Mapoly0006s0064



Description

Zinc knuckle

Reference DB

Database ID Description
GO GO:0003676 Nucleic acid binding
GO GO:0008270 Zinc ion binding
OrthoMCL OG5_130047
PFAM PF00098 Zinc knuckle
PFAM PF14392 Zinc knuckle
PANTHER PTHR23002 ZINC FINGER CCHC DOMAIN CONTAINING PROTEIN

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpC2H2-2 transcription factor, C2H2-ZnF Mapoly0006s0064.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0006s0064.1 scaffold_6:731851..739889  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0006s0064.1  

Gene structure:

mRNA scaffold_6:731851..739889  ( - strand )
three_prime_UTR scaffold_6:731851..732597  ( - strand )
CDS scaffold_6:732598..732827  ( - strand )
CDS scaffold_6:735485..735575  ( - strand )
CDS scaffold_6:735874..735965  ( - strand )
CDS scaffold_6:736172..736319  ( - strand )
CDS scaffold_6:738745..738918  ( - strand )
CDS scaffold_6:739398..739658  ( - strand )
five_prime_UTR scaffold_6:739659..739889  ( - strand )

Sequences:

Gene

>Mapoly0006s0064.1
AGACCAGCATTCAAGGCAGACTGTATCGTGTTGAAATGTCGTTCATTGGGATTACAAAATCACGGGGGATCGAAATCGAAATAGAAAGTCAGAAGTAGAGGAAAATTTGTAGAGCTGCTAAAACCCTAGAACCCTGGTTCGGCGAATCGGTTTAGTGCTCGTCTCACGAAGGAAAGTTTGTTAGCGCTACATCTGCTCTCCGTGCTTCTCCAATCGCCTGCGGTCTATGTGATGGGAAATGCTCGTCAGAGAGCTGCACGCAAGAAATTGGCTCAGTCAGGCGACGGTGGTGAGCCTAACGTAGTGCTGAAGAAGCAGAACTCGGAGAATCATGGAGCGGAAGTTTTGGAATCCGGGAAGAAGAAGAAGATTAGCGGACCGAAGAAACGTAAGAGAAATGACGAAGGAGAGAATGTGGGCAACGATGACGGAGAAGTCGTTCAGTCCGTTTCCAATGGGTCTGAGAAAGCTGAGTCTGGGGATAACTTGAAGGTGAGGTCAAATCAGCTAGCTTGTATAAGTCGCCGTGTTCATCCTGCAGATTCGAAAGTTGAGGTTGATTATAGGTCCACAGCGAATGTTGACTGCTTAGAACTGATGCCTGCTTTCAGGCACTTCTTGGATGATCGGTCCCTTCGCGAAAGACAATTACAGCCCTGTGTGTGAACATGTTTGAAATGAAAGGGTGAGTTCAGGCGCTGGAGAATACTGCATCTGCTGCTTTTCCATGAGTACTTTAATTCTGGGTTGAGGGCTTCAGTGGCTGCATCTGTTCACTGCATTAAATTTGTTCCTTTCTGTACAAGTCAAGTATTTTCCAGTAATTTTCGACTTTCTGCTCTTGGTTACTACTTTTTGAATCAGTGCCGACTTGGATGATTGTCTTCGAATAAATATTCTCGTCTTTGCAGCTGGGAACACAACGTTGCATTTAGTTTTGGACTAAGAGTAGTCGTTTTGATGGGATTCAGGGAACGGGTCAAGGTCCGAAGAGAGCGAAAGATGATAAAGCCTCGAAGAAAACTGGGAGTAAACATCCTCTACGCGTAGCAGGGATGAGACCCGGTGAAGGCTGCTTCCTGTGCAAGGGTACCGATCACATCGCTAAGTTTTGCCCAACGAAAAGCTCCGCAGATCGGAAGAAGGTTAGTGTTTTTTGCCGTGGCGAGGGACTCAACGTACATTTTGCTTTAAGTACGATGGCTATCTTGCGCAGCGCACATATCGTCAATTATGAGTCAGGTAGAAATAACACAATCTCTCAATGATATTTCGTATCAATGAGAGAAAAATGAAATTGTCTTTTGTTTTGAGATTCTAATCGTCTCATTTGTAGTGGAGTCTAGCATCGGCTCATTGGCAACTTCTTTCCAACGGCCTTTTAGGTTGCTAAACACTCGTTTCTGTTTTTCCTTTTGAATGTGAACTTCAGTTGTGACTCATTTGGATCTTGTGTGTCTTACAACCTCGTGGAAATAAGAAATAAGTAAGGACGAAGTTTTCGTCGAAGTTCAACAAAGAGGAGTGTTGCCAAATCTTGGTGTGTCTCCAACTTGTAGAAACCTCGAGGACACTTGTTGTGTTGCAACGTGACTCAGATTGTTATACTTGCTACTTTCTGGAGGTTTAGATTTGTGGAGAATTCTTTGCAGCTTTGCGAAGGAAATTCCAAGGAGGAGTGACGGGAATCTGACGCTTCCCGTGCAGGCATTGTTGATGGTCCTTGGAGGACTGTCTTCTGTCGGAACCAATACCCTGTTCCGCCCACTCTCTTACCACCACTGTTACTTCGACAGCAGGACTGTCCGTGTACTCCACAGTGTTACTATCTCTGACTTCTCCGAATGCATCCATCGGTTTGTCTTTGCGCTTTGTAATGTAGTATATCTCGTCGGCACCTTCGTGACGAGACACCTAGACTTCCGTTGCATCGATCTCGTACATGCTAAGCATTGCCGCTACCCATCTGCTATTTATTCTGTAGCTCTGCGAATATTGTAGATGTTACGCATTCTAGTGCGCTTCAGATCCTGCGAGAGCCTGCGTAAAAAGTGTTGTGTTGTCCTGGAATTGGAGAGCAGAGTTTCAGTCCAAGGCCACTGCACCACTGGCCATAATGCACACCGTTGCAATGGCTGCCAGCAATTTACTTGTTTAGCTTAGATTTGTCCTAACCTTGCTAATTAAGGTAACGAGGTCTATGGTCTTTAGCCTGTTACAGACAATACCAAGACGATCGGTCATTGATGAATACGCCATTTAACTTCGCCATATGTAATCTTATTGATGCCCTAGATACTGTCCTTTACATGACTCTACAAAGTCAGGTAGACCATTGACCCCGTTACAGACTGGAGTTGGGAACTTGCCTCTGGAACTTTGTCTTTGTTAGCAAGATGCAGATCCTTTCGAAATTTCGGTGACCAGTGATGGCGATCTAGAGCAAGATGGCAGGGTGGAAACTGAATCAAGCTTTCCCCTTTCCAGTCCTTAACCTTTGGGTTAAGGACTGGAAAGGGGAAAGCTTGATTCAGTTTCATGGGACTCCTTGCGGAGGTACCTGTTGGAACTCAACGTCCCGAATGTCTTCTATCTCAACCACTAGAAGAACAAGATGGAGAACCACACTGCAACATGCTCTCCTTGTGGCGTGCATTCTTCGTTTGTAGCGAGATTCGTGGGGCTTTTTGTGACAGCTGGAAACTTCGAACTGACCACATCTAAAGGACATCGTCCACTACGTTAAAGATTGTAATGGACGTTATTCCACTCTTCTTCGTTACAAGCTCTATGTGCAGTTTGCTTTCAAATTCACAAACTTTGTTTACCTCTGCATTTTTAAGTGTCGTACAAGCATTGGCACAAATATCAGTCACACGGTTAATCTTTTGCTCGTTTGCTTGAGTTCTCCCCTCGAGGAGTCAAGTAAACGAAGAATGTGCTTTAAAAGTTCTAGCAAATTCAACTCTTTTCTGTCTTCCCTTTACCATTCACGGAAGAAACCTCTACATCAGTAGTAGTTTAAATAGTAGTACCTATCCTCCTCTTACTACCACAGCAATGACAATCCCTTCCCATCGTCTAGTGCTTTTTTTGAATTATTGCTTTTTGAGGCCTTCGTTGAGTCTGAATTCAATCTTGTATAATTGTATCTGATCATTTTGACCTTTTCAACCAACTGGTTTGTTGAGTACTTCGTTTCTGTTTTACCTGATTAAGCCACGGTTTAGGTTTTTAGGTCTGAATTCCACCAATACCTTGGATGCGTTCACAGTTTTAAGTCGATCGTGTTAAGTTTCTTTCGAGAGTTAAGCTCCATTATAAAATCTGCCATGTTATCTAAAAGTAAAATAAATTCGAACTGCTTCTTATCAATCCTTCGAGGCATTTGAGTGGAGACTTAGAGGTACCAGTTGTGGAGGGTATGACTTGATAATTTGCGCAATGGGTGATTAATCATTCTTTGCTCTTCTGCTGCTTCGTGTTTATGAACTGTATTTGTGAAACTGGATCAAGCATGATTTGTTATGCTGAGCTTAATTCATATTTGGTGATGCTTTGACACAGTAGATGTGTCTCCTTTGTCGGAGAATTGGACATACGGTGAAAAATTGTCCCAGTAGTTTTGGTGGGGCTGAAGACGGTAGTTCCAAATTCTGCTACAATTGTGGTGAAAGCGGGCATCGGCTTTCAGAGTGCAAACAACCGCTGAAAGATGGTACAACCATGGTGCTTTGTCCCCACATATATGTCTTCATATTATGTTTCTTTCACTAGTTCATGGCTCATGGATGATGCTGATTATTCGTCGATCTTTACACACTAGGTTTGGCCATTCACAGTTCATTTTAAGTGAATATGTGCATTACGTAAGCTTAAGCTGGACAATTTAATTCCTCTATTCCAACACGGTCTCGTTCGCAGGAGGGACAGCATTCGCCGAATGTTTTGTCTGTAAACAAAAAGGACATCTTAGTAAAAATTGCCCAAGCAATCCGCACGGCATCTATCCTAAGGTAAGCTTCTAAGCAATGGGGAAATACAGGAAAAGATGCCTGCTGTATGGCATCTGAAGCCGCAGATCTACCTTCGTGACGTTCTTTACCACCGCTGCTAAGTGTGGTAGTTAGTAGTTCTGCATAGTTCGTCAAACCAACAATTTAACTGGTTTAGAGATAGTTTAGATCAGTCTGATTTAGATTCAGATTCTTCTGTGATCGAATCACACAAATGCCGATCCGTCGAACATGGAACACATGGATCGAACACTTTCAGAGGGAAACCTACCTCAATCACTGTTCTTGCTTCTTTCAGGGTGGTTCCTGTAAGCTCTGTGGCGGAGTAACCCATCTCGCCAAGGACTGCCCTTCGAAGACTGCAGGTCAACGGGAAAAGCTTAAAATTTGTAAGTGCAGAATCTTTTTCGTCTTTCTAGGTAGAGGGGATATAGTGACGATTGTTAAGTTCCTGCAAGTCATTTACAAATTGCTTAGTAATCTACGTATCCTGCAAGTGCTCCCTAAATATGTATTGGGGTGATACATAGTAGGATGGTCTGAACGTACAAGGCTCCTTGATTGCGCCAGTCCTGCTTGATAGCACGTTTTCATAACTACAACATACATAACCCTGTTTAGCTCAAATCTTGAGCATTGTCAGTCTGACAGGCTTCAGGACATCTTTGTTTATGGTATTTGGACACAGGTTTCATGTGCCACATTACTTAAGTGCTGTATGACTTTTATGACTTTTCTAGATCACTTCCTTTATTCGTTATACGATACAATCATGCTTCGACGATAAGCATCATTCGAAAGAAAGACGTCAACACTCAAACGATATAGTCTGTTTCAGTTTGTTGCACATAGAAGAAACTTGACCCGTAAGGTTGAGGCCAGGGTTGTTGTAGAAGGCTATTTATTTATTGTGAGGAAGGCTTGCCCAAAGACTGAACGATTTCAAGTTTTCGGGTACTCGACTTTTGATAGGTCATACCCGTTTCCTCGGGTGGGTTTGTGGTCTCCGTTTCTCCCTCACAATCATACTGCTGAATATCACCTTGTTGACCAGTGTGGCACATGGTGCATCTCTTCGTCAATGTCTATCCCCGAGTTCATTTGTTCTCCTTTCCTTCTCTGTATTTGGGAGTAAGCATAATAAATCGATCAAGTTGTTGGTCATTATTATGTGAACATCTTTGCTGCCTCTATGTTACTGTTTATATACGTGAGCTCCTTTTTTCCTTTTTCTTCTTATTCATGAATTTTCCATTATAAATCTATTTTCTTAATTCTCTGTAATCACAAACTTCTCCCCTGTATCTACGTTAGCATGGCCACACCTCTGTATTATCCTCTTCGCAGCTTCTGTTACCCTGTGTATCTACGTCAGTTGTGCTTTAGCACATTCCAGATTGAGCTCCTGTTTTCCGTTTTCCTCTTCTTTATTAGTGGTCGATTACATTTACTTTTGTATACTTATTCAATTACCTTGCAACCTCTATTTTCCCCTGTATCTACGTTTGCATGGTCATTTCAGAGGCAGCACCCATTTTGCGATGCAAGTGAGTCTTCTTTGGAATCAAAATTAAGTTTGTTTAACAGGATTTGTCTTTGTATCCATAACAATCAGTATATGTTTCTAGTATATGACAATATCCAATAAGCGCATTCTTAGTTAGTATTACAGATCGCACGTCCACGATCTTGTACGGCTCTTGAATGGACAGACCCGTACTACTCTTTTGTATGTATTTGGGTTATTGCATGAAGGTTTTTTTTCCACTTTTTCTTGTGTTTCTTGTTTTCATTATTGCCTATACTTCTGCTCTAAGACCTCTTCCTTGTAATGTTGTATTCCGTTCATTGTCATCCCAGTGAGCAGTTCGCGTGAGATCTGCATTCTTCCTTTTTTTCCCAGCCATACGACATAGACAGCAGTCGTGCAAAGAAACCGAATTGCGAGGATCCATTGCTCTCGCTGTGTTTACGTAGTCGGTGGGCAACGTTTGTTCGCTAATATTCTGCCGTTTGCTGGTGTCGAAAGATACTGGCTTTCAGCATGTACGGACAAATTAGTCCGTAATGCAGCTATTTGAACACGGAATATAGTTACCCACTAATAGCAAGTCTATGTATAGCTCTCTAACCTGGTTGAACCTGTTCCAAATTACTATGACCGGCAATGTGCTCAAGTTCACTCAACGATATGCGTGCATCAACTTTGTTGCGTACGTCCATTTTCTGGGCAATTGTATGTTTTTATCATTTGCTTTAGGTGGTAGATAGAATATTCGGGGTTCGCGCCTATTTTTCATGTCTGCTGTATGTTACTCATCGGCAGGCTGTTAACTTCCGTGTCAGTTCTTTTCATTTTCTTCGCATCATCTTATGCTTTCACTGTTCACTGTTATTGCGTTTTATTGCACATATTTCGCTCTGTTTTACTTCTCTACTTTTACGGTGAACAATCTCAAGACAGGGCTTTGCTCATCTTCAGTAGTTCAAATCTTCACAATTTTTTGTCAGTTATAATATTCGTCTCTACAGTCGGAATTGGGGTGTAGGCATTGACAAATGACCTCTCTATAGGTCATATTTCTTCTCACTGGTGATTCTCTGTAATTTCGATTGCAGTGCTCAATTGGTCTTTCAATTTACCCTCCTCTTCCATCAACCCCGTATAATTTTTTACCAGTTTCAATGGCACCATCAAGTTACAGTCTTCTGCACTTCGTTTCCAAATAATTTACTCTGCCATCGGATTTATTTACCTCCTTCTAAATTGCTACTTTACCGATCTTTCTTAACTTATTTAGTGTTAACTGATGAAATGGAAAAGGAAGTAATGGGGACACGATATGGGTGAAAGTTATTGAAAACGTATGGAAAAGTTGACACTTGTTTTGAAGTTGCTACGCCTTGCATGGTATCAAAGTTTTATATAGGCTGAGGGGACGGTTGTAGTCAGACAACGCGTGGTAGATGTAAATTGTTTGTTGTTCAGCCTATTCTCTACCTCTGTACTGACAGAACTTGGTTGTCCCTTCAAACATCTGTGCAGCGGTTGAGACAGCAAAGGCTTCGGAACCTGGAGAAAACGGTAAACGTATCGTGTTTCAGAGTGGTGATGATCTGAATGACGATTTTGGAGATCTGGATTACGGTAGCGATGGTGATGTAGCCGATGACCAAGTCGATAATAGGAAAGTCAATTCAACAAAGAAGTCCAAAAAGCGAACTCCGAAGGCCACTCCAAAGGTCGTGAAGTTCAAAGGCAGTAGCTTATTGTGATAGGAAGGGCCAAAGTTTGATACGCTCATTGCAAGTTTACTAGTGCCCAAAGTTCTTTGACATACAGTACTTCGCGTCGTCTGCCTTTCCTGCACGGAGTTTTCAAAGGTTGTATCGTTCAGAAAGAAAAACAATGTTCAAGAGATTGCGGGTACTCGGTCAAATGTGATGATGTTTGGACTAGCCTGTTGTATTCTGCCATCCGAAGTTACAGTATGCCTGGTTTAGTCCATCGGTTTAGCTTTTTACGGTATTTATCTTCAGTTGTAATGGGTCCTACGTTACTCCCTTGTGGTAAGCAGTTCTCCATAGTTGAGATCATGGGTATTAGGCAAATTTTTTGAGCACATCATGGTGTTTTATGCTGTTGTAAGTGAGGATCAAGCTTGGCTCTCGTTCGGTTGGTAAAAACTTCCTTTTGGTAGGCCTTCATAGGGATATGCCTTTCTTTCGTTTTCTTGTTCGCGGGTAGTTCAATTATTCCCTTCAGAGTGGTGTCCAACTTTGTCATTCTCCTTTCTTTAAAAGAAAGGAGAAATGACTGATTGTAATTCTGCAGCTGGAGTTATGTATGTACGAAGGACTATGTAGTCTCTGGACCAAGTGATCGGATTTTCATGATGGGAACTAAGTAAGAACAAGCGGTTTGAATCCCTTTGCACGGTCTCCATCTGAAAGAGGGATGGTGCAATCCAGTCACTGCTGCCTCTTAGAGGAACTCAACTACTTCTCTCTGTTACGATGCTA

mRNA

>Mapoly0006s0064.1
AGACCAGCATTCAAGGCAGACTGTATCGTGTTGAAATGTCGTTCATTGGGATTACAAAATCACGGGGGATCGAAATCGAAATAGAAAGTCAGAAGTAGAGGAAAATTTGTAGAGCTGCTAAAACCCTAGAACCCTGGTTCGGCGAATCGGTTTAGTGCTCGTCTCACGAAGGAAAGTTTGTTAGCGCTACATCTGCTCTCCGTGCTTCTCCAATCGCCTGCGGTCTATGTGATGGGAAATGCTCGTCAGAGAGCTGCACGCAAGAAATTGGCTCAGTCAGGCGACGGTGGTGAGCCTAACGTAGTGCTGAAGAAGCAGAACTCGGAGAATCATGGAGCGGAAGTTTTGGAATCCGGGAAGAAGAAGAAGATTAGCGGACCGAAGAAACGTAAGAGAAATGACGAAGGAGAGAATGTGGGCAACGATGACGGAGAAGTCGTTCAGTCCGTTTCCAATGGGTCTGAGAAAGCTGAGTCTGGGGATAACTTGAAGGGAACGGGTCAAGGTCCGAAGAGAGCGAAAGATGATAAAGCCTCGAAGAAAACTGGGAGTAAACATCCTCTACGCGTAGCAGGGATGAGACCCGGTGAAGGCTGCTTCCTGTGCAAGGGTACCGATCACATCGCTAAGTTTTGCCCAACGAAAAGCTCCGCAGATCGGAAGAAGATGTGTCTCCTTTGTCGGAGAATTGGACATACGGTGAAAAATTGTCCCAGTAGTTTTGGTGGGGCTGAAGACGGTAGTTCCAAATTCTGCTACAATTGTGGTGAAAGCGGGCATCGGCTTTCAGAGTGCAAACAACCGCTGAAAGATGGAGGGACAGCATTCGCCGAATGTTTTGTCTGTAAACAAAAAGGACATCTTAGTAAAAATTGCCCAAGCAATCCGCACGGCATCTATCCTAAGGGTGGTTCCTGTAAGCTCTGTGGCGGAGTAACCCATCTCGCCAAGGACTGCCCTTCGAAGACTGCAGGTCAACGGGAAAAGCTTAAAATTTCGGTTGAGACAGCAAAGGCTTCGGAACCTGGAGAAAACGGTAAACGTATCGTGTTTCAGAGTGGTGATGATCTGAATGACGATTTTGGAGATCTGGATTACGGTAGCGATGGTGATGTAGCCGATGACCAAGTCGATAATAGGAAAGTCAATTCAACAAAGAAGTCCAAAAAGCGAACTCCGAAGGCCACTCCAAAGGTCGTGAAGTTCAAAGGCAGTAGCTTATTGTGATAGGAAGGGCCAAAGTTTGATACGCTCATTGCAAGTTTACTAGTGCCCAAAGTTCTTTGACATACAGTACTTCGCGTCGTCTGCCTTTCCTGCACGGAGTTTTCAAAGGTTGTATCGTTCAGAAAGAAAAACAATGTTCAAGAGATTGCGGGTACTCGGTCAAATGTGATGATGTTTGGACTAGCCTGTTGTATTCTGCCATCCGAAGTTACAGTATGCCTGGTTTAGTCCATCGGTTTAGCTTTTTACGGTATTTATCTTCAGTTGTAATGGGTCCTACGTTACTCCCTTGTGGTAAGCAGTTCTCCATAGTTGAGATCATGGGTATTAGGCAAATTTTTTGAGCACATCATGGTGTTTTATGCTGTTGTAAGTGAGGATCAAGCTTGGCTCTCGTTCGGTTGGTAAAAACTTCCTTTTGGTAGGCCTTCATAGGGATATGCCTTTCTTTCGTTTTCTTGTTCGCGGGTAGTTCAATTATTCCCTTCAGAGTGGTGTCCAACTTTGTCATTCTCCTTTCTTTAAAAGAAAGGAGAAATGACTGATTGTAATTCTGCAGCTGGAGTTATGTATGTACGAAGGACTATGTAGTCTCTGGACCAAGTGATCGGATTTTCATGATGGGAACTAAGTAAGAACAAGCGGTTTGAATCCCTTTGCACGGTCTCCATCTGAAAGAGGGATGGTGCAATCCAGTCACTGCTGCCTCTTAGAGGAACTCAACTACTTCTCTCTGTTACGATGCTA

CDS

>Mapoly0006s0064.1
ATGGGAAATGCTCGTCAGAGAGCTGCACGCAAGAAATTGGCTCAGTCAGGCGACGGTGGTGAGCCTAACGTAGTGCTGAAGAAGCAGAACTCGGAGAATCATGGAGCGGAAGTTTTGGAATCCGGGAAGAAGAAGAAGATTAGCGGACCGAAGAAACGTAAGAGAAATGACGAAGGAGAGAATGTGGGCAACGATGACGGAGAAGTCGTTCAGTCCGTTTCCAATGGGTCTGAGAAAGCTGAGTCTGGGGATAACTTGAAGGGAACGGGTCAAGGTCCGAAGAGAGCGAAAGATGATAAAGCCTCGAAGAAAACTGGGAGTAAACATCCTCTACGCGTAGCAGGGATGAGACCCGGTGAAGGCTGCTTCCTGTGCAAGGGTACCGATCACATCGCTAAGTTTTGCCCAACGAAAAGCTCCGCAGATCGGAAGAAGATGTGTCTCCTTTGTCGGAGAATTGGACATACGGTGAAAAATTGTCCCAGTAGTTTTGGTGGGGCTGAAGACGGTAGTTCCAAATTCTGCTACAATTGTGGTGAAAGCGGGCATCGGCTTTCAGAGTGCAAACAACCGCTGAAAGATGGAGGGACAGCATTCGCCGAATGTTTTGTCTGTAAACAAAAAGGACATCTTAGTAAAAATTGCCCAAGCAATCCGCACGGCATCTATCCTAAGGGTGGTTCCTGTAAGCTCTGTGGCGGAGTAACCCATCTCGCCAAGGACTGCCCTTCGAAGACTGCAGGTCAACGGGAAAAGCTTAAAATTTCGGTTGAGACAGCAAAGGCTTCGGAACCTGGAGAAAACGGTAAACGTATCGTGTTTCAGAGTGGTGATGATCTGAATGACGATTTTGGAGATCTGGATTACGGTAGCGATGGTGATGTAGCCGATGACCAAGTCGATAATAGGAAAGTCAATTCAACAAAGAAGTCCAAAAAGCGAACTCCGAAGGCCACTCCAAAGGTCGTGAAGTTCAAAGGCAGTAGCTTATTGTGA

Protein

>Mapoly0006s0064.1
MGNARQRAARKKLAQSGDGGEPNVVLKKQNSENHGAEVLESGKKKKISGPKKRKRNDEGENVGNDDGEVVQSVSNGSEKAESGDNLKGTGQGPKRAKDDKASKKTGSKHPLRVAGMRPGEGCFLCKGTDHIAKFCPTKSSADRKKMCLLCRRIGHTVKNCPSSFGGAEDGSSKFCYNCGESGHRLSECKQPLKDGGTAFAECFVCKQKGHLSKNCPSNPHGIYPKGGSCKLCGGVTHLAKDCPSKTAGQREKLKISVETAKASEPGENGKRIVFQSGDDLNDDFGDLDYGSDGDVADDQVDNRKVNSTKKSKKRTPKATPKVVKFKGSSLL

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>