Mapoly0013s0061



Description

Arf/Sar family, other

Reference DB

Database ID Description
GO GO:0005525 GTP binding
KEGGORTH K07977 Arf/Sar family, other
KOG KOG0070 GTP-binding ADP-ribosylation factor Arf1
OrthoMCL OG5_138382
PFAM PF00025 ADP-ribosylation factor family
PANTHER PTHR11711 ADP RIBOSYLATION FACTOR-RELATED

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpARFB1 SAR/ARF GTPase Mapoly0013s0061.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0013s0061.1 scaffold_13:584593..589599  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0013s0061.1  

Gene structure:

mRNA scaffold_13:584593..589599  ( - strand )
three_prime_UTR scaffold_13:584593..585036  ( - strand )
CDS scaffold_13:585037..585255  ( - strand )
CDS scaffold_13:586709..586774  ( - strand )
CDS scaffold_13:586939..586998  ( - strand )
CDS scaffold_13:587453..587568  ( - strand )
CDS scaffold_13:587683..587773  ( - strand )
CDS scaffold_13:588966..589022  ( - strand )
five_prime_UTR scaffold_13:589023..589599  ( - strand )

Sequences:

Gene

>Mapoly0013s0061.1
TGGACGCCCAGCGAAAATAGCGGATGGGCAAATGTTATACGTGTGGGGAGTGTTGATCAAGAAGGCGAGCGTAGCAAAGTCGTGCCCGGAAGTGGAAGTGAGGTCAAGAAGAGAAAAAAGAAGAGAAAGCGAAAGGTGAAACCAGCAGAACATTCGGCAGAAAGGAGAAGTGAGAAGACAGGCACATGTTATAGAGGTTAGAATTGAAGGAACGAAACAGATTGCAAAATGGGCATGCGAGGTTGAAATTTGTGAGCCTCAAGACGTCTGGCTGAGTGATCGGGACAGCCTGTTCTTTGTCCAGTTGCCTTCTTATAGGTTTTAGTCTGAGACTTGGATTCTTCGATGTGCGAATAGCACGGAGGGAGAGAGGGAGGGAACGAGGAAGCTCAGGAGGGCGACAAACGCGCAGAGAGGGAGGGAGGGAGAGAGAAGAATTCATCACTGGGCCTGTCTGGAGTGATAGCAAAATCTGTGGATCTGTTGCAGCTAGTTCGATTTGTGCGTGAGTTTGAGGGATGGAACCAGTGAGTTGACTAAACGGGCTGGACCTCCTTATTATGGACATTACATTACGATGGGGCAAACGTTTCGGAAGCTTTTTGACAGCATCTTTGGCAACAAGGAGATGCGAGTAAGTACTATTCCCGCACAATCAATCTTGCCGAGCGCGAGATCTCTCAAGCTGTCATAGGTCACTAGCTCTCGGGAATCGGTAAGTGGGCTGGAACCTTTCACGGACGAACCACGGACCAAATCAGTGAACGTTTGGGAAATTCCCGGCAGCCAAGGTGGTCTTTTGTTGCTTTCAAAGTATCGGTGATCTACGCGTCTCTCGTTTAGCATCTCTGCGATCAAATGACTCATAAATTGACCGGTCACACAAGTTGTTCATCATTATCCTTAGTGTTCAGGCCAGTTACAGCTGTAAATCTGTTATTACTTGGTCCAATCGGACAATTTAAGAAAAAGAAATTGTTCTTTAATCTTAATAATTGGCGGCATATACACGAGAAGAAGAGAGACGCTCGTTGCTGGGAAGAAATTGTGCAAGAAGTTTTGGAAGCTGGCAGTGATTAGAGGTGGAATAGATTCTAATGTCATCTCTAATTTGTAGGATCCAATCTGCTCGTGAATGATATTCTTTCACGATTGATTGGCGGAGCACCTAGCACAAACCATTCACACCTCAGGGTGAGAAGGATGTGTGCTAGGTGTCGGGTCTCATGTATTTACAGCCATTGTACTCTCTTCCAATCAGTCGGCAACTTTGTACATGATGTCAGCCTTTAGTTTAGTCATATACTTATCCTGCACAATGGAGCTACCAGAACGTTCAGGCTAATTTGTAAACTACAGAAAACTGGAGCTGAGAATAGTCGTCGTCGGTTGTGGACCTGGAATTATTGAAGAGCATAGGGTGAAATTGGAGGTGATCAATGACATTGAGCTCAATATATCTGTGTTTAGATCCAGTCCTAGGTCCGTCACTACAAACAATAGTATATTTGATTGTCCCCAACGCTGTTCTGAATGCCCAGAGGCTTTGGTATTTTGGCTACTGTTACATGATTTTAAAGATTCTCCCCCAATGTCGTTAAACTGCGGCTTATGCAATTTACTGAGAAGTTGCAAAACTGTGGCACGGCACGTGAAACTATTCTGGTCGATATCCTTGCCGAAGGACGATGAGACTGGCTAAGAATATGCACAATGTACATTTGTCCAGTTTATTGCTGTGGAGCTCACGCAACTTCGAACAGTAACAATATTTTTGTTACTCTTATCGTAACCTGGTTGTATTTGTGCAACTCTATTTTGTGTAGGTGGTGATGCTGGGTCTAGATGCTGCTGGCAAGACAACCATTCTTTACAAGCTTCACATAGGAGAAATCCTTTCCACAGTGCCCACAATAGGTATGGTCGAAAGAATTTGTGATTCTTGTCTGCGACACTATCAAATGGCAGTTTCCTTTGTGGTTTTAGTACTGAATTGGCTGCTGATATTCGGTTTTACTTTATTGATGACAGGGTTCAACGTTGAGAAAGTACAATACAAGAACGTCGAATTTACGGTTTGGGATGTCGGCGGTCAGGAAAAGTTGAGGCCACTCTGGAGGCATTATTTCAACAACACTGATGGTTTGGTGAGATGTCTCTTTTCGATCTATATTAGTTGTCTCGTTGTTGTTGTGGTGGAAACTATGTCAGCTCTCTCAAGGGATTATTGTTTTAATGCCATATTGCAACCCCTCTCTACGGTTGCCAGTCCTTTCAAACAGTTCAAAAGATCAGCTCGCTTTTGTTTGCGTTTCTTATAGGATAATGTGTTTAAGCCGAGTGGGGAGATCCGTGCCGTCTTGCGAGTCTTGATCCGTGCCGTCTTGCATTTAGGTCTTTCAGCTAGAAAGGGTTTGTGTTCTGCGTTTATGATGGACGATTGCTCTCGCGTATTTCTGAGCGTTGTACAGTAATAATCATGCGTTCACGAGAATACGACGCAAAGAATTTTGTGGAACAACATTTGTTTGAGCGAAATGGAGCACTCTAGTCTCTTTTTGGCAGTTTAGTGCCTTACGATAATTGTTTGTACGTTCGCAGATATATGTGGTCGATTCATTAGATAGAGAGCGAATTGATAAGGCAGCTGCGGAGTTCCAGGTACCTCTTTAATATTGTTCACTTTTATGATTCTTCTGTGTGTTGAGATAGTTTATGGATGGAAGCCTGCTTGTCAATTTAAATTGGAACTCGTGGTTTTGAATCGTTCAGACGGATCTCGTGGATCAGACTGGTGTTTACTAACTGGGTGGGTCTCCTCGCAGACGATCGTGCAAGACCCGTTGATGAGGAACAGTGCTATTCTTGTGTTCGCCAACAAGCAAGACATGGTGGGACATTACGTACTGAACCCCATATGTATCAAACTTGTTTTAGAGAAGACAACTTGTGCAAGTTGTTAGTTGTGGGCAGGCTTGCGAGGGAGTAATCTTAGTCTGCTTGAGCCCTATATATTTTGTAAATGATCTGTGTGTGGGCAACAGCTCTTGATTTTCTTTGCGTTGTTTCCAGACCCAGCGCGATCCTGTTATAAAACCTATGCACCAGAGGCCAACATTTTACTTCAAATCTGCACCCAGACCAGACCATAACCATCAGCAGAGACCTAAGCCCACCCATGCCCACCCATAGCATTACCTGTGCCCACCCATGCTATTCAAATTACGCCAGTTGTGTTATGTGTATTAACCGGTTACACCAATTCTTGGTTGGATCTTGACAAACACTGCCCTTAGCATTACTTGTGCCCACCCATGGAAAAATATTGTCACCCAAAACCCATGGGCATGGGTGGGTTTGGGCGTGGGCATGGGTATGGGCACCCAATGTTGGGCTCTGCTATGCACCTTGGTACCCACTGATGAAGCAGCCGAGTATGTGACCGGAATATGTTTCTTCTCGTTCAGATATTGTTGATGGTCACTGGATGCCTTTCTTGCGTCTGGCTGGAACTTCCATACCGCTCACCTAGTCTCTTAGTATCGCCGTATCGACTGCGGGATTCTTTTCACTACTTACTGCATACAAACGCTTCTATCTTCCGCCGTTTTTCTACTCTTCGTTCATCTGCGTGTTTGCATCTATTATTTTCTCTTCAGTCTTTGGAATCATGTTTCTTTCCATTCGATTCTTTCCATTCAATTGAGAAGCACACCGTGGCCCTGAATTGTTTGGTCCTCTTGCATGTTAAGGCCCTCGGGTTTTTCATGTCCTATTTGTAATTATCTTTATCATTGTCAAGGAACTCTGCAAAATGTTGTACACAAGAGAACACTTCCGTCCCTGAGTTTCCTTCAGAACGGGAGTTGGTTACAATCGAAGATTGTCCACCTCCGATGACAAGTATGATCATCTGATTGCAGTTTGTGATTCCATAATACTAGAAATCACAGTTCTCACTCTGCTTGATGTATGAATCGATTCAGTCAATTGACTTTCCTACGCGGTATCACTTTTCCCATACTATGCATCCAGTTTCTCCGGGTGTGGGCCATATGCACATAGGTCGTTTTGTAGAAGTTCGTTGGATCTCTGGTCTTGGCTTTGAGTTCTGGCTGGTTTTCCATCTAACGACAGCTCCAAGAATCTCTGGATCTCTGTTTGGTGTTCTATGGTCGCCCTACGTATAATTAATGAGCATCCGGAGTGGGTGCTTTCATGCAACTTCAGACGTTATAACTTGAAGTTCAAGACGATCTGTGTGAATAAGAGGGTTCATATTCCTGTGAGGTCTAACTTTTCGGCCGGGAAATGACGAAGTAGTGGGGGTTGGCGTGCATGCAGAAAAATGCTATGAGCCCTGCAGAAGTATGCGAATCGCTGGGTCTGTACAGCCTTCAAAATAGGCGATGGCACATTCAAGGAACGTGCGCTCCCAAAGGGGAAGGCCTTTATGAAGGTCTGGATTGGTTGGCCAACATTCTCAAGGAGATGCAGGCCCAAGGTGTATCGACATCGGTACTTGGATCCACCACTGGAATAAGGCGTTCAGGTGGAAATTGATTGAGATTCTAATTCGCACCACCCCTTCCAGTCAAGGAGATGTTGATTTGGTGGACACCAGAGCAGGCAGTGGTATAGGGAACGATGGAATAGTATTGCAGCTTTTGTCATCGGAAATATCGGTGTTTCTTCACCAGAAGTTAGTGCTCGGTCTTCGTATGCTTTCAAAGTTGCTTGTAGTCATCGCAGAGCGAGTTTCTGCCTCCAGGAGGCATTGTTGTAGATGTTGGCCTTAGATATCGGAGTTAGTAGTGACGACTCAGGCGACCGTGTCCTGTTTGTTTTTTAACGCTTAAGGACCATCCACTGTCATTCATTCTAGGTTCACGCTCGGCTCCTCGGCGGCCTTGATAGTAATGGAGTAATTTCGAATTACTTTTGATTCAATAAGTGTTTGGAATCTACTTTCACATGTTTTCTACATAAAAGTCTCTTAGCTGGTTC

mRNA

>Mapoly0013s0061.1
TGGACGCCCAGCGAAAATAGCGGATGGGCAAATGTTATACGTGTGGGGAGTGTTGATCAAGAAGGCGAGCGTAGCAAAGTCGTGCCCGGAAGTGGAAGTGAGGTCAAGAAGAGAAAAAAGAAGAGAAAGCGAAAGGTGAAACCAGCAGAACATTCGGCAGAAAGGAGAAGTGAGAAGACAGGCACATGTTATAGAGGTTAGAATTGAAGGAACGAAACAGATTGCAAAATGGGCATGCGAGGTTGAAATTTGTGAGCCTCAAGACGTCTGGCTGAGTGATCGGGACAGCCTGTTCTTTGTCCAGTTGCCTTCTTATAGGTTTTAGTCTGAGACTTGGATTCTTCGATGTGCGAATAGCACGGAGGGAGAGAGGGAGGGAACGAGGAAGCTCAGGAGGGCGACAAACGCGCAGAGAGGGAGGGAGGGAGAGAGAAGAATTCATCACTGGGCCTGTCTGGAGTGATAGCAAAATCTGTGGATCTGTTGCAGCTAGTTCGATTTGTGCGTGAGTTTGAGGGATGGAACCAGTGAGTTGACTAAACGGGCTGGACCTCCTTATTATGGACATTACATTACGATGGGGCAAACGTTTCGGAAGCTTTTTGACAGCATCTTTGGCAACAAGGAGATGCGAGTGGTGATGCTGGGTCTAGATGCTGCTGGCAAGACAACCATTCTTTACAAGCTTCACATAGGAGAAATCCTTTCCACAGTGCCCACAATAGGGTTCAACGTTGAGAAAGTACAATACAAGAACGTCGAATTTACGGTTTGGGATGTCGGCGGTCAGGAAAAGTTGAGGCCACTCTGGAGGCATTATTTCAACAACACTGATGGTTTGATATATGTGGTCGATTCATTAGATAGAGAGCGAATTGATAAGGCAGCTGCGGAGTTCCAGACGATCGTGCAAGACCCGTTGATGAGGAACAGTGCTATTCTTGTGTTCGCCAACAAGCAAGACATGAAAAATGCTATGAGCCCTGCAGAAGTATGCGAATCGCTGGGTCTGTACAGCCTTCAAAATAGGCGATGGCACATTCAAGGAACGTGCGCTCCCAAAGGGGAAGGCCTTTATGAAGGTCTGGATTGGTTGGCCAACATTCTCAAGGAGATGCAGGCCCAAGGTGTATCGACATCGGTACTTGGATCCACCACTGGAATAAGGCGTTCAGGTGGAAATTGATTGAGATTCTAATTCGCACCACCCCTTCCAGTCAAGGAGATGTTGATTTGGTGGACACCAGAGCAGGCAGTGGTATAGGGAACGATGGAATAGTATTGCAGCTTTTGTCATCGGAAATATCGGTGTTTCTTCACCAGAAGTTAGTGCTCGGTCTTCGTATGCTTTCAAAGTTGCTTGTAGTCATCGCAGAGCGAGTTTCTGCCTCCAGGAGGCATTGTTGTAGATGTTGGCCTTAGATATCGGAGTTAGTAGTGACGACTCAGGCGACCGTGTCCTGTTTGTTTTTTAACGCTTAAGGACCATCCACTGTCATTCATTCTAGGTTCACGCTCGGCTCCTCGGCGGCCTTGATAGTAATGGAGTAATTTCGAATTACTTTTGATTCAATAAGTGTTTGGAATCTACTTTCACATGTTTTCTACATAAAAGTCTCTTAGCTGGTTC

CDS

>Mapoly0013s0061.1
ATGGGGCAAACGTTTCGGAAGCTTTTTGACAGCATCTTTGGCAACAAGGAGATGCGAGTGGTGATGCTGGGTCTAGATGCTGCTGGCAAGACAACCATTCTTTACAAGCTTCACATAGGAGAAATCCTTTCCACAGTGCCCACAATAGGGTTCAACGTTGAGAAAGTACAATACAAGAACGTCGAATTTACGGTTTGGGATGTCGGCGGTCAGGAAAAGTTGAGGCCACTCTGGAGGCATTATTTCAACAACACTGATGGTTTGATATATGTGGTCGATTCATTAGATAGAGAGCGAATTGATAAGGCAGCTGCGGAGTTCCAGACGATCGTGCAAGACCCGTTGATGAGGAACAGTGCTATTCTTGTGTTCGCCAACAAGCAAGACATGAAAAATGCTATGAGCCCTGCAGAAGTATGCGAATCGCTGGGTCTGTACAGCCTTCAAAATAGGCGATGGCACATTCAAGGAACGTGCGCTCCCAAAGGGGAAGGCCTTTATGAAGGTCTGGATTGGTTGGCCAACATTCTCAAGGAGATGCAGGCCCAAGGTGTATCGACATCGGTACTTGGATCCACCACTGGAATAAGGCGTTCAGGTGGAAATTGA

Protein

>Mapoly0013s0061.1
MGQTFRKLFDSIFGNKEMRVVMLGLDAAGKTTILYKLHIGEILSTVPTIGFNVEKVQYKNVEFTVWDVGGQEKLRPLWRHYFNNTDGLIYVVDSLDRERIDKAAAEFQTIVQDPLMRNSAILVFANKQDMKNAMSPAEVCESLGLYSLQNRRWHIQGTCAPKGEGLYEGLDWLANILKEMQAQGVSTSVLGSTTGIRRSGGN

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>