Mapoly0003s0313



Description

ADP RIBOSYLATION FACTOR-RELATED

Reference DB

Database ID Description
GO GO:0005525 GTP binding
KEGGORTH K07977 Arf/Sar family, other
KOG KOG0070 GTP-binding ADP-ribosylation factor Arf1
OrthoMCL OG5_126696
PFAM PF00025 ADP-ribosylation factor family
PANTHER PTHR11711 ADP RIBOSYLATION FACTOR-RELATED
PANTHER PTHR11711:SF118

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpARFA1 SAR/ARF GTPase Mapoly0003s0313.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0003s0313.1 scaffold_3:3293293..3296358  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0003s0313.1  

Gene structure:

mRNA scaffold_3:3293293..3296358  ( - strand )
three_prime_UTR scaffold_3:3293293..3293825  ( - strand )
CDS scaffold_3:3293826..3293831  ( - strand )
CDS scaffold_3:3294235..3294316  ( - strand )
CDS scaffold_3:3294473..3294591  ( - strand )
CDS scaffold_3:3295205..3295324  ( - strand )
CDS scaffold_3:3295496..3295566  ( - strand )
CDS scaffold_3:3295760..3295907  ( - strand )
five_prime_UTR scaffold_3:3295908..3295958  ( - strand )
five_prime_UTR scaffold_3:3296133..3296358  ( - strand )

Sequences:

Gene

>Mapoly0003s0313.1
CTTCTCTCGCTCTCTCTCTCTCTCTCTCTCCCTCCCACTCTCTCCTCTCTCTCGCGCAGAGCGGAGCCTGAGTTCGTGTGTATCTGTCCGTCCGTCTGTTTGTCTTTCCTTCCTTCCTTCCTTGAGCCCCAGCCAGGCCCCAGCCCCGCCCAGGCCAGAGCGCCGCTTCGACGCTTGTCTTCTCTTTGGTGCTTCGACGCTTGTCTTCTCTTTCGTGCGTCGGTGGGTACGTTGCTTGTGCTTTCGGTGCTGGTGCTGCTGGGATTGCTTTGGTTACGCTTTGCCTGGTGATTGCGATCAATCGATTGCGTGAGGGATCGAAGATCGGCGCTGGTGGGGGCGGGGGTGGATGATTTGGGAGTGCTGAGCGGGTCGGGGTGGGGCTGGTTGATCTTGGCAGGGGCGGAGCAGTTGGTGGTGGCCGGTGATTGTGTAGAGAGCGCGAGCCAAGATGGGGCTCACGTTCACCAAGTTGTTTCAGCGTCTCTTCTCTAAGAAGGAGATGCGAATCTTGATGGTGGGTCTCGATGCGGCTGGTAAGACGACCATTTTGTATAAGTTGAAGCTTGGCGAGATCGTGACGACCATTCCTACAATCGGTGAGTTTCTTGCTTTGTTTTGTTGGGTGCTGAGGTCGCGTTTGTGGTTGGGGTTTTGGTTGGTTTGCTAGCTAGCTAGCTCATGGATTAATTGATCTTCCGATTGAAACCCTTGGATGTGGATGAGAAGTTGATGGTCTTAGGCATAGGCTCTGCGTTTGTCTCACATCTGTTCTCTTCTCTGCACCCGCAGGATTCAATGTCGAGACTGTAGAGTACAAGAACATTAGTTTCACTGTGTGGGATGTAGGAGGTCAGGACAAGGTAAGCTACGCATCTCCATTTTCCAATAAGTCGGATCTGGTTGTCGTTCGGAGCTTGCACCGATTTGGAAAGATGTGCCTAGAAGTATCTTTTGTAGGTCATGAATTAGGTGTACACGGTTTCGTGTCTTGAGGATTTATTGCTAACCCGTCTTGGAATGGAGTAATGCAGATCCGCCCTCTGTGGAGGCACTATTTCCAGAACACGCAGGGTTTGATCTTCGTGGTGGACAGTAACGATAGAGATCGTATTGTTGAGGCCCGTGATGAGTTGCATAGAATGTTGAATGAGGTATGCCGATCCTACCGTTCTGCCTCTCCCAGTTTTTTGTTTGAATTTTCTTCCGTACGTATCTTGATACCTGGCCAGAATCTAGGCTTTCAATTTCCCAGATCCGAGCCTTCATCGCAGCCAGGATAGCATGAAAGTTGCTGTTGGAAATCTGATCTCTTCAGTAGAGCCTTTCATACGTACACGATTAAAGAAGTCTGTAAGCTGCACTTCCAAGCGGTTAACAAGTACTCATCTATAGTGTTGCCAACTGGCCCTACATGTCAGTTCCGTGCCAACATTATGTATCACATCAGAACTTGCGATTTATCCTCGGGATGATTTACGGTTCTTCTCTCTATTTCTTTAATATAGATAAGTTTCACATTCTTGTCACTGGTCTCGAGATTAGGCTTGCTCACCGTGAAAGGTTGCATGGCCGTTTGGTGAAAACAAGAATTGTGAGGCTTCGCTTGCTCACATTTTCGTTTTAGTTTCCTTCCTGTGTGTTATCCCCTAGAGCTTTCAATTAAGTTCGATAAGGTGTCCGGTCTTCATGGGCATCGACCGTCAGCGGTTGTAAAGTAGGATGGATGAGAGCACATTATCATACTGACACGAGGAACCTATGCAGGATGAACTTCGCGATGCCGTATTGTTGGTATTTGCCAACAAACAGGATTTGCCGAACGCCATGAATGCGGCGGAGATTACCGACAAATTGGGGCTTCACTCTTTGCGCCAGCGCCACTGGTAGGAATCTTTCTTGTAGTCTGGGTGTGCAGATCTTCTGATGTTTTGTACCGTTCATTTGACGACCAAGGTTTGCCATGTGTCTTGGCTAGACTAACACAGGATTATATTTCGTAAAAATGATATGCTAACAGATTTTATTATTACCGGTGGCAGGTATATCCAGAGTACATGTGCTACTTCAGGAGAGGGTTTGTACGAGGGTCTTGACTGGCTGTCAAGCAACATCGCAAACAAGGTAGATGTTTTCAATGTTTTGCAAGTGTGCATTATTCGCTGTAGAATGTATGGTTAGAAGTTGTTCTGCATATTCTAGACTTGAAGCATGTATGAAGACATGGTCCAAATCTTCTGATCGGATCATTTGCATGTTGAAGCCTGGGCCATCTACGTCCAAGTAGTAGGACGGATTGAATTCTGCATATAAAGTGCCCGGGCTCTTCACAAGAAAGTGGTGGTCTTCTTGAGGTGACGCTTCTCGTCGTGAATGGATCTTACTTAGCCATCTGCCGAAGCAAGTCATAACCCAGAGGACGTGGTGAATACCGGGCCACAGGCAGATCGATAATGGTTTTGCCTTGGTTTTGAGTTTGGAGCCTGGCTGAGGAGTGTCTTATTTTTTTGCTGTCTATTTTATGCAGGCTTGATTCAGTACGGCTTAGACACTAGGTGGAAAGCCACAAGGTAGCGCAGACAGTGTTAGTCTCGCGGCAGTGGGATTTCTGTGGTGTTGGAGGGCTCGTCAAGCTGCAGCTGGCGTGACTGGGGTTCTTTATAATATGGATGATAAACAGTCGCAGATTCTCCTAAGATTTCGTTGAGTGAAGGGCAAGTTTAGATCAACGAAGTCTGCAGAATTCTTTTTCTGAACTTTCTCTCTTTCGACAACCTAAGTCATTGCTTGCTATCCTCTGACTCCGGTGGTAGGAGAAACGTTAAAATCTTGAAGAGGTGTTCAAGATAGGATTGACAGATAGGCATGATAGATTTTGTTGCGAAAGTTTTCCGAACTCGTAGTTTTTGAGTGTTTTCCTTCCTACAACAATCAAGAGGTTGTTGGGACCTTATTGCTCTACTCGTGTACAAGTGCAAGATATTCTTTATCTATGTCTGTACCCAAGTCATGTAGAAATGTTGTTGAGCACTTCAATCTATGATACCACAATCGATACTTTCCATC

mRNA

>Mapoly0003s0313.1
CTTCTCTCGCTCTCTCTCTCTCTCTCTCTCCCTCCCACTCTCTCCTCTCTCTCGCGCAGAGCGGAGCCTGAGTTCGTGTGTATCTGTCCGTCCGTCTGTTTGTCTTTCCTTCCTTCCTTCCTTGAGCCCCAGCCAGGCCCCAGCCCCGCCCAGGCCAGAGCGCCGCTTCGACGCTTGTCTTCTCTTTGGTGCTTCGACGCTTGTCTTCTCTTTCGTGCGTCGGTGGGGGCGGAGCAGTTGGTGGTGGCCGGTGATTGTGTAGAGAGCGCGAGCCAAGATGGGGCTCACGTTCACCAAGTTGTTTCAGCGTCTCTTCTCTAAGAAGGAGATGCGAATCTTGATGGTGGGTCTCGATGCGGCTGGTAAGACGACCATTTTGTATAAGTTGAAGCTTGGCGAGATCGTGACGACCATTCCTACAATCGGATTCAATGTCGAGACTGTAGAGTACAAGAACATTAGTTTCACTGTGTGGGATGTAGGAGGTCAGGACAAGATCCGCCCTCTGTGGAGGCACTATTTCCAGAACACGCAGGGTTTGATCTTCGTGGTGGACAGTAACGATAGAGATCGTATTGTTGAGGCCCGTGATGAGTTGCATAGAATGTTGAATGAGGATGAACTTCGCGATGCCGTATTGTTGGTATTTGCCAACAAACAGGATTTGCCGAACGCCATGAATGCGGCGGAGATTACCGACAAATTGGGGCTTCACTCTTTGCGCCAGCGCCACTGGTATATCCAGAGTACATGTGCTACTTCAGGAGAGGGTTTGTACGAGGGTCTTGACTGGCTGTCAAGCAACATCGCAAACAAGGCTTGATTCAGTACGGCTTAGACACTAGGTGGAAAGCCACAAGGTAGCGCAGACAGTGTTAGTCTCGCGGCAGTGGGATTTCTGTGGTGTTGGAGGGCTCGTCAAGCTGCAGCTGGCGTGACTGGGGTTCTTTATAATATGGATGATAAACAGTCGCAGATTCTCCTAAGATTTCGTTGAGTGAAGGGCAAGTTTAGATCAACGAAGTCTGCAGAATTCTTTTTCTGAACTTTCTCTCTTTCGACAACCTAAGTCATTGCTTGCTATCCTCTGACTCCGGTGGTAGGAGAAACGTTAAAATCTTGAAGAGGTGTTCAAGATAGGATTGACAGATAGGCATGATAGATTTTGTTGCGAAAGTTTTCCGAACTCGTAGTTTTTGAGTGTTTTCCTTCCTACAACAATCAAGAGGTTGTTGGGACCTTATTGCTCTACTCGTGTACAAGTGCAAGATATTCTTTATCTATGTCTGTACCCAAGTCATGTAGAAATGTTGTTGAGCACTTCAATCTATGATACCACAATCGATACTTTCCATC

CDS

>Mapoly0003s0313.1
ATGGGGCTCACGTTCACCAAGTTGTTTCAGCGTCTCTTCTCTAAGAAGGAGATGCGAATCTTGATGGTGGGTCTCGATGCGGCTGGTAAGACGACCATTTTGTATAAGTTGAAGCTTGGCGAGATCGTGACGACCATTCCTACAATCGGATTCAATGTCGAGACTGTAGAGTACAAGAACATTAGTTTCACTGTGTGGGATGTAGGAGGTCAGGACAAGATCCGCCCTCTGTGGAGGCACTATTTCCAGAACACGCAGGGTTTGATCTTCGTGGTGGACAGTAACGATAGAGATCGTATTGTTGAGGCCCGTGATGAGTTGCATAGAATGTTGAATGAGGATGAACTTCGCGATGCCGTATTGTTGGTATTTGCCAACAAACAGGATTTGCCGAACGCCATGAATGCGGCGGAGATTACCGACAAATTGGGGCTTCACTCTTTGCGCCAGCGCCACTGGTATATCCAGAGTACATGTGCTACTTCAGGAGAGGGTTTGTACGAGGGTCTTGACTGGCTGTCAAGCAACATCGCAAACAAGGCTTGA

Protein

>Mapoly0003s0313.1
MGLTFTKLFQRLFSKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYIQSTCATSGEGLYEGLDWLSSNIANKA

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>