAAAAGCAGGGAATATTAAGTTGATCGCCTTAGGCCGCCAATTATTTTACTCCCTTTTGGACGGACATCTACTATCACGAGGTATCTTGTTGTCGAAAGCTGAAATGTTGTGAGACCTTTTTGAACCAATTTGTTGTATTTGATTATAAAGATATGTTCCGAGACTGGCGTTGGTCGACCCG

mRNA

>Mapoly0002s0103.1
GCAACGGGACGGGAAGAGGAGCTCGATCGTATTTGGCTCGCGAGGCGCGGCCACTCTCTCGCACTGTTCGAGCTGTGGCTCCATCGCTGCTGCTGCTGCTGCTTCTTCCTCCTCTTCTTCTTCATAATCTGCGGAGTCAAGAATCGTGATTCGGATTCTTCGACGCGGTTCTTAAATGATTTCGGATATCGAGGACTCAGTGCAGCGCGGAGGCGAAGGCCGAGCGAGGGCGTCCGGCGAATTCGGCTCGGTGACGATGCGAAGTGGTCAAATTTGAGCAGATCTGGTGGTCGGTTTTGTGGTATGTCCGCCTGAGAGTGCAGGAGGCATTCTGAGAGCTCCACTCTGTCGGGTTGGCGTCACATGCGGGAGGACGGCCGCGAATCATGATGAACACTCGCCGAGATTACCGCAATCGCAATTCTCTGTTCGACAGTTTGGAGGAAGGTGGCTTGAGACCAGCTTCCTCATACTCGACCAGCGAAATTGCAGAACAGGAGAATGACCGGGGAATAGATGATCTCAGTGATAGAGTGAACGTGCTGAAGAGGCTGACATCTGATATCCATGGCGAGGTGGATACTCACAATCGGCTGCTGGAGCGCATGGAACAAGATATGGATTCTTCAAGAGGAATGCTCTCTGGAACAATGGATCGCTTCACAAGGGTCTTCGAAACGAAGTCAGGGAGAAACGTTGTCACTATAGTTGGATCTTTGGTGATTGTGTTTCTTCTAGTTTACTACTTGACAAAGTGAAAAGGGAGTCCCATTGGTTTGTGTTATTATAACAGGGAACTTGTTTCTGTAGGGCTGCTTTTAGCCACAACGGCAGTAACAATGAATTGATGTGTGAACAAAGTACCTACTTAAAGGGCAGAACTTTGGAGTACATCTACATGCGTTGGCAATAGATATGAAAGATCAATTAATTATCTGCTGATTTCATTTCTTCCTAACCACTGACTCACCGTACCGTCGTCACTCAGTGTGATCGAAGATTGATGGTTACTAGGAGCGATACAAGAACAAGTGACGATATGTAGGCTAATTTTGGCAATGTCAGTTGAACCACGTTCCAAAGGGACGGTGTTGAGATTTCTACTGTAGGTGCGTATGTGTTTCGGCCGCTGATGTACCCGATGTCCGTTCTTAATGTAAAACGGAAACAAACGACTTAATATTATTACAGAAGTCAAATGCTCATCATACTAAAAAGCAGGGAATATTAAGTTGATCGCCTTAGGCCGCCAATTATTTTACTCCCTTTTGGACGGACATCTACTATCACGAGGTATCTTGTTGTCGAAAGCTGAAATGTTGTGAGACCTTTTTGAACCAATTTGTTGTATTTGATTATAAAGATATGTTCCGAGACTGGCGTTGGTCGACCCG

CDS

>Mapoly0002s0103.1
ATGATGAACACTCGCCGAGATTACCGCAATCGCAATTCTCTGTTCGACAGTTTGGAGGAAGGTGGCTTGAGACCAGCTTCCTCATACTCGACCAGCGAAATTGCAGAACAGGAGAATGACCGGGGAATAGATGATCTCAGTGATAGAGTGAACGTGCTGAAGAGGCTGACATCTGATATCCATGGCGAGGTGGATACTCACAATCGGCTGCTGGAGCGCATGGAACAAGATATGGATTCTTCAAGAGGAATGCTCTCTGGAACAATGGATCGCTTCACAAGGGTCTTCGAAACGAAGTCAGGGAGAAACGTTGTCACTATAGTTGGATCTTTGGTGATTGTGTTTCTTCTAGTTTACTACTTGACAAAGTGA

Protein

>Mapoly0002s0103.1
MMNTRRDYRNRNSLFDSLEEGGLRPASSYSTSEIAEQENDRGIDDLSDRVNVLKRLTSDIHGEVDTHNRLLERMEQDMDSSRGMLSGTMDRFTRVFETKSGRNVVTIVGSLVIVFLLVYYLTK

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>