Mapoly0008s0071



Description

AP2-like factor, ANT lineage

Reference DB

Database ID Description
GO GO:0003700 Sequence-specific DNA binding transcription factor activity
GO GO:0006355 Regulation of transcription, DNA-dependent
KEGGORTH K09285 AP2-like factor, ANT lineage
OrthoMCL OG5_135471
PFAM PF00847 AP2 domain
PANTHER PTHR32467 FAMILY NOT NAMED
PANTHER PTHR32467:SF5

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpAP2L1 transcription factor, AP2/ERF Mapoly0008s0071.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0008s0071.1 scaffold_8:895126..905363  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0008s0071.1  

Gene structure:

mRNA scaffold_8:895126..905363  ( + strand )
five_prime_UTR scaffold_8:895126..897741  ( + strand )
CDS scaffold_8:897742..897997  ( + strand )
CDS scaffold_8:899510..900404  ( + strand )
CDS scaffold_8:900807..900889  ( + strand )
CDS scaffold_8:901062..901070  ( + strand )
CDS scaffold_8:901226..901314  ( + strand )
CDS scaffold_8:901815..901888  ( + strand )
CDS scaffold_8:902313..902363  ( + strand )
CDS scaffold_8:902612..902688  ( + strand )
CDS scaffold_8:903555..904495  ( + strand )
three_prime_UTR scaffold_8:904496..905363  ( + strand )

Sequences:

Gene

>Mapoly0008s0071.1
GAGCGACGTCGACTGTCATTGCTCGAGACTCGCGCAGCAGCAGCTCCATGCGAGTGAAGCTCAGTGAACTGAAGTGAAGCGAGTCCAGCGAGCGAGTGAGCACAGACAACCTGAGCTTGGGCTTCCCTCCCTCCCACCAACAGCATCAGCTGCATCAGAAGAAGAAGCCAAGGAAAGCAAGAGTCTGCGTTCGTTGCCAAGCAGAACCAGCGCAGCCGAGCTGTGCAGTTTGGTTCAGTTCACTTCAGTCCAGTCCAGTCTAATCCAGTTCCAGTTCGGTTGGAAAGAGAGTCCTTTCGTTCGGTCACCCGAGGAGAGAATGATCGGGGAGGCTGCCATGGCTGTCTGAAGTCGTGAGTAGAAGGAGGAGGGAAGGGGGGAGGGAGGGGGTAGAGTGGGGCTGACTGCGGCCGAGTGACCGAGAGCTGATGTTGCTGCTAGCAGATAATGGCCTGCCTGCCGGATCTGCCTCTAGTGGAGAGGAGGGCGAGGAGTAAGCGGTGGTGGTAGGAGGCAAGAGAAGAGCAGCAATCTGTCTCGGGTGCGCGTCGCCGGAACCTGGCGGAGCTTGTAGAGGGAGGGAGGGAGGGAGGGAGGGAGGAAGGGAGGATTGGGTTGTGTGCCGTGCTGTGCTGAGCGGAGCGAGCGATTACTTCCTGGGAGCATCCATAGGCGGGGGGAGAGTACCCAGCATAGATTGCCGCATGCCCCAACAAGACCGACAGCACGAGTGAGAGAGAGAGAGAGAGTTGAAGGGCGGAGACGAGTGAGAGCGACAGAAAAGATAGGAGAGCAGCAGAAGAGGCAGCGAGGGGGCAGATCGCAGTGTTAGTGTAGTGGTGCGCGCTCAAGAGCAAGAGCAAGAGCGAGTGAGTGAGTGAGTGGGAGGGAGGCGAGGAGAGGAGAGGAGAGGGGAGGGGAGGGAGCGGGTGGAAACAAACGCGTACTGGGGAAGCATTTTGAGGAAGGGAATAAGTGAGCGCAGCAAAGGGTGGCTGTCGGACTGAGGGAGAGAGTGAGGAGAGAAGGGGGTTGGACCAGTACAGTAGGAGAGCCGGCCCGTAATTCGGGGCATATATGGGCAGACAAGCGGGTTGATAGTAGTCCGCATGCGCAGCGATCTCAATCAATTGGAAGAGTTGTCTAGTAACTGAGTCGCGACGAGTCGAGTCGAGACGAGAAGGGGAGAGGAGGAAGACGGAGAGAGAGGGAGAGAGAGAGACGAGGAGGGGAATGAGAAGCGAATCGAAAACATAGGCCCAGGGAAGAAGAAGGAGAGGAAGACGAGTAAGGATTGAACGCACTCACTCACGCACTTGCACTCGGTTGTGGCTGTGGTGGCGGGCGGTCGAGCGGAGTAGTAGAGGAGAGGGGCAAGGCCAGACAAGGCGAGGCAAGGCAAGGCAAGGCGAGGCGAGAGGCAAGGGAAGGGAAGGGAAGGGAAGGGAAGGGAAGCCTGTGACGAGAGGAGAGGAGAAGGTGGAGAGAAGTGCCGCTGCTGTGTGCTGTGCTGCGCAGTCGTTCGTGTCGTTGTGGTCGTGTTGGTTGATCCACTCGAAGCTGTGTCGTAGTGGGGTGTGGTAGTCCTGGTTCGCTCGCTCTTTCTGCTATGGGTTTAGTTGGCTGCTTTGGATTCCGCCTCGAGGCCAGTAGTATGATAATATTGATGCGGGCCTTTCCTGTGAGGTTCAGTGCTGAACCAGCCCATGGTTCTAGTTGAAAGGAAAGCGCTAATCCGAATTGGCATGCAGTAGTCCTGAGGTGTGACGTTTTGTTTCAGGAAGATCTTTGTATAGCGCTTCAGTTGAGGACGGGGTGCTACCACCACCGCCGCCACCACCACCACTTCTCCCTTCTACCCCTTACACCACCACCCTCACTTATCCTTGCCAGCAACAAGCCCCAGCTTAAGCACTAGAAAATCGTCTTCACCATCATCCCAGAGAGAGAGATAGAGAGAGCGAGAGCGAGAGCGAGAGAGAGAGGCGCTGTCATTCGCGCATTGCTGAGGAAATCTCGAGTTCCGGACACAAGCCCTCACTCCAGTCTTCTCACACCGCCCGCCAGTTGGCAGCCGCACTGCCCCTTTGCCACGAATTTTTCCCCGGGAATTGAAGGCTCCTAGAGCTCGAGAGGTCCGTCGCCACATCTGTAATTTGGGCTTCCAGGCGATTTCAGCTCGTTGAGCCTACTGTCCGGTCGCACTTGTACATTCGCACCCCCCCTCCCCCCAAGCCCAAGCCCAGCCCCAGCCCCAGCCCCCTCTTCTTCTTCTTCTTCTTCTTCTTCTTCATCTTCTTCTTCCCCGCACCGACCCCAACCCCCATCTTCCCAAGTTCCCATGCGAGTCTCGGAGCCCCCGTTCTTCCGTCGAGCAGCAGCAGGCGAATCTTGAGAGCCTCGTCCGGAGCAGAAGGCCGTGTCTGCCAATGTGGGCAACGGATATCTTGACCTACGAAAACCTGTCAGAAGAAGAAGACGAGTGGTATCTCGGAGTTCGGTTCTGGGGTAGAGCACCGGCGTCTTAGCCACCGATCGCCTTCGATCCCATTTTCCCATCTCCGCTGTTTCTCGCAAGCAGTCAAGCTGGGAAATTTCGTAGCTGAAGATAGGTCGATGAGGTCGGTCAACAACTGGTTGGCCTTCTCTCTATCGCCCCATTTGACCATTGATGTGCCCGATCATGCGCCTTCCGCACAAACTAATGGTCCTAAGATGGCTCAACATTCTTCAGCGGAGAATGGGTTGTCCTACAACGGAGCACCATCGGGCGAATGCTACAACCTTGGACAGTCGGACGGCGACACCCTGTCCATGCGCCCAGATGGCTCGCTTTGTATTATGGAGGCGTTGAGTCGCTCTCATAGTGGAGGTAAGCTCTCCTTCTCCTCCTCCTTTTCTTCCCCTCCTCTCGTGCCGTCTTTTGGAATTGCTGCTCTCTCCATTTTTCATGTCCTGCCCCCGCTCTCCAGCTCCTCGGACTAGGGTTGTCACCTTCTCAGCCCCTCGCCCAGCTCGCTGTGCTCCCGTCATCGTTGAATTATGATCGGGGCTCGTGCCCTCTCGCAAGCTCCTCGCATTCTACTCCCCATGTATCGCTGCTCCGGCCGTCAATTTTGCCCCGAGCTGGGCGAAATCCCGAGGCTCAGTGTGCAGCCGAAGAAGTAAGCAGGTTCGGGAGGGGGAGGTCGCATGCGCGAGCGAAATTGTTGGGACGATTCCCAGCGGAAGAGGATTCGTGCGCATGAGCACGGAAATGCCTTTGTTCTTCTTCTTCTTCTTCTTCTTCTTCATCTTCTTCTTCCCCGCACCGACCCCAACCCCCATCTTCCCAAGTTCCCATGCGAGTCTCGGAGCCCCCGTTCTTCCGTCGAGCAGCAGCAGGCGAATCTTGAGAGCCTCGTCCGGAGCAGAAGGCCGTGTCTGCCAATGTGGGCAACGGATATCTTGACCTACGAAAACCTGTCAGAAGAAGAAGACGAGTGGTATCTCGGAGTTCGGTTCTGGGGTAGAGCACCGGCGTCTTAGCCACCGATCGCCTTCGATCCCATTTTCCCATCTCCGCTGTTTCTCGCAAGCAGTCAAGCTGGGAAATTTCGTAGCTGAAGATAGGTCGATGAGGTCGGTCAACAACTGGTTGGCCTTCTCTCTATCGCCCCATTTGACCATTGATGTGCCCGATCATGCGCCTTCCGCACAAACTAATGGTCCTAAGATGGCTCAACATTCTTCAGCGGAGAATGGGTTGTCCTACAACGGAGCACCATCGGGCGAATGCTACAACCTTGGACAGTCGGACGGCGACACCCTGTCCATGCGCCCAGATGGCTCGCTTTGTATTATGGAGGCGTTGAGTCGCTCTCATAGTGGAGGTAAGCTCTCCTTCTCCTCCTCCTTTTCTTCCCCTCCTCTCGTGCCGTCTTTTGGAATTGCTGCTCTCTCCATTTTTCATGTCCTGCCCCCGCTCTCCAGCTCCTCGGACTAGGGTTGTCACCTTCTCAGCCCCTCGCCCAGCTCGCTGTGCTCCCGTCATCGTTGAATTATGATCGGGGCTCGTGCCCTCTCGCAAGCTCCTCGCATTCTACTCCCCATGTATCGCTGCTCCGGCCGTCAATTTTGCCCCGAGCTGGGCGAAATCCCGAGGCTCAGTGTGCAGCCGAAGAAGTAAGCAGGTTCGGGAGGGGGAGGTCGCATGCGCGAGCGAAATTGTTGGGACGATTCCCAGCGGAAGAGGATTCGTGCGCATGAGCACGGAAATGCCTTTGTTGAATGCACCTGACGATGCAGGCGTGCAAGTCCTGAGGGTAAGGACATGGATGGGGGTGGGGATGAATCGGATGACTGATTGTGTTGTTGTTGACGGGCAATTGTGGTGGGTGTGCAGATTGGGCCCAGCTCAAGACTAGTCATGTGCAGCACCCCTCCCAGCATTTGCTGAACGCCGACCTCTCGAGGCTGGCGGGCAGCAGAGCACCTAGTGAACAGATCACGCAGAACCAATATGATTCACTGGGTTCCCAATCCAATAAGTCGGACCATGACTCGGGCCCGAAACTGGAAGACTTTTTGGGAGGAGCTTCGTCGCTGGGAGGTCAATACACCAACCGATCAGATTCACAGTCCCACAATTTCGAGAACTTGTACTTCCGGGACATCAATGTGAATCTGAGTCCTTACTCTGGTGGTGCCCAGCAACAGGCCAATCATGTGCCTCCCAGTTTCCATGCGTACGGCTTGCAGCGGACTGATAACTCTTCCACACAGCAACCGTACGACTCTCACTCAAGGAACAACACTGCAGCGGAGCCGAATCTCTGCCACACCAATGTGCACGCTCAGAATCTGCTGCAGGCGGCTCTCGATCAACACCATCACCCGGGGTCCGCCCAGGCCGAAATGTTGCAGGATTGCTCGCTGCAGAGCTCCAACCTCTCGGCGCTCAAGACCTGGCTGCGCCAGAGCCAATCGGCCACGGGCTCGGGCGGCGTCAACGCGCTGGGCTCCGCCGACAACAAGCAGCAGCAGCAGCAGCAGGGGCTCGGCAAGGCCAGCTGCATACCCAACATTGCCGGCGTCCATCAATCTCTGTCGCTGTCCATGAGCCCCGGCTCCCAGTCCAGCAACACTCTGGTGGGCGCCCAGCCCCCCAATGTCACCGCCGAGACCTCCCCGGAGACTCGCAAGCGCGGAGCCGGGCGCGCTGGCAGCAAGGAGGCCTCGCCTCGCAAATCCATCGACACCTTCGGCCAGCGCACTTCTGTCTTCCGCGGAGTGACCAGGTGCGCTCCAATTGATCGCCCTCTCTTCGTTTCCTCTCAATTTCTTCCCTCCGTCGATCTGATATCATGTCCCTCTACGCCAACCCCCACTAGAAATACCGACAGCTGTGTCACCTTCGTCCGATTCCTGCTCTCTCGCCGCGACATCCATGGTCACGGCGGGGCGCGAAATCAATGATATTATTCGAACCGGAATTCCCATCCTCCTCATCATTGTGCCCTACTGTAGCCCCAAGTGTCTAGACACGGACACGAAGCTCTGAAAAAGGACGAGTCATGAATCGGTGTGGCGTTCGGTCCGAGTCACGAAATCGATTAGGGATTCGTAGCTTACTGAATTTTTATACCATTTCTCGGAAGTACTAACGAGGCCGTCTTGTGGGTGGGTCCTGATTTTGCCAGGCATCGTTGGACGGGGCGCTACGAGGCTCATCTCTGGGACAACAGTTGCCGCAAGGAGGGACAAACCCGAAAGGGACGACAAGGTCAGTCGCCTTGCTTTCGTTCTCTCGCTAATTCACTCTTTCGTTCGTTCAATCGATCAGTTACCTTATTTCTGGCACGGCTATCAGAATCATCGCAGTTCATGTACTAAGCTTTTCTTCCGGCGTTGTGGTCTGTGCATGTGCCGCTGTCAATGGCTCTCCAAATCTTCAGTTTATCTTGGTAAGCAGCCCTTGCCCCCCTATAGTACCTTCGTCATGGCGATGCCCAAGCTTCTCCTGCAGGCTTTGCCGAAAAGAGAGTGGAGTCTAGCCGCCGATGTGACGTTCTGAGACTTTCACAGTGGCTAATTGATGCTGTTCGCTGTTCGCTTGCAGGTGGATACGATAAAGAGGAAAAGGCTGCGCGAGCCTACGATCTCGCTGCCCTCAAGTACTGGGGTCCGAATACGACCATCAACTTTCCGGTACATCAACCTATCCGAGTGTCTGCTAGTGCGTGTGTGTGTGTGTGCGAGGTCAGATTGCTGCTGGAGCATGTTTCGATTTGGGTCATGTTCATGTTACGTTAGGCAGATGGTGTCTACTCTTGCTTCCTTCCTTCCTTCCGCTCGTCAAGGTGGTGGTGGTGGTGCAAGGCTCGTGCGCTCGCTCGCCCCGGCCCGAACTAAATGACGAGATTCTCGCAGAGAAGGAAGGAATGGTCGAAAAACGTGTGGAATTCGAAACACGTTCCTAACAGCAACAGTGGTGCTGGCTCGAGAGTCTGTCTGACTGACCTCCTCCATGAAGTTAGGTCGAGGGGGCTCCTGTACGTAGGTTGACTGGCATCCTAACACGAGCTGACGAAGCCCTCCCTGAGAGGATTCGCTCGCCCGCGCGGTGCTCGTAGTGTACTGTCGGCACGCACGTAGGCAGACATACTCATGGTAATTAATGAAGGGCGTCGTGATGGATCGACATGCAGATACACCAGTATGAGAAGGAGCTCGAGGAGATGAAGAATATGACTCGCCAGGAATACGTGGCATCTCTGCGAAGGTCAGTTGCGCCAATATTCGCCCTCCTCCATTCTTGTGCTTCTCCTCCTGTGTTCGTCAGCTCCCCTCCCCTCCCCTCGACCCGAACCTTAAGGTGCTTGCTTGTACGATTGATGCCGTCCTTAATCGATTCTAGTCATTTTCCGCCACCATGATCCATAATCTAAGCTTTTTCGTGTCTGATAACGTACCTTGTACGGAGAAGCGCTTATCATTATTGTGCACCCCCAACCCCACCCCCCTCCCTCTAGGTTTCAGCCCCCGGGGGCTCGAGAAGATCTCGGTACGGTGAAAGTGGAAGGGCACGTAAGTGTTGCGGTGATCTCGTCCGCCCAAATTTAGCTCTATCTCCCGTCTCCTGTCTGATCGTCATCATCATCGCTATCGTCAGCTGACCGGCCTCCGCCTCGTCGTGAATTATGCAGGAAAAGCAGTGGATTCTCCAGAGGAGCTTCTGTCTACCGAGGAGTGACCAGGTGCCATACTATCCCCCGCCCATGCAGTGTATTATGCAATAATAATTGGCCTTCCATGTCTGATCCTTACCTCCTGGTTAGGGTGCCTCATGCTTGCGATATCTTGCTTATGGTACCATGGCCGAGACGTGGATGTGCAACATGAATTTCAGTCGTGGGCGCACAGTGATTGTTTCTCCCCGAGAGGAAGTTGTTGTTCTGGCGAATTTACTCTTAACTTTGACTTTGTGCGATTTCGCCGTCCGCAGACACCATCAGCACGGTCGCTGGCAGGCACGAATAGGCCGCGTTGCTGGTAACAAAGACTTGTACTTGGGAACATACAGTGAGTGCTCGTCCCACGTCCTTGAATGTCTCTCCCTCCTAAACACGTACATGATCCGCTGCCTTCAGGAAAGTGGACTTTCTCTCTCTCTCTCTCTCTTTCCAATCTCTCCAATCTCTCTGCCCATGCACGCACTAAGCTTCGTTTGATCTAGCTCTCTTGGTTGAGAAGTCGGTGGATGTGCATGCGATGATGTCGAATAGCTTTATCCGACGCGAAGGGAGCCACAGTCTGACTGACTGATCGGTCATTCTGGTGTGACCTCGGGGTTGGTTGATGGGTCGAGCTTCGCTCATGAAGGTCCCAGAAGAGAGAAAAATTTGCCCTTCGAAGTCCGGTCGGTCAGTGAGCCTTGAATGAACGAATGGAAGGGAATCGCTTAAGGCGGGGATGCATCAATGCTGTCAGGTCGCATCCAATCGGAGCCCTGCACTACAGCGTGTGGCATTGTGATTTCACTGTGCACTTAGTTCATTCACGAGCCCATGGAATGGAAGTGGGGACCCCGTTGCATCATACAAACAGCGAGAGGATGCAAAGCCATCGTGCTGAAAGGGGCTGTACAGCTCCCCTCTCTCTGATCATGGAAATGGCGAACTACAGGCTTGCCACACGCACAGTGTGCTTTAATGCCTGCTGCAGGCTTGTCGGAACTTATCGATCCGAATTGGTAATGGGGTGGAATCTCGGGGTGGTTGGGAGAGTACTCATGCTAGTGTTAGTGTTTCTCATTAATGCTCATGGAATGGAATGGAGTGGAATTGATGATATGACAAAATGGGCATGGACTGATCGATCGCTGGACGACTGTGTGTGTACGTGTGTGTTGTTGGGTGGTGTTTTGTAAATGCGACGGTGGGATCCAGGCACGCAAGAGGAAGCGGCCGAGGCGTATGACATAGCAGCGATCAAGTTCCGAGGAATAAACGCGGTCACGAACTTCGACATCAGCCGCTACGACACGAAGAAGATCTGTGGCACGGCGCACAACACGGCCGATGGCGAGTCGCCCAAGGTGCAAGCGGCGAGCACCAAGGAGCTGGCGGCGGTGCCCCCCGAGCAGCCCAGCGATCCGAGCGTCGACGGTCATCAAACGGACGAGGATTCCCAGAGCTTGCAAACGGGGAACACCAACACCAGCCAGGTGACGGACGGGCTGGTGTCGAAGTCGCATCTGCAGGAGTGGCACATGCTGTACCATCAGCAGCAGACGCAGCGCAATTGGGACGATGCCAACCACCAGCAGCAGCAGCAACAGCAGGCCGCTGCAGCGCAAGCGCAGCAGCAGCAGGATGTGAGGACGCAGTCACTGATCTCGGACTCGCTGGGGCACAAATTCCTGCAGTCCCCGGCGGGCAACATGCACTCGGCGGTGCTGCGCAACCTGATGGGGCTGAGCGACGCGGGGACGAGCGGGAGCGAGTCTTCGGGCGGCATGCTGGCGCTGCCGGGGCCCTCGAGCACCATGATGGGCGGCAGCTCGGGGTTCCCGGGGGCGCAGAGCCCCAAGTCGCTGCGGGAGCAACAACAAAGCGAGGACGAGAGCTCCAAGAGTGGGGGCCAAGGAGGCGGAGGAGGGTCGGCTTACGAGAACTTTCCGCAAGGGGATCTGAGCAGGCATATACTCTACTTGTCCCATGGGCAGTCGCCCCCGAATGGAAGCGCCAAGTCGACGAACAACTACGACAACAGTTCGTTAGGCAACCAATCGTGGATGAGCCCCCAAGGAAATTTGAATCAGCGGGTGTCAGCAGCGGGCCACTTAAGCGTCGGCCATATGCCCATTTTTGCAGTTTGGAACGATTGAAGGAAGGAAGCAGGTTCATTCGCTTCATTCGCTTCTTCGAATAATGAAGGAGGAGGGGAAGAAGATTAAGAAGAAGAAGAAGAAGAAGAAGAAGAGACTGTGATCGATCTATCTGTGCACGAGGAAGTCGGCAGTGCAGGCGTAGAAGGAAAAGATAGAAAAGACCCTTTGAAGAAGAAGAAGAAGAAGATTAGTGTTCGTTCTACTTACTAGAAGAAGCCCATCAACCAGCTAGCCGATCGAGGACGGGGACTCTGGCCTCTCAATCTCTGTCTCACTCTCTCATTCTCATTCTCGTCTGCGATCTGCCGCTGGCAAATCTTTCTGCTCGGTTCGGTTCTTGGGTCTCTAGTAGGACAGGACAGCACCAGGATCCACCACCCACCACCAGCTTCAGTCACCACATCACTCGACATACCCCCCACTCTCGACTCTACTCAACTCCCTCTGTCGCAGTCGCCCATCTGAACTCATTCACTCGCGCGCATGCACTCGTCCGTCGTCGTTGTCCCCGAGAGACAGAGCTTGCGGACATGTTCCGGCCTTGTTCCCCTGTTTTGTTCTACTGGGGAAAGGGGACATTGTAATGTTAGCTGGTGCCCCTTTTTTTGGTCACGTTCCTTGGAAGAAGCAGGCCCCTAGGAAAGATCGAGGATCTCTGGTATTTGTAGCCGCTCCGGCTGCTGGCTGTGTAGGCGAGGCTCGGCCGTCGTCCACTGGTCTCAGCCAGAAGTCAGTTGTTCCTGCTGCTACTGCTGAATTGTGATACATTCATATTAAACACTACGCCATATGGCACATGTAAAATGGTGTGCGAAGAATTCATTTATGCAAACCCGAAAGGGATTGTATGATTGTAAATACGGTT

mRNA

>Mapoly0008s0071.1
GAGCGACGTCGACTGTCATTGCTCGAGACTCGCGCAGCAGCAGCTCCATGCGAGTGAAGCTCAGTGAACTGAAGTGAAGCGAGTCCAGCGAGCGAGTGAGCACAGACAACCTGAGCTTGGGCTTCCCTCCCTCCCACCAACAGCATCAGCTGCATCAGAAGAAGAAGCCAAGGAAAGCAAGAGTCTGCGTTCGTTGCCAAGCAGAACCAGCGCAGCCGAGCTGTGCAGTTTGGTTCAGTTCACTTCAGTCCAGTCCAGTCTAATCCAGTTCCAGTTCGGTTGGAAAGAGAGTCCTTTCGTTCGGTCACCCGAGGAGAGAATGATCGGGGAGGCTGCCATGGCTGTCTGAAGTCGTGAGTAGAAGGAGGAGGGAAGGGGGGAGGGAGGGGGTAGAGTGGGGCTGACTGCGGCCGAGTGACCGAGAGCTGATGTTGCTGCTAGCAGATAATGGCCTGCCTGCCGGATCTGCCTCTAGTGGAGAGGAGGGCGAGGAGTAAGCGGTGGTGGTAGGAGGCAAGAGAAGAGCAGCAATCTGTCTCGGGTGCGCGTCGCCGGAACCTGGCGGAGCTTGTAGAGGGAGGGAGGGAGGGAGGGAGGGAGGAAGGGAGGATTGGGTTGTGTGCCGTGCTGTGCTGAGCGGAGCGAGCGATTACTTCCTGGGAGCATCCATAGGCGGGGGGAGAGTACCCAGCATAGATTGCCGCATGCCCCAACAAGACCGACAGCACGAGTGAGAGAGAGAGAGAGAGTTGAAGGGCGGAGACGAGTGAGAGCGACAGAAAAGATAGGAGAGCAGCAGAAGAGGCAGCGAGGGGGCAGATCGCAGTGTTAGTGTAGTGGTGCGCGCTCAAGAGCAAGAGCAAGAGCGAGTGAGTGAGTGAGTGGGAGGGAGGCGAGGAGAGGAGAGGAGAGGGGAGGGGAGGGAGCGGGTGGAAACAAACGCGTACTGGGGAAGCATTTTGAGGAAGGGAATAAGTGAGCGCAGCAAAGGGTGGCTGTCGGACTGAGGGAGAGAGTGAGGAGAGAAGGGGGTTGGACCAGTACAGTAGGAGAGCCGGCCCGTAATTCGGGGCATATATGGGCAGACAAGCGGGTTGATAGTAGTCCGCATGCGCAGCGATCTCAATCAATTGGAAGAGTTGTCTAGTAACTGAGTCGCGACGAGTCGAGTCGAGACGAGAAGGGGAGAGGAGGAAGACGGAGAGAGAGGGAGAGAGAGAGACGAGGAGGGGAATGAGAAGCGAATCGAAAACATAGGCCCAGGGAAGAAGAAGGAGAGGAAGACGAGTAAGGATTGAACGCACTCACTCACGCACTTGCACTCGGTTGTGGCTGTGGTGGCGGGCGGTCGAGCGGAGTAGTAGAGGAGAGGGGCAAGGCCAGACAAGGCGAGGCAAGGCAAGGCAAGGCGAGGCGAGAGGCAAGGGAAGGGAAGGGAAGGGAAGGGAAGGGAAGCCTGTGACGAGAGGAGAGGAGAAGGTGGAGAGAAGTGCCGCTGCTGTGTGCTGTGCTGCGCAGTCGTTCGTGTCGTTGTGGTCGTGTTGGTTGATCCACTCGAAGCTGTGTCGTAGTGGGGTGTGGTAGTCCTGGTTCGCTCGCTCTTTCTGCTATGGGTTTAGTTGGCTGCTTTGGATTCCGCCTCGAGGCCAGTAGTATGATAATATTGATGCGGGCCTTTCCTGTGAGGTTCAGTGCTGAACCAGCCCATGGTTCTAGTTGAAAGGAAAGCGCTAATCCGAATTGGCATGCAGTAGTCCTGAGGTGTGACGTTTTGTTTCAGGAAGATCTTTGTATAGCGCTTCAGTTGAGGACGGGGTGCTACCACCACCGCCGCCACCACCACCACTTCTCCCTTCTACCCCTTACACCACCACCCTCACTTATCCTTGCCAGCAACAAGCCCCAGCTTAAGCACTAGAAAATCGTCTTCACCATCATCCCAGAGAGAGAGATAGAGAGAGCGAGAGCGAGAGCGAGAGAGAGAGGCGCTGTCATTCGCGCATTGCTGAGGAAATCTCGAGTTCCGGACACAAGCCCTCACTCCAGTCTTCTCACACCGCCCGCCAGTTGGCAGCCGCACTGCCCCTTTGCCACGAATTTTTCCCCGGGAATTGAAGGCTCCTAGAGCTCGAGAGGTCCGTCGCCACATCTGTAATTTGGGCTTCCAGGCGATTTCAGCTCGTTGAGCCTACTGTCCGGTCGCACTTGTACATTCGCACCCCCCCTCCCCCCAAGCCCAAGCCCAGCCCCAGCCCCAGCCCCCTCTTCTTCTTCTTCTTCTTCTTCTTCTTCATCTTCTTCTTCCCCGCACCGACCCCAACCCCCATCTTCCCAAGTTCCCATGCGAGTCTCGGAGCCCCCGTTCTTCCGTCGAGCAGCAGCAGGCGAATCTTGAGAGCCTCGTCCGGAGCAGAAGGCCGTGTCTGCCAATGTGGGCAACGGATATCTTGACCTACGAAAACCTGTCAGAAGAAGAAGACGAGTGGTATCTCGGAGTTCGGTTCTGGGGTAGAGCACCGGCGTCTTAGCCACCGATCGCCTTCGATCCCATTTTCCCATCTCCGCTGTTTCTCGCAAGCAGTCAAGCTGGGAAATTTCGTAGCTGAAGATAGGTCGATGAGGTCGGTCAACAACTGGTTGGCCTTCTCTCTATCGCCCCATTTGACCATTGATGTGCCCGATCATGCGCCTTCCGCACAAACTAATGGTCCTAAGATGGCTCAACATTCTTCAGCGGAGAATGGGTTGTCCTACAACGGAGCACCATCGGGCGAATGCTACAACCTTGGACAGTCGGACGGCGACACCCTGTCCATGCGCCCAGATGGCTCGCTTTGTATTATGGAGGCGTTGAGTCGCTCTCATAGTGGAGATTGGGCCCAGCTCAAGACTAGTCATGTGCAGCACCCCTCCCAGCATTTGCTGAACGCCGACCTCTCGAGGCTGGCGGGCAGCAGAGCACCTAGTGAACAGATCACGCAGAACCAATATGATTCACTGGGTTCCCAATCCAATAAGTCGGACCATGACTCGGGCCCGAAACTGGAAGACTTTTTGGGAGGAGCTTCGTCGCTGGGAGGTCAATACACCAACCGATCAGATTCACAGTCCCACAATTTCGAGAACTTGTACTTCCGGGACATCAATGTGAATCTGAGTCCTTACTCTGGTGGTGCCCAGCAACAGGCCAATCATGTGCCTCCCAGTTTCCATGCGTACGGCTTGCAGCGGACTGATAACTCTTCCACACAGCAACCGTACGACTCTCACTCAAGGAACAACACTGCAGCGGAGCCGAATCTCTGCCACACCAATGTGCACGCTCAGAATCTGCTGCAGGCGGCTCTCGATCAACACCATCACCCGGGGTCCGCCCAGGCCGAAATGTTGCAGGATTGCTCGCTGCAGAGCTCCAACCTCTCGGCGCTCAAGACCTGGCTGCGCCAGAGCCAATCGGCCACGGGCTCGGGCGGCGTCAACGCGCTGGGCTCCGCCGACAACAAGCAGCAGCAGCAGCAGCAGGGGCTCGGCAAGGCCAGCTGCATACCCAACATTGCCGGCGTCCATCAATCTCTGTCGCTGTCCATGAGCCCCGGCTCCCAGTCCAGCAACACTCTGGTGGGCGCCCAGCCCCCCAATGTCACCGCCGAGACCTCCCCGGAGACTCGCAAGCGCGGAGCCGGGCGCGCTGGCAGCAAGGAGGCCTCGCCTCGCAAATCCATCGACACCTTCGGCCAGCGCACTTCTGTCTTCCGCGGAGTGACCAGGCATCGTTGGACGGGGCGCTACGAGGCTCATCTCTGGGACAACAGTTGCCGCAAGGAGGGACAAACCCGAAAGGGACGACAAGTTTATCTTGGTGGATACGATAAAGAGGAAAAGGCTGCGCGAGCCTACGATCTCGCTGCCCTCAAGTACTGGGGTCCGAATACGACCATCAACTTTCCGATACACCAGTATGAGAAGGAGCTCGAGGAGATGAAGAATATGACTCGCCAGGAATACGTGGCATCTCTGCGAAGGAAAAGCAGTGGATTCTCCAGAGGAGCTTCTGTCTACCGAGGAGTGACCAGACACCATCAGCACGGTCGCTGGCAGGCACGAATAGGCCGCGTTGCTGGTAACAAAGACTTGTACTTGGGAACATACAGCACGCAAGAGGAAGCGGCCGAGGCGTATGACATAGCAGCGATCAAGTTCCGAGGAATAAACGCGGTCACGAACTTCGACATCAGCCGCTACGACACGAAGAAGATCTGTGGCACGGCGCACAACACGGCCGATGGCGAGTCGCCCAAGGTGCAAGCGGCGAGCACCAAGGAGCTGGCGGCGGTGCCCCCCGAGCAGCCCAGCGATCCGAGCGTCGACGGTCATCAAACGGACGAGGATTCCCAGAGCTTGCAAACGGGGAACACCAACACCAGCCAGGTGACGGACGGGCTGGTGTCGAAGTCGCATCTGCAGGAGTGGCACATGCTGTACCATCAGCAGCAGACGCAGCGCAATTGGGACGATGCCAACCACCAGCAGCAGCAGCAACAGCAGGCCGCTGCAGCGCAAGCGCAGCAGCAGCAGGATGTGAGGACGCAGTCACTGATCTCGGACTCGCTGGGGCACAAATTCCTGCAGTCCCCGGCGGGCAACATGCACTCGGCGGTGCTGCGCAACCTGATGGGGCTGAGCGACGCGGGGACGAGCGGGAGCGAGTCTTCGGGCGGCATGCTGGCGCTGCCGGGGCCCTCGAGCACCATGATGGGCGGCAGCTCGGGGTTCCCGGGGGCGCAGAGCCCCAAGTCGCTGCGGGAGCAACAACAAAGCGAGGACGAGAGCTCCAAGAGTGGGGGCCAAGGAGGCGGAGGAGGGTCGGCTTACGAGAACTTTCCGCAAGGGGATCTGAGCAGGCATATACTCTACTTGTCCCATGGGCAGTCGCCCCCGAATGGAAGCGCCAAGTCGACGAACAACTACGACAACAGTTCGTTAGGCAACCAATCGTGGATGAGCCCCCAAGGAAATTTGAATCAGCGGGTGTCAGCAGCGGGCCACTTAAGCGTCGGCCATATGCCCATTTTTGCAGTTTGGAACGATTGAAGGAAGGAAGCAGGTTCATTCGCTTCATTCGCTTCTTCGAATAATGAAGGAGGAGGGGAAGAAGATTAAGAAGAAGAAGAAGAAGAAGAAGAAGAGACTGTGATCGATCTATCTGTGCACGAGGAAGTCGGCAGTGCAGGCGTAGAAGGAAAAGATAGAAAAGACCCTTTGAAGAAGAAGAAGAAGAAGATTAGTGTTCGTTCTACTTACTAGAAGAAGCCCATCAACCAGCTAGCCGATCGAGGACGGGGACTCTGGCCTCTCAATCTCTGTCTCACTCTCTCATTCTCATTCTCGTCTGCGATCTGCCGCTGGCAAATCTTTCTGCTCGGTTCGGTTCTTGGGTCTCTAGTAGGACAGGACAGCACCAGGATCCACCACCCACCACCAGCTTCAGTCACCACATCACTCGACATACCCCCCACTCTCGACTCTACTCAACTCCCTCTGTCGCAGTCGCCCATCTGAACTCATTCACTCGCGCGCATGCACTCGTCCGTCGTCGTTGTCCCCGAGAGACAGAGCTTGCGGACATGTTCCGGCCTTGTTCCCCTGTTTTGTTCTACTGGGGAAAGGGGACATTGTAATGTTAGCTGGTGCCCCTTTTTTTGGTCACGTTCCTTGGAAGAAGCAGGCCCCTAGGAAAGATCGAGGATCTCTGGTATTTGTAGCCGCTCCGGCTGCTGGCTGTGTAGGCGAGGCTCGGCCGTCGTCCACTGGTCTCAGCCAGAAGTCAGTTGTTCCTGCTGCTACTGCTGAATTGTGATACATTCATATTAAACACTACGCCATATGGCACATGTAAAATGGTGTGCGAAGAATTCATTTATGCAAACCCGAAAGGGATTGTATGATTGTAAATACGGTT

CDS

>Mapoly0008s0071.1
ATGAGGTCGGTCAACAACTGGTTGGCCTTCTCTCTATCGCCCCATTTGACCATTGATGTGCCCGATCATGCGCCTTCCGCACAAACTAATGGTCCTAAGATGGCTCAACATTCTTCAGCGGAGAATGGGTTGTCCTACAACGGAGCACCATCGGGCGAATGCTACAACCTTGGACAGTCGGACGGCGACACCCTGTCCATGCGCCCAGATGGCTCGCTTTGTATTATGGAGGCGTTGAGTCGCTCTCATAGTGGAGATTGGGCCCAGCTCAAGACTAGTCATGTGCAGCACCCCTCCCAGCATTTGCTGAACGCCGACCTCTCGAGGCTGGCGGGCAGCAGAGCACCTAGTGAACAGATCACGCAGAACCAATATGATTCACTGGGTTCCCAATCCAATAAGTCGGACCATGACTCGGGCCCGAAACTGGAAGACTTTTTGGGAGGAGCTTCGTCGCTGGGAGGTCAATACACCAACCGATCAGATTCACAGTCCCACAATTTCGAGAACTTGTACTTCCGGGACATCAATGTGAATCTGAGTCCTTACTCTGGTGGTGCCCAGCAACAGGCCAATCATGTGCCTCCCAGTTTCCATGCGTACGGCTTGCAGCGGACTGATAACTCTTCCACACAGCAACCGTACGACTCTCACTCAAGGAACAACACTGCAGCGGAGCCGAATCTCTGCCACACCAATGTGCACGCTCAGAATCTGCTGCAGGCGGCTCTCGATCAACACCATCACCCGGGGTCCGCCCAGGCCGAAATGTTGCAGGATTGCTCGCTGCAGAGCTCCAACCTCTCGGCGCTCAAGACCTGGCTGCGCCAGAGCCAATCGGCCACGGGCTCGGGCGGCGTCAACGCGCTGGGCTCCGCCGACAACAAGCAGCAGCAGCAGCAGCAGGGGCTCGGCAAGGCCAGCTGCATACCCAACATTGCCGGCGTCCATCAATCTCTGTCGCTGTCCATGAGCCCCGGCTCCCAGTCCAGCAACACTCTGGTGGGCGCCCAGCCCCCCAATGTCACCGCCGAGACCTCCCCGGAGACTCGCAAGCGCGGAGCCGGGCGCGCTGGCAGCAAGGAGGCCTCGCCTCGCAAATCCATCGACACCTTCGGCCAGCGCACTTCTGTCTTCCGCGGAGTGACCAGGCATCGTTGGACGGGGCGCTACGAGGCTCATCTCTGGGACAACAGTTGCCGCAAGGAGGGACAAACCCGAAAGGGACGACAAGTTTATCTTGGTGGATACGATAAAGAGGAAAAGGCTGCGCGAGCCTACGATCTCGCTGCCCTCAAGTACTGGGGTCCGAATACGACCATCAACTTTCCGATACACCAGTATGAGAAGGAGCTCGAGGAGATGAAGAATATGACTCGCCAGGAATACGTGGCATCTCTGCGAAGGAAAAGCAGTGGATTCTCCAGAGGAGCTTCTGTCTACCGAGGAGTGACCAGACACCATCAGCACGGTCGCTGGCAGGCACGAATAGGCCGCGTTGCTGGTAACAAAGACTTGTACTTGGGAACATACAGCACGCAAGAGGAAGCGGCCGAGGCGTATGACATAGCAGCGATCAAGTTCCGAGGAATAAACGCGGTCACGAACTTCGACATCAGCCGCTACGACACGAAGAAGATCTGTGGCACGGCGCACAACACGGCCGATGGCGAGTCGCCCAAGGTGCAAGCGGCGAGCACCAAGGAGCTGGCGGCGGTGCCCCCCGAGCAGCCCAGCGATCCGAGCGTCGACGGTCATCAAACGGACGAGGATTCCCAGAGCTTGCAAACGGGGAACACCAACACCAGCCAGGTGACGGACGGGCTGGTGTCGAAGTCGCATCTGCAGGAGTGGCACATGCTGTACCATCAGCAGCAGACGCAGCGCAATTGGGACGATGCCAACCACCAGCAGCAGCAGCAACAGCAGGCCGCTGCAGCGCAAGCGCAGCAGCAGCAGGATGTGAGGACGCAGTCACTGATCTCGGACTCGCTGGGGCACAAATTCCTGCAGTCCCCGGCGGGCAACATGCACTCGGCGGTGCTGCGCAACCTGATGGGGCTGAGCGACGCGGGGACGAGCGGGAGCGAGTCTTCGGGCGGCATGCTGGCGCTGCCGGGGCCCTCGAGCACCATGATGGGCGGCAGCTCGGGGTTCCCGGGGGCGCAGAGCCCCAAGTCGCTGCGGGAGCAACAACAAAGCGAGGACGAGAGCTCCAAGAGTGGGGGCCAAGGAGGCGGAGGAGGGTCGGCTTACGAGAACTTTCCGCAAGGGGATCTGAGCAGGCATATACTCTACTTGTCCCATGGGCAGTCGCCCCCGAATGGAAGCGCCAAGTCGACGAACAACTACGACAACAGTTCGTTAGGCAACCAATCGTGGATGAGCCCCCAAGGAAATTTGAATCAGCGGGTGTCAGCAGCGGGCCACTTAAGCGTCGGCCATATGCCCATTTTTGCAGTTTGGAACGATTGA

Protein

>Mapoly0008s0071.1
MRSVNNWLAFSLSPHLTIDVPDHAPSAQTNGPKMAQHSSAENGLSYNGAPSGECYNLGQSDGDTLSMRPDGSLCIMEALSRSHSGDWAQLKTSHVQHPSQHLLNADLSRLAGSRAPSEQITQNQYDSLGSQSNKSDHDSGPKLEDFLGGASSLGGQYTNRSDSQSHNFENLYFRDINVNLSPYSGGAQQQANHVPPSFHAYGLQRTDNSSTQQPYDSHSRNNTAAEPNLCHTNVHAQNLLQAALDQHHHPGSAQAEMLQDCSLQSSNLSALKTWLRQSQSATGSGGVNALGSADNKQQQQQQGLGKASCIPNIAGVHQSLSLSMSPGSQSSNTLVGAQPPNVTAETSPETRKRGAGRAGSKEASPRKSIDTFGQRTSVFRGVTRHRWTGRYEAHLWDNSCRKEGQTRKGRQVYLGGYDKEEKAARAYDLAALKYWGPNTTINFPIHQYEKELEEMKNMTRQEYVASLRRKSSGFSRGASVYRGVTRHHQHGRWQARIGRVAGNKDLYLGTYSTQEEAAEAYDIAAIKFRGINAVTNFDISRYDTKKICGTAHNTADGESPKVQAASTKELAAVPPEQPSDPSVDGHQTDEDSQSLQTGNTNTSQVTDGLVSKSHLQEWHMLYHQQQTQRNWDDANHQQQQQQQAAAAQAQQQQDVRTQSLISDSLGHKFLQSPAGNMHSAVLRNLMGLSDAGTSGSESSGGMLALPGPSSTMMGGSSGFPGAQSPKSLREQQQSEDESSKSGGQGGGGGSAYENFPQGDLSRHILYLSHGQSPPNGSAKSTNNYDNSSLGNQSWMSPQGNLNQRVSAAGHLSVGHMPIFAVWND

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>