Mapoly0008s0060



Description

Protein of unknown function DUF260

Reference DB

Database ID Description
OrthoMCL OG5_147219
PFAM PF03195 Protein of unknown function DUF260
PANTHER PTHR31529 FAMILY NOT NAMED

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpASLBD2 transcription factor, ASL/LBD Mapoly0008s0060.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0008s0060.1 scaffold_8:764578..770167  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0008s0060.1  

Gene structure:

mRNA scaffold_8:764578..770167  ( - strand )
three_prime_UTR scaffold_8:764578..765508  ( - strand )
CDS scaffold_8:765509..765985  ( - strand )
CDS scaffold_8:768146..768424  ( - strand )
five_prime_UTR scaffold_8:768425..770167  ( - strand )

Sequences:

Gene

>Mapoly0008s0060.1
AAGAGTGCGGCGCGGGCATGAGAAAAAGGGCCCACGTAGGATGAGACCAAGTGATTGCAAATCGAAGGGTGAATAGTGTCATTTCAACTGTGTGCAGAGGGAGTGAGAAGGGGAGTGAACGAGAGAGGAGAAAAAGAGGAGAGGAGAGGATCGGGCCCCACAAAGCCAGAGAGCAAGGAGAGTCTGTGACAGATTTACACACATCTGCAACTCTGGGTCCGCTTTCTCCTCGAACCTGTGCTCCTGCTTGGGGTTGCTCCTTCCGCTGCCTTGTTGTTCGTTCACCGAGTTCGAGGGTGTTGCTCTAGACTGCTCAGATTGGAGCACCTTCCTGGGAGTGACTGCAGCTGCTGGCCTGCAGCTGCAGCAGCAGCAAAGCAGCAAAGCAACCGGATCACCGCAGGGACTTCCTGCTTGGCCTGTGCCAGGTGCAGGTCCTCAGCTTGTGCTAACGCTTGTGTGTTGTGCAACTTCTCGACATCGTGGAACTGAAGGAATTTGCTGTGGTGCGGAGGGACGGAGGACGTACCACATTTCTTCCATTCCACCGGGCTTGGGTTGGATCCTGTGCTTCTGTCGACTGTCGAATGTCTCTCACTCGATTCTTAGAAAGCTGCAGATTAATCCTTTCACCTCAGAATCCATCCCTCCGCCTCCGCCTTTTGCACAGAGAGAGGAGAGGTTACGTTGCCAGATGATTAAACTTTTCCGTGTTTCTGCCGTCGGAGTGTTAAGTGGAGTGCAGTCTAATATAGCAGCGGCAGAGGCCTAGAAACGGACGGAAATAAGTGGATCCGAGTAATTTTGAGGGACCCCTTCTGAACAACTGAGGTGAAATTAGTGCGTAAGACTGCGACAGCACAATCAGCAGCAAGTGCCCAGGCCAGTGCCTTCACAGTATCCGAAGCAGTGGGCATCTTTGGCTGCAGGTGTAATGGCTTGAATAAGTTCCGAAATTCCTTCCATTAGTTGGACGGAAGTGGCTCCAGTCCTGCCTACTTGAGGATTCTGGACGTCGGAGACTCAAAGGAGAAGATTGGTTTCTTGCTTACTTTTGCAATCGTCAGGATCTGCCAGTCTTTGGGCATTAAGATCGACCAGCTGACGGTAAAATTCATATTCGATGTGAGTGCAACAGTGGGAGGTCCAAACTCCCATCATCAACTGCTCTTGGGTCCCACTGAGAACCGCAATTCTATTGAAGCTGCCAGTAGCTCACGCGGAATCAGTAGGTGCTTGGACTCGTCCATGCATAAACAGCATAGCACAGGTACAACGACAACGGTAAAGTCCTGGGATAAAAAATTACGTAGCTGATCCATTCAGCCTGAGTCGACATCGGTACAAGTCAACTGCCTGAGAACAGCTGCTGCAGAACAACGAGAAGAAAGCTGGAAGCCAATGATCAGATGCTCACCCTCTGGGTCTGGTGACTCTCCGAAGCCCATCTTCTGTCACAATCCTGCAAGAAGTGGTAGGTGGAATTTCAAGGGTCGAGCTACGTAATATCTCGTGTTAACATACAGGTAATCAGATAGTTCCTCTAGAGCCAACGGTTGATAAACAGCGATCGACGAGACAAGCAAACGAAGACGACGAGGAGGAGGACGAGGAGAAGAAGAGCACTGGAGCCTAAGACCATCACAAAGAGAGAGAGAGCGTGCATCAAAGCTCTGATCAGAGAAATAGATTCACCTAAATTCAAAAGCGAAGGAAAGGGTTGGCTGGATCGATCCCGTCGGCATGAGCAGTAGTGGAGCACCGTGCGGGGCTTGCAAGTTCCTGCGCAGAAAATGTGTTCGCGGTTGTATATTTGCTCCTTACTTCGGTGCGGAGCAAGGTGCTGCTCGCTTTGCAGCTGTGCACAAAATTTTCGGGGCCAGTAATGTCGGAAAGCTGCTTCTACACATTCCTCTGGGCAAGCGGTGTGATGCTGTCCTCACTATCAGCTACGAAGCCCAGGCTCGACTCTCAGACCCGGTCTACGGCTGCGTCGCCACCATATTCGCTCTCCAACAGCAGGTAATACTACATGGTACAAGCATCCTCCACATACACCTCCCACATCAGATAACCATTCATCTGACATACATTGCAAATGCCATTTTTCATGGATTGTTATGGATATTTATCGTTTCTGCTGGGGTGCACTGTTTGCTTCGTATCACCAGTACCCATAACCCGAGGATGCACAACTTGATATATGAATGCACATATTTCGACCAGATATTTGAGCAGATGTGCTATGTTTAGATTCGATGAATGGACTAAGTGACAGATTCTCATCACTATCATCTCTTAGTTGTACATGTGCTGATGATTATCAAGGAAACAAATGCCACTTCTGATATTCGAGTCCAAAGATCAACATGACGGCCAGTAATGTTGGCTTCGTTGACGTGCGATTGAAGCTGGATAGATGGTATGAGGACTCTCGTTGACCACAGGTCAACGACCTACAGTCGATGTCCAATTAGAGATCGGGTCCGGTTCGAGAACAGCTAGTGGACCAGCACTGTATATGAAGCTAATCACGTCGAATTCCAGGCCGAAGTGTTTGGCCTGGTTTGCTGCTAGTAATTGTCAGATTACAGTTCCTTCTCTGTGGTCACAATGTGAGCCCATTGTCCAAGGAAATGGATGAAGTTTCCGCACAGACGGACGGACGGGCCCCGCGTTCATTCGTACATGCATGCATGCAAGCCTTCCTGCACACAATCAATAAATTGGTCCACATTTGATGCTCATTTGCAGTTACGTTACGTCGCTGCTTGCATCACGGGCGCACAGAATAGGATCTCACTAAGATTTCCAGTCTCACATATTCCTCATTTCTTCCAGACCTGTTTCTGCTATTTGTTGCGTAGGCAACAGTTACTTCGTCATGTGCACGAGCTTCTTCTGTTATAGATCTTTCCTCTTTCGATCCACCACTTAGTGTTGTCATTACTTTCGAGAGGACTTTGTGCGCGTGGTCTATAACGCAATGAAGGGATAGAGATAGACTTGGGGTTTCTTTAAACGCTGCATTTCTGTAATTCGAATCCTTGGACTCACCCATTCATGAGCGGATGCATAGCTAGAGTCAATGGCTGCAGCTTCTGCGGCCACAAGCATCTTCCGTCACGACAGCAGTGATGCGAATTCAGACTCGTGAGAGTGGATTGTGTGATGGGGGCGTGGAGTATGAAAACATCCTTCGCCGATATGCGAAATCAGAGATCCCAACTGCCATCGAGCTACCAGGATCCTCATATTGTCCGCAGCCGTCATGTTCGTGGATGTGCTGACAAAGATGGGCAATATGATTGCGTATTGATTATTCGACCACCATGGCCTTCTTCTGAGTGCCGTCCTTTCTGTGTGACTGCATCAGTTACGTCACATTCCAAACATTTTCTGGCAGCCCTGGAAATCTTGACCTGGAACGTTTCTGTCTTCTGCCTTTCTTGGACCACTTCATGAGAATCTGGAGCAGAAAATAAACATGCGTAACACCCCACTCACTTTCGGCGTTTTCCCCTAATGCGAGGCGATCATGTCTTTAATCTAACTGTCCCACAGCTTCCAGTACGCTTCTTCGATCCCTGATGAATGCTTGAGGATGGCGTTGTGAGTCTCATTCCCACCTTAGTGCAGGTGTCAAGGTTTCCCCGTAGATCATGTCAGATCCACTTTTCTCCTGGCTTTCTTTCGTTTCAGACTTTTAATTTTGGTTCCGCGGTATTATTTTGCTCAGTCACGAGGTCGGCGTGGTAGTTGTGTGTCTCGATGGCAAGACGCACTTTGATCGATATCGAGATCTGATTCCACAGAGGAAACGGTTGCGGAGGGTAATTAAGGTGAGGAGTTTGGTGAGCGAAAATCTAGGTAGATCCAGCTTCGGTCTGGGAAGATAGCCGAGCAGTGAGAAGAGCGTCAGACGACCAAGCTAGTCAGTGACCCACACGATAAGAGGCTAAAATCTATAGCGAAAGGTGATCCGTGGTAGACAGTTGGACTGGAGCTTGGACGCTGCTGGTATGCAGCATTGGGCGGAGGGCATTCCTTCGCCTGTGTATGGATATTGTTAGATGCCCAGAATTCTTCGATCTGAGGGCGAGGTGCATGTGTGGATAAGTCAACAACAGGAATCAAGGACAGTACATTCGCTTCCACTGATTGCTGTTTGATTTTTGGCAGGTGGCGAGCTTGCAGGCAGAGTTGGCCATTGTACAGGCGCAGCTGGCCAGCCGTTTAGCAGTGGCAGCGTTACAGCAGCAGCAGCAGCAACACCAACAACATGGGGGAGGAGGCGCTGGCGGATCATCATCGATGCCTTATGTCGAGCAAGGAAGCATGACACCCGGGGGCGTCACGGCGGGCATGTCCATGGCTGGAAGCTCATCGGTTGGATCTTACGCCAACCGCATAAAGGAAGAATCCTATCATCATGGAATGCATTGCTACGATCCCGGACATCACCACGGTGTTCATCTCGACCAGATGACTTCCAGCCCTCCTGACGACATGGAGCCTCAGGACCTCCACAAAAGAGGCTCCGACTCGATGGATCCGCAGCAGAGTGGGGCGACTGGAGGTGGAGGTGGAGGAGGAGGAGGAGGAGACATGGGGGACCTGCAAATTCTGGCCCAAGCGCTTCTCAGCAGCCGCAAATGATCATTGCGATCATGATCATCGTATCATCATGAACTCATTAAGACCGATCGAATCCTGCATGCAACAACGATTGATCATGAGATCTCGAAGCCCATCATCTGTCTACTAGCTACTCACTCCAACTGCAGCAGCAGCATCGGTATTTTCTTCAGAAGACAATCAAACGGCAGCAGAAGTTAGAACATCAATCGTAACAATGGAATGGAATGGAATGGAAACCGTCATCATGCTGCAGTTGATGACGAACTCTTCTTCCTCCGAGTAGAGAGAATCATGACCTTGGCGGTGCACTGTACTGAACTGGTTGACCAAAAGCAAAACTCTTGCTTGAGAGAGTGGAGGTATATCGTTAGAGTAGAGACGTAAGTACATATAGAATCTGATAATCAATTGTAAAGAGATTGTACTACGACCAATACATTGGTGGTGCCAGTCGGAGTCACTATTCGTGTCTCCCTGCCACGGCAATCTCTCTGAACATGATGGGCTTGGCAGCTCAAGGGTGAGGTACTAAATGTTAGTTCGATCCTCCATCCTCCACCCCTGCCTCCCTGGAAAACTGAACAAACATACATGAATTCATACGGAGCTAGACTATACTAACTCACAAATTCTCCTCTACGTACTCTTACACTACTGGTTCTACTGTTCTAAGTTTGGTCCAGCAGCTGCAGTTGACCTTGGAGGTGCAGTTACTACTGAAATAGTTCCGTCTTGCCTGGAAGAGGAGCTCGAACTTTCTTTTGCTTCACCAACTGGAGCTTCACTCTAAGCTTAGGTAGATAGGTACATAGATAATAGATAGATAGTCAAGACGAAGATTACGTGGAGTGTACTAATATAAAATGCTATTTAGGCATTGTATACAGCTTCAGGGATAAAGTCCACCATGTAAAATTGTTACTCATTGCTTCCTTTCATAAAGAATTAT

mRNA

>Mapoly0008s0060.1
AAGAGTGCGGCGCGGGCATGAGAAAAAGGGCCCACGTAGGATGAGACCAAGTGATTGCAAATCGAAGGGTGAATAGTGTCATTTCAACTGTGTGCAGAGGGAGTGAGAAGGGGAGTGAACGAGAGAGGAGAAAAAGAGGAGAGGAGAGGATCGGGCCCCACAAAGCCAGAGAGCAAGGAGAGTCTGTGACAGATTTACACACATCTGCAACTCTGGGTCCGCTTTCTCCTCGAACCTGTGCTCCTGCTTGGGGTTGCTCCTTCCGCTGCCTTGTTGTTCGTTCACCGAGTTCGAGGGTGTTGCTCTAGACTGCTCAGATTGGAGCACCTTCCTGGGAGTGACTGCAGCTGCTGGCCTGCAGCTGCAGCAGCAGCAAAGCAGCAAAGCAACCGGATCACCGCAGGGACTTCCTGCTTGGCCTGTGCCAGGTGCAGGTCCTCAGCTTGTGCTAACGCTTGTGTGTTGTGCAACTTCTCGACATCGTGGAACTGAAGGAATTTGCTGTGGTGCGGAGGGACGGAGGACGTACCACATTTCTTCCATTCCACCGGGCTTGGGTTGGATCCTGTGCTTCTGTCGACTGTCGAATGTCTCTCACTCGATTCTTAGAAAGCTGCAGATTAATCCTTTCACCTCAGAATCCATCCCTCCGCCTCCGCCTTTTGCACAGAGAGAGGAGAGGTTACGTTGCCAGATGATTAAACTTTTCCGTGTTTCTGCCGTCGGAGTGTTAAGTGGAGTGCAGTCTAATATAGCAGCGGCAGAGGCCTAGAAACGGACGGAAATAAGTGGATCCGAGTAATTTTGAGGGACCCCTTCTGAACAACTGAGGTGAAATTAGTGCGTAAGACTGCGACAGCACAATCAGCAGCAAGTGCCCAGGCCAGTGCCTTCACAGTATCCGAAGCAGTGGGCATCTTTGGCTGCAGGTGTAATGGCTTGAATAAGTTCCGAAATTCCTTCCATTAGTTGGACGGAAGTGGCTCCAGTCCTGCCTACTTGAGGATTCTGGACGTCGGAGACTCAAAGGAGAAGATTGGTTTCTTGCTTACTTTTGCAATCGTCAGGATCTGCCAGTCTTTGGGCATTAAGATCGACCAGCTGACGGTAAAATTCATATTCGATGTGAGTGCAACAGTGGGAGGTCCAAACTCCCATCATCAACTGCTCTTGGGTCCCACTGAGAACCGCAATTCTATTGAAGCTGCCAGTAGCTCACGCGGAATCAGTAGGTGCTTGGACTCGTCCATGCATAAACAGCATAGCACAGGTACAACGACAACGGTAAAGTCCTGGGATAAAAAATTACGTAGCTGATCCATTCAGCCTGAGTCGACATCGGTACAAGTCAACTGCCTGAGAACAGCTGCTGCAGAACAACGAGAAGAAAGCTGGAAGCCAATGATCAGATGCTCACCCTCTGGGTCTGGTGACTCTCCGAAGCCCATCTTCTGTCACAATCCTGCAAGAAGTGGTAGGTGGAATTTCAAGGGTCGAGCTACGTAATATCTCGTGTTAACATACAGGTAATCAGATAGTTCCTCTAGAGCCAACGGTTGATAAACAGCGATCGACGAGACAAGCAAACGAAGACGACGAGGAGGAGGACGAGGAGAAGAAGAGCACTGGAGCCTAAGACCATCACAAAGAGAGAGAGAGCGTGCATCAAAGCTCTGATCAGAGAAATAGATTCACCTAAATTCAAAAGCGAAGGAAAGGGTTGGCTGGATCGATCCCGTCGGCATGAGCAGTAGTGGAGCACCGTGCGGGGCTTGCAAGTTCCTGCGCAGAAAATGTGTTCGCGGTTGTATATTTGCTCCTTACTTCGGTGCGGAGCAAGGTGCTGCTCGCTTTGCAGCTGTGCACAAAATTTTCGGGGCCAGTAATGTCGGAAAGCTGCTTCTACACATTCCTCTGGGCAAGCGGTGTGATGCTGTCCTCACTATCAGCTACGAAGCCCAGGCTCGACTCTCAGACCCGGTCTACGGCTGCGTCGCCACCATATTCGCTCTCCAACAGCAGGTGGCGAGCTTGCAGGCAGAGTTGGCCATTGTACAGGCGCAGCTGGCCAGCCGTTTAGCAGTGGCAGCGTTACAGCAGCAGCAGCAGCAACACCAACAACATGGGGGAGGAGGCGCTGGCGGATCATCATCGATGCCTTATGTCGAGCAAGGAAGCATGACACCCGGGGGCGTCACGGCGGGCATGTCCATGGCTGGAAGCTCATCGGTTGGATCTTACGCCAACCGCATAAAGGAAGAATCCTATCATCATGGAATGCATTGCTACGATCCCGGACATCACCACGGTGTTCATCTCGACCAGATGACTTCCAGCCCTCCTGACGACATGGAGCCTCAGGACCTCCACAAAAGAGGCTCCGACTCGATGGATCCGCAGCAGAGTGGGGCGACTGGAGGTGGAGGTGGAGGAGGAGGAGGAGGAGACATGGGGGACCTGCAAATTCTGGCCCAAGCGCTTCTCAGCAGCCGCAAATGATCATTGCGATCATGATCATCGTATCATCATGAACTCATTAAGACCGATCGAATCCTGCATGCAACAACGATTGATCATGAGATCTCGAAGCCCATCATCTGTCTACTAGCTACTCACTCCAACTGCAGCAGCAGCATCGGTATTTTCTTCAGAAGACAATCAAACGGCAGCAGAAGTTAGAACATCAATCGTAACAATGGAATGGAATGGAATGGAAACCGTCATCATGCTGCAGTTGATGACGAACTCTTCTTCCTCCGAGTAGAGAGAATCATGACCTTGGCGGTGCACTGTACTGAACTGGTTGACCAAAAGCAAAACTCTTGCTTGAGAGAGTGGAGGTATATCGTTAGAGTAGAGACGTAAGTACATATAGAATCTGATAATCAATTGTAAAGAGATTGTACTACGACCAATACATTGGTGGTGCCAGTCGGAGTCACTATTCGTGTCTCCCTGCCACGGCAATCTCTCTGAACATGATGGGCTTGGCAGCTCAAGGGTGAGGTACTAAATGTTAGTTCGATCCTCCATCCTCCACCCCTGCCTCCCTGGAAAACTGAACAAACATACATGAATTCATACGGAGCTAGACTATACTAACTCACAAATTCTCCTCTACGTACTCTTACACTACTGGTTCTACTGTTCTAAGTTTGGTCCAGCAGCTGCAGTTGACCTTGGAGGTGCAGTTACTACTGAAATAGTTCCGTCTTGCCTGGAAGAGGAGCTCGAACTTTCTTTTGCTTCACCAACTGGAGCTTCACTCTAAGCTTAGGTAGATAGGTACATAGATAATAGATAGATAGTCAAGACGAAGATTACGTGGAGTGTACTAATATAAAATGCTATTTAGGCATTGTATACAGCTTCAGGGATAAAGTCCACCATGTAAAATTGTTACTCATTGCTTCCTTTCATAAAGAATTAT

CDS

>Mapoly0008s0060.1
ATGAGCAGTAGTGGAGCACCGTGCGGGGCTTGCAAGTTCCTGCGCAGAAAATGTGTTCGCGGTTGTATATTTGCTCCTTACTTCGGTGCGGAGCAAGGTGCTGCTCGCTTTGCAGCTGTGCACAAAATTTTCGGGGCCAGTAATGTCGGAAAGCTGCTTCTACACATTCCTCTGGGCAAGCGGTGTGATGCTGTCCTCACTATCAGCTACGAAGCCCAGGCTCGACTCTCAGACCCGGTCTACGGCTGCGTCGCCACCATATTCGCTCTCCAACAGCAGGTGGCGAGCTTGCAGGCAGAGTTGGCCATTGTACAGGCGCAGCTGGCCAGCCGTTTAGCAGTGGCAGCGTTACAGCAGCAGCAGCAGCAACACCAACAACATGGGGGAGGAGGCGCTGGCGGATCATCATCGATGCCTTATGTCGAGCAAGGAAGCATGACACCCGGGGGCGTCACGGCGGGCATGTCCATGGCTGGAAGCTCATCGGTTGGATCTTACGCCAACCGCATAAAGGAAGAATCCTATCATCATGGAATGCATTGCTACGATCCCGGACATCACCACGGTGTTCATCTCGACCAGATGACTTCCAGCCCTCCTGACGACATGGAGCCTCAGGACCTCCACAAAAGAGGCTCCGACTCGATGGATCCGCAGCAGAGTGGGGCGACTGGAGGTGGAGGTGGAGGAGGAGGAGGAGGAGACATGGGGGACCTGCAAATTCTGGCCCAAGCGCTTCTCAGCAGCCGCAAATGA

Protein

>Mapoly0008s0060.1
MSSSGAPCGACKFLRRKCVRGCIFAPYFGAEQGAARFAAVHKIFGASNVGKLLLHIPLGKRCDAVLTISYEAQARLSDPVYGCVATIFALQQQVASLQAELAIVQAQLASRLAVAALQQQQQQHQQHGGGGAGGSSSMPYVEQGSMTPGGVTAGMSMAGSSSVGSYANRIKEESYHHGMHCYDPGHHHGVHLDQMTSSPPDDMEPQDLHKRGSDSMDPQQSGATGGGGGGGGGGDMGDLQILAQALLSSRK

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>