Mapoly0005s0152



Description

TRANSCRIPTIONAL ACTIVATOR HAP5

Reference DB

Database ID Description
GO GO:0003700 Sequence-specific DNA binding transcription factor activity
GO GO:0005622 Intracellular
GO GO:0006355 Regulation of transcription, DNA-dependent
GO GO:0016602 CCAAT-binding factor complex
GO GO:0043565 Sequence-specific DNA binding
KOG KOG1657 CCAAT-binding factor, subunit C (HAP5)
OrthoMCL OG5_152404
PFAM PF00808 Histone-like transcription factor (CBF/NF-Y) and archaeal histone
PANTHER PTHR10252 HISTONE-LIKE TRANSCRIPTION FACTOR CCAAT-RELATED
PANTHER PTHR10252:SF8 TRANSCRIPTIONAL ACTIVATOR HAP5

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpCCAAT-NFYC1 transcription factor, CCAAT-NFYC Mapoly0005s0152.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0005s0152.1 scaffold_5:1699394..1702131  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0005s0152.1  

Gene structure:

mRNA scaffold_5:1699394..1702131  ( + strand )
five_prime_UTR scaffold_5:1699394..1700402  ( + strand )
CDS scaffold_5:1700403..1701260  ( + strand )
three_prime_UTR scaffold_5:1701261..1702131  ( + strand )

Sequences:

Gene

>Mapoly0005s0152.1
CTCGCTCGCTCTCTCTCTTCTTCCCATTCGCCTTTTTCTATCTGTCTGCCTGCAGAGGAATTGTATGCGCTCGCGCTTCCCGTCCCAATCCCCCTCCTCCCCACCCAGCCCCGCAATCTCGCAGTCTCCCTCACCCCCCGCCTCCTGCTGCTGCTTCTCCTCGCTCGCACTGCACTATCACTCTCTCTCTCTCTCTCTCAACGAACCGAACGTGCTGGACGCTCGCTCCTCATCTGTCGTTGTGTCTGCGTGCGCGTGTCCCCCCTCCTCCCGCCCCCCCTCCCCTCACGAAGTGTCGATTGTAGCTACTCTTCCATTGTGGCCTTCCGAGTCCAGTTGTCGACGTAGAGACGGAGAGTCATCGAGGTCGAGAGACGAGGTGGCGGTTTTCTCATCGGAACGATTTCCGAGTTTGAAGTTTCGTCTGCAGTTTTCGACAAGGTGAGGGAGAGATAGAGATAGAGAGATAGAGAGAGAGAGAGAAGTGAAAAGGAAGTGAAAAGCGTGCGTAAGAAGAACTGAAGTGCCTCGTTTGTGCGGGACTGACTTTCGGGCTCGGTAGGATCTGCAGCGAGAGTGTAATGCGCGGGCACAGGCCTGGGTTTGGTGCTGCGTCCGAGTGTTGATAGCTATGGCAGCGGGGTTCGGGCTCCCTCCGTGTAGTTTGAGATAGTTGTGGCTGCTCCCCGAGCAGCAGAGCGCGAGGGAGGGAGGGAGGGAGGGCAAGGAGAACTCACACGCTTGTCACGAAGATTGCCCCACTGGTTCTGGGAGCAGTAGAAGACCGAGGTCACACTCGAACCACTTAATCAGTCGACTCGACAGAATTGAATCCCCGAAGGAGCAGCAGTCCGGTACCTTGCTCGAGGGACGGGAGAAAGGATAGAGGAACGAAGGAGCTGAAGCAGTTAGAGCAGCGCGGGCAGCAGGGGTTAGTTAGGAGGCGATAGCGTGGTCGGAGAAGGTCGGAGGGCGGAGCCAATTGCTTGCTGCACGTGAGAGAGTAGTCATGGATATGGCGCAGCAGCCGATGAATATGATGCCGGGGCAACAGCAAATGCAGTATCCTCAGATGGCCCAGAATCCTCAGATGCAAGCGCAGATGCAACAGCCGTATCCGCAAGGCTCGCCGGGAGTGCCGTCGCCCCCTGGCCCATCGGGACAGCCGCAGGGTCCGTATCCCGGGGCGCTCGCGCAACAGCAGGTCAGTTTCCAGCATCTGCAGCAGCAGCACCAGCAGCAATTGCAGATGTTCTGGCACAGTCAAATGAACGAAATTGAGCAGGTGTCGGATTTCAAGACGCACCAGCTTCCTTTGGCTCGAATCAAGAAAATCATGAAAGCAGACGAAGACGTAAGAATGATCTCAGCTGAGGCGCCCGTCCTCTTCGCCAAGGCGTGCGAAATGTTCATTCTCGAGTTGACTCTCCGGTCGTGGATTCACACGGAAGAGAACAAGCGCCGGACCCTGCAAAAGAACGACATCGCTGCAGCCATCACGCGCACGGACATCTTCGATTTCTTGGTCGATATCGTGCCCCGCGACGAGCTCAAAGACGAGACTGCTCTGGGCGGGGTGCCCCGCGCAGCTCTGCCCGTGGGCTCGCCAGCTGATGCCATTCCTTACGGCGGTGGCATGTACTACGTCGCCACGGGCCAACCTCAGGGCGGGCCTCCCATGCAGCAGGGGCAGCCGAACATGATGGGCTCTCCGGCTATGATGGTTGGGAGGCCCGGAATGCCCATGGATCCGGCCATGTATGGCCAACAGGCCAGACCTCCGACGATGCAGTACATGCCGCCACAATCAATGCAGCAGATGTGGCCGCAGTCCGGCTCGTCACCAGGAATACCGCCGAGTAGTTGAATGAGGATCACACTGGGGCTTCTCAACTGGAAGTCGCGTCGTGTGCAGTGCAGCAGCTCGATGGTTGATTGTAATTAGTGGAAGTTGGAACTCGATGTGCAAATTCCTTTTCTGCTTACAAGAGTCTGAGAAGGAGTAGGACCAGTGAGTAGGGGCAAGATACAAACACTGGGCGGCGATAAGGCTGGAGTCGTTTGTGTAGATAGCCGTATTGCCGCCATACGGGACCAGGGAGTTCTTGATATGACAATCTAGAATGCAGAGCACCTTCTTGAATCACCACCATGAAGCCTTAGAGATGCAATTCGAAGACTCTATCAAGGAATTTGTGGTAGGTTATTTTTATTTTCCAGGATTCCAAATTTTTAGGACCTTGTGATATAGCTGCTGCTTTTGGTCCTTGCTCTGGCATTAAGAATCGACAGGAAGGCAGCAAATATGCTGCAAACACTCCGATGATGGTGATTGTATGATTTGACCATAGTAAATTTCGCTATTTTGTTGATTAATCGAACTCTACGTGCCTGGTTCACTCTGGTCTCAGATCTCTAATCAGGTCCCATGCAATTGGTGTCGTGAAGTCAAGTTCTTCCACTGTCTGTTTTCTGTGAGAAAATCTCAATTCTGGCTGTTTCATCTGCTGAATTTGTGCTAGTTGTGTAGAGGGAGCACATCCTGTACGACTGTAAGTCGTACAGCATGATTGTCAGGTTTGACTGCTATGTATCACATTCTGTTCCACACATGTTATATTCAGATCTGAGTCAGCATAGCTGTTCCTGATTTCAGGCACTTAGTATTACTGCTGTGCAATATCTGAAAACGAAACCGCTTGTTGAGATCCCACACCAGCAGTTACGGCAAGGACAGC

mRNA

>Mapoly0005s0152.1
CTCGCTCGCTCTCTCTCTTCTTCCCATTCGCCTTTTTCTATCTGTCTGCCTGCAGAGGAATTGTATGCGCTCGCGCTTCCCGTCCCAATCCCCCTCCTCCCCACCCAGCCCCGCAATCTCGCAGTCTCCCTCACCCCCCGCCTCCTGCTGCTGCTTCTCCTCGCTCGCACTGCACTATCACTCTCTCTCTCTCTCTCTCAACGAACCGAACGTGCTGGACGCTCGCTCCTCATCTGTCGTTGTGTCTGCGTGCGCGTGTCCCCCCTCCTCCCGCCCCCCCTCCCCTCACGAAGTGTCGATTGTAGCTACTCTTCCATTGTGGCCTTCCGAGTCCAGTTGTCGACGTAGAGACGGAGAGTCATCGAGGTCGAGAGACGAGGTGGCGGTTTTCTCATCGGAACGATTTCCGAGTTTGAAGTTTCGTCTGCAGTTTTCGACAAGGTGAGGGAGAGATAGAGATAGAGAGATAGAGAGAGAGAGAGAAGTGAAAAGGAAGTGAAAAGCGTGCGTAAGAAGAACTGAAGTGCCTCGTTTGTGCGGGACTGACTTTCGGGCTCGGTAGGATCTGCAGCGAGAGTGTAATGCGCGGGCACAGGCCTGGGTTTGGTGCTGCGTCCGAGTGTTGATAGCTATGGCAGCGGGGTTCGGGCTCCCTCCGTGTAGTTTGAGATAGTTGTGGCTGCTCCCCGAGCAGCAGAGCGCGAGGGAGGGAGGGAGGGAGGGCAAGGAGAACTCACACGCTTGTCACGAAGATTGCCCCACTGGTTCTGGGAGCAGTAGAAGACCGAGGTCACACTCGAACCACTTAATCAGTCGACTCGACAGAATTGAATCCCCGAAGGAGCAGCAGTCCGGTACCTTGCTCGAGGGACGGGAGAAAGGATAGAGGAACGAAGGAGCTGAAGCAGTTAGAGCAGCGCGGGCAGCAGGGGTTAGTTAGGAGGCGATAGCGTGGTCGGAGAAGGTCGGAGGGCGGAGCCAATTGCTTGCTGCACGTGAGAGAGTAGTCATGGATATGGCGCAGCAGCCGATGAATATGATGCCGGGGCAACAGCAAATGCAGTATCCTCAGATGGCCCAGAATCCTCAGATGCAAGCGCAGATGCAACAGCCGTATCCGCAAGGCTCGCCGGGAGTGCCGTCGCCCCCTGGCCCATCGGGACAGCCGCAGGGTCCGTATCCCGGGGCGCTCGCGCAACAGCAGGTCAGTTTCCAGCATCTGCAGCAGCAGCACCAGCAGCAATTGCAGATGTTCTGGCACAGTCAAATGAACGAAATTGAGCAGGTGTCGGATTTCAAGACGCACCAGCTTCCTTTGGCTCGAATCAAGAAAATCATGAAAGCAGACGAAGACGTAAGAATGATCTCAGCTGAGGCGCCCGTCCTCTTCGCCAAGGCGTGCGAAATGTTCATTCTCGAGTTGACTCTCCGGTCGTGGATTCACACGGAAGAGAACAAGCGCCGGACCCTGCAAAAGAACGACATCGCTGCAGCCATCACGCGCACGGACATCTTCGATTTCTTGGTCGATATCGTGCCCCGCGACGAGCTCAAAGACGAGACTGCTCTGGGCGGGGTGCCCCGCGCAGCTCTGCCCGTGGGCTCGCCAGCTGATGCCATTCCTTACGGCGGTGGCATGTACTACGTCGCCACGGGCCAACCTCAGGGCGGGCCTCCCATGCAGCAGGGGCAGCCGAACATGATGGGCTCTCCGGCTATGATGGTTGGGAGGCCCGGAATGCCCATGGATCCGGCCATGTATGGCCAACAGGCCAGACCTCCGACGATGCAGTACATGCCGCCACAATCAATGCAGCAGATGTGGCCGCAGTCCGGCTCGTCACCAGGAATACCGCCGAGTAGTTGAATGAGGATCACACTGGGGCTTCTCAACTGGAAGTCGCGTCGTGTGCAGTGCAGCAGCTCGATGGTTGATTGTAATTAGTGGAAGTTGGAACTCGATGTGCAAATTCCTTTTCTGCTTACAAGAGTCTGAGAAGGAGTAGGACCAGTGAGTAGGGGCAAGATACAAACACTGGGCGGCGATAAGGCTGGAGTCGTTTGTGTAGATAGCCGTATTGCCGCCATACGGGACCAGGGAGTTCTTGATATGACAATCTAGAATGCAGAGCACCTTCTTGAATCACCACCATGAAGCCTTAGAGATGCAATTCGAAGACTCTATCAAGGAATTTGTGGTAGGTTATTTTTATTTTCCAGGATTCCAAATTTTTAGGACCTTGTGATATAGCTGCTGCTTTTGGTCCTTGCTCTGGCATTAAGAATCGACAGGAAGGCAGCAAATATGCTGCAAACACTCCGATGATGGTGATTGTATGATTTGACCATAGTAAATTTCGCTATTTTGTTGATTAATCGAACTCTACGTGCCTGGTTCACTCTGGTCTCAGATCTCTAATCAGGTCCCATGCAATTGGTGTCGTGAAGTCAAGTTCTTCCACTGTCTGTTTTCTGTGAGAAAATCTCAATTCTGGCTGTTTCATCTGCTGAATTTGTGCTAGTTGTGTAGAGGGAGCACATCCTGTACGACTGTAAGTCGTACAGCATGATTGTCAGGTTTGACTGCTATGTATCACATTCTGTTCCACACATGTTATATTCAGATCTGAGTCAGCATAGCTGTTCCTGATTTCAGGCACTTAGTATTACTGCTGTGCAATATCTGAAAACGAAACCGCTTGTTGAGATCCCACACCAGCAGTTACGGCAAGGACAGC

CDS

>Mapoly0005s0152.1
ATGGATATGGCGCAGCAGCCGATGAATATGATGCCGGGGCAACAGCAAATGCAGTATCCTCAGATGGCCCAGAATCCTCAGATGCAAGCGCAGATGCAACAGCCGTATCCGCAAGGCTCGCCGGGAGTGCCGTCGCCCCCTGGCCCATCGGGACAGCCGCAGGGTCCGTATCCCGGGGCGCTCGCGCAACAGCAGGTCAGTTTCCAGCATCTGCAGCAGCAGCACCAGCAGCAATTGCAGATGTTCTGGCACAGTCAAATGAACGAAATTGAGCAGGTGTCGGATTTCAAGACGCACCAGCTTCCTTTGGCTCGAATCAAGAAAATCATGAAAGCAGACGAAGACGTAAGAATGATCTCAGCTGAGGCGCCCGTCCTCTTCGCCAAGGCGTGCGAAATGTTCATTCTCGAGTTGACTCTCCGGTCGTGGATTCACACGGAAGAGAACAAGCGCCGGACCCTGCAAAAGAACGACATCGCTGCAGCCATCACGCGCACGGACATCTTCGATTTCTTGGTCGATATCGTGCCCCGCGACGAGCTCAAAGACGAGACTGCTCTGGGCGGGGTGCCCCGCGCAGCTCTGCCCGTGGGCTCGCCAGCTGATGCCATTCCTTACGGCGGTGGCATGTACTACGTCGCCACGGGCCAACCTCAGGGCGGGCCTCCCATGCAGCAGGGGCAGCCGAACATGATGGGCTCTCCGGCTATGATGGTTGGGAGGCCCGGAATGCCCATGGATCCGGCCATGTATGGCCAACAGGCCAGACCTCCGACGATGCAGTACATGCCGCCACAATCAATGCAGCAGATGTGGCCGCAGTCCGGCTCGTCACCAGGAATACCGCCGAGTAGTTGA

Protein

>Mapoly0005s0152.1
MDMAQQPMNMMPGQQQMQYPQMAQNPQMQAQMQQPYPQGSPGVPSPPGPSGQPQGPYPGALAQQQVSFQHLQQQHQQQLQMFWHSQMNEIEQVSDFKTHQLPLARIKKIMKADEDVRMISAEAPVLFAKACEMFILELTLRSWIHTEENKRRTLQKNDIAAAITRTDIFDFLVDIVPRDELKDETALGGVPRAALPVGSPADAIPYGGGMYYVATGQPQGGPPMQQGQPNMMGSPAMMVGRPGMPMDPAMYGQQARPPTMQYMPPQSMQQMWPQSGSSPGIPPSS

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>