Mapoly0004s0047



Description

Protein of unknown function DUF260

Reference DB

Database ID Description
OrthoMCL OG5_150318
PFAM PF03195 Protein of unknown function DUF260

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpASLBD1 transcription factor, ASL/LBD Mapoly0004s0047.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0004s0047.1 scaffold_4:543923..545419  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0004s0047.1  

Gene structure:

mRNA scaffold_4:543923..545419  ( + strand )
five_prime_UTR scaffold_4:543923..544644  ( + strand )
CDS scaffold_4:544645..545037  ( + strand )
three_prime_UTR scaffold_4:545038..545419  ( + strand )

Sequences:

Gene

>Mapoly0004s0047.1
CGTGCTTGTCATTTTCTTGTCATTTCAAGTGCTTTTTGCAGGAGTGACAGCATGGAGTCAGGATGGATTGTGCACGATCCATCGTGGGATGGCCCTTCGAATTCATTAATCTTGAATTGGTCAAATGGGTATAAGTTTGTGCAGCTAAACCCGTCCCATCTAGCATTGAGTGCAACAAGGAGGGCATATCAATCATTGGTGGGCGGAAGGGACGAGGATGTACGTTACGTGGAATGCTGCTTGGGGTCCATATTTGAGCTTGGGAAGGTTTCAGAAACTCTTTCACCATGTTGTTTGGTTCTTGAAAGAATCAGGACAAGGGCGTCGGTGTGCAGCACCAACCGCTGCTTATTTTTCTTGCGGTTGTTGCTTATTGTAGGCGAGCCAAAAGTGACGATTTCACCCGCGTTTTTGATGTGCTACGTCTACGATAAGCTGTCGATGGGAGTAGCGTAGTAGGTATAGCGTATTCACATTGAAGATTTACATCATGACTGACAGCGATGTCTAATCAGACATCGTCATCATGTAAGAGAAAATATAAAAGTCATGATGTATTGTCTGGAAGTTATTTGATTTTCCGCAAGGGGTACATGCGATTGCTTCCTGGCATTGTGGTTTCATCGAGCATAGGCTCCACTCCGAACGTTGCCTGCAAGTTCCAGCGTCGGAAATGCCCTGTGGACTGCTTGTTGGCGCCGTAGTTCCCTCCGGACCAGCCCATGTGCTTTGCCAACGCGCACAGGCTCTTCCGAGTAGCGAACATATCGAGGCTTATACGAGAGAATCGGAGCTCCGTCGAGAATGTGATGAAGAGTGTCTGCTTCGAGTCTAACACTCGGGAACGAGATCTTGTCAATGGAATATATGGGACATTACGATATTTTCAGCGAGAGGCCGAGAGACTGGAGGAGAACAGAACGGCTTGGTCTGCATTCTTCGGAGTATTACAGGTCCTTCAGAGTATTACGCACATGCACTGCCTACTTAGGTCGCCTTTACAAAGACAACGTCAGCGCTGCAAGACAACGATGTTTATCATATGTTGCAGCAGCATCTACAACAGCAACAACTGCATTACATGCAGATGCCCCAGCAGCAGATGTCTTCTCTAGAGTGTTTTGTTAGAGTATTTTGTTAATTTTAATGCCGGTGGTGGAGGCTTTAATCCGGTGGAAACAACGGACGTGTCGACCTCTATCCACTTATGCACCTCATAGATAGAAGTGCAGAAGTTACTCTTCATCGGGCCTCTTCTTCGTACACTGGAACAGCAGCGAGAGACTTTCTCTCCCTCACACACAACTCTTAACTCTCGCTATTATTGACTTTTGTTGTAATTGCAGATAATACAGAATCTGCAGCTTTACATCGTTAATTTTTTTTTCTTTCTGTTTCTTTTCTCCACAGCTATAAATCTATCCAGACGCACATGCAATGTCTTCCCAGGATTTTATATTTTATGACAAACTAATAAAAAACATGGCTGATTCGCCC

mRNA

>Mapoly0004s0047.1
CGTGCTTGTCATTTTCTTGTCATTTCAAGTGCTTTTTGCAGGAGTGACAGCATGGAGTCAGGATGGATTGTGCACGATCCATCGTGGGATGGCCCTTCGAATTCATTAATCTTGAATTGGTCAAATGGGTATAAGTTTGTGCAGCTAAACCCGTCCCATCTAGCATTGAGTGCAACAAGGAGGGCATATCAATCATTGGTGGGCGGAAGGGACGAGGATGTACGTTACGTGGAATGCTGCTTGGGGTCCATATTTGAGCTTGGGAAGGTTTCAGAAACTCTTTCACCATGTTGTTTGGTTCTTGAAAGAATCAGGACAAGGGCGTCGGTGTGCAGCACCAACCGCTGCTTATTTTTCTTGCGGTTGTTGCTTATTGTAGGCGAGCCAAAAGTGACGATTTCACCCGCGTTTTTGATGTGCTACGTCTACGATAAGCTGTCGATGGGAGTAGCGTAGTAGGTATAGCGTATTCACATTGAAGATTTACATCATGACTGACAGCGATGTCTAATCAGACATCGTCATCATGTAAGAGAAAATATAAAAGTCATGATGTATTGTCTGGAAGTTATTTGATTTTCCGCAAGGGGTACATGCGATTGCTTCCTGGCATTGTGGTTTCATCGAGCATAGGCTCCACTCCGAACGTTGCCTGCAAGTTCCAGCGTCGGAAATGCCCTGTGGACTGCTTGTTGGCGCCGTAGTTCCCTCCGGACCAGCCCATGTGCTTTGCCAACGCGCACAGGCTCTTCCGAGTAGCGAACATATCGAGGCTTATACGAGAGAATCGGAGCTCCGTCGAGAATGTGATGAAGAGTGTCTGCTTCGAGTCTAACACTCGGGAACGAGATCTTGTCAATGGAATATATGGGACATTACGATATTTTCAGCGAGAGGCCGAGAGACTGGAGGAGAACAGAACGGCTTGGTCTGCATTCTTCGGAGTATTACAGGTCCTTCAGAGTATTACGCACATGCACTGCCTACTTAGGTCGCCTTTACAAAGACAACGTCAGCGCTGCAAGACAACGATGTTTATCATATGTTGCAGCAGCATCTACAACAGCAACAACTGCATTACATGCAGATGCCCCAGCAGCAGATGTCTTCTCTAGAGTGTTTTGTTAGAGTATTTTGTTAATTTTAATGCCGGTGGTGGAGGCTTTAATCCGGTGGAAACAACGGACGTGTCGACCTCTATCCACTTATGCACCTCATAGATAGAAGTGCAGAAGTTACTCTTCATCGGGCCTCTTCTTCGTACACTGGAACAGCAGCGAGAGACTTTCTCTCCCTCACACACAACTCTTAACTCTCGCTATTATTGACTTTTGTTGTAATTGCAGATAATACAGAATCTGCAGCTTTACATCGTTAATTTTTTTTTCTTTCTGTTTCTTTTCTCCACAGCTATAAATCTATCCAGACGCACATGCAATGTCTTCCCAGGATTTTATATTTTATGACAAACTAATAAAAAACATGGCTGATTCGCCC

CDS

>Mapoly0004s0047.1
ATGTGCTTTGCCAACGCGCACAGGCTCTTCCGAGTAGCGAACATATCGAGGCTTATACGAGAGAATCGGAGCTCCGTCGAGAATGTGATGAAGAGTGTCTGCTTCGAGTCTAACACTCGGGAACGAGATCTTGTCAATGGAATATATGGGACATTACGATATTTTCAGCGAGAGGCCGAGAGACTGGAGGAGAACAGAACGGCTTGGTCTGCATTCTTCGGAGTATTACAGGTCCTTCAGAGTATTACGCACATGCACTGCCTACTTAGGTCGCCTTTACAAAGACAACGTCAGCGCTGCAAGACAACGATGTTTATCATATGTTGCAGCAGCATCTACAACAGCAACAACTGCATTACATGCAGATGCCCCAGCAGCAGATGTCTTCTCTAG

Protein

>Mapoly0004s0047.1
MCFANAHRLFRVANISRLIRENRSSVENVMKSVCFESNTRERDLVNGIYGTLRYFQREAERLEENRTAWSAFFGVLQVLQSITHMHCLLRSPLQRQRQRCKTTMFIICCSSIYNSNNCITCRCPSSRCLL

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>