Mapoly0013s0177



Description

ADP-ribosylation factor-like 1

Reference DB

Database ID Description
GO GO:0005525 GTP binding
KEGGORTH K07942 ADP-ribosylation factor-like 1
KOG KOG0070 GTP-binding ADP-ribosylation factor Arf1
OrthoMCL OG5_128805
PFAM PF00025 ADP-ribosylation factor family
PANTHER PTHR11711 ADP RIBOSYLATION FACTOR-RELATED

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpARFC2 SAR/ARF GTPase Mapoly0013s0177.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0013s0177.1 scaffold_13:2009266..2014972  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0013s0177.1  

Gene structure:

mRNA scaffold_13:2009266..2014972  ( - strand )
three_prime_UTR scaffold_13:2009266..2009936  ( - strand )
three_prime_UTR scaffold_13:2010190..2010195  ( - strand )
CDS scaffold_13:2010196..2010229  ( - strand )
CDS scaffold_13:2010421..2010551  ( - strand )
CDS scaffold_13:2010797..2010844  ( - strand )
CDS scaffold_13:2011021..2011132  ( - strand )
CDS scaffold_13:2011628..2011646  ( - strand )
CDS scaffold_13:2011826..2011888  ( - strand )
CDS scaffold_13:2013536..2013574  ( - strand )
CDS scaffold_13:2014142..2014244  ( - strand )
five_prime_UTR scaffold_13:2014245..2014972  ( - strand )

Sequences:

Gene

>Mapoly0013s0177.1
TGGTTCAAAACTGCGAGGCGCGGGTCGAGGCTCGGGAACGCTGCTCGGGTCGGGAGTCGGGAGCGTCGTGGTCGTGCGTCGTCGTGGCGGCTCACGTCGATCGAGGGCCGAGGGTCACCGGAGACGCCAGGAGCGAGCGAGGTTGCGTTGCGAGGGGAGGCAGCGAGCGAGGGAGCGAGGGAGCGAGAGAGTGTGCTTCGGGAGCCCTCGGGCAAATGAATGGGGGAAGAGCGCTGGGTTGGGGACTGCTCGCTGCATCTGCCTCCTCCTCCTCCTCCTCGAGTCGTTGAATCGTGAAATTGGGTGGCTTTCGTTGTGGTGCCTCGACCTCCGGTCAGCTCTTCGCTCCTGTTCGGTCGGTGGATCGGTGGTGAGGCGTATGTTTGTGCTCGTCGATCGTCGTGGTCATCGTCGTCCATCGAAGCCGATGCGATTTCGGATGGCCGAGTGGGTGGAGCGAGTTGTGGTCGCGCAGGCGAAGTTGTGATGTGATTTGATGTGATCCGACCAGACCAGACCAGACCAGACGAGAACACGACAGCATTGGTTGGTTCCGCTAGACTACGGTATGATCTGATCTGCGCCACCGTTGAGCTCGGTCGCGGTGGGGAGGGGCTGGAGGTTGTTATTTCCAAGTCTGGGGAGCTGCAAGCGTTTGAGGGAAGGTGGAGTGGTGCTTTGCGCTGAGCGGACCGCTGTAAGCTGGGCGGGCCAACAGAGGAGTCACGATGGGAATTTTTTTGTCGAAATTGTTTTCTCAGTTATTTGGAGACAAGGAGGCTCGGATTCTCGTGCTAGGGCTCGACAATGCGGGAAAGACTACCATTCTCTGTATCCTACCTAAATCGTCCGAGTCGAAGTCTGTGCTGATCGGATTCAATGTTGTTGGTTTTTCTCACTTTTTGTTTTTTCGGTACGAACGACCTCGATAGGGTTTGGAAATCAGCCCGCGTCTACGCAGAATCTGGAATAAGGAATGAAGTTGTTTGGAGTATGTGAGCTGCGTGATAAGACCTTTCTCTAATGGGTAAGTGAGCGCTATGTCCGAGAATGTGAAGGCGAAAAATTCCTGTTCATTTTCGTACGTGACCCTGTTCCGACCGCAGACTAGGGGCTTTAAGCTCACAGCACCTCAAGAATTAAATCCTCTGCATAAATGCCCCACAATATGGTGTTGACATGGACAGTCTGGTCTCCTTGAAGTTGCATCAACAAGGTTCTGGCGGAACTGTTGAGTAGAAACAGCTGGATTCAACATATGTTTCCAAAGAATGAAAATGGTTTCATGAGCATAAACTATATCCTTGAAAAGTAGTCCAGTGTTCGTGATCCAATATATATTCGAAGACTAAGTGATGGTCATGATAAGCACATTTATTTCCTTAATTATTTGTTTAGATCGCCTGCAGGTGGGAGAGGTGGTAGCTACTATACCAAGTAAGTCTTGCTATTCTCCTCCTTTTCGTTGCTGACAGCTGAAGATACTCCTAGCATTGATTATACACTCCTAGAGGATAAATTTAACAGCGCTGAAGGTTTTGTCATTGTCCGTTCAATTCCACTTCCATTTTCTCTGCTATCCCTCCCAAAATGATCACTGCAGTGATTCCTATATGTGATAGTTCGGTATGGATCCCAGCTTCGGTAATTAGGTTGAAGTGAGTTATCTCATGGTAAGTTTGACAGCGTCGAAATTGGAAATGAAATGCATTGATCTTTCTCTTTCCACAGTCCCGAGTTCACACGTGAACTTACTGCAGTTATAAAGAGAAAACACATTTTTTCATAATTTATTGTCTGCTGGCATGAATAAAGTACACATAAGAATACGCTGAACAGAGCTACAAGGTTACAATCACGAAGGCTTCTATTATCTTGGATTTTCCGCTTTTCAGTACAGCTGATTCATTCTTGTCCGTGCTCCCAGGCTTGAGCTGGGAACGCAAAGCTGCCAAAGGAAACAGTCACTGAGTTTATCGTCTATCGAGCCTATAGGGGTAGGGACCTAAAGTACAAAGCAAAGTCAGAACGCAGGAGCTAACATCATGGAGATATTGGGTTTGCAATATATGGATCAGATAGATTTATTCTTATGAGTCATACATAAGCAGATGTAATTTGAGGTTGTAAAGCAGGAAACAACGATAGGAGCTTTTTCTAAGTCAGTTTCTACCTCTGAGGGGAAAGCTTTGCCTTTTCAAAATCTTCAAAATCTTCAAGGAACCTCTTCAAAATCTACGTACGTATACCCTGTAGGTATGGCTACATGCCAACGGGAAAAGAAACCAAAGCCCGAGTACATCATCAAGTGGAGGCTACCTCTTACTTTACGTCGGGTTTGGAGTCATCCTCTCACACTAAACCAAACTTAACCGTACGTTGGTACTCATATTTGTCCTATTTCATAATACCAGTAAAATGAGCTTTGAGGGTGAGAAAATTGCAAATTGACAATGACTGGTGGTGAGCAGCCATTAGCTTATGACAATAACGAAGTGAAAGAGGTGGATCATCTTTGCGAAATTTGTATATGTTCAATAGGCGCTTTGTTTACCTCCCTGGTCGTATTGATTTATCATTACGATTGCACTACAAAATGTAGCACATAGTTTGTTTTTCACTTTTGCCACCTGCAAAGTTCTGAAAGGAGAGCTTGCTGCACGACTGAATATGGTTGTTCTTACACGTTCACCTTTTTCACTGGTTCCACAGTTACATCCCAGTTTGCTTCTCTTCATTGAGTAAAAAAGTTTGTTAAGCTCACAGGATAATATATTGAATAGCAAGGATATAGTCAATAGCTGTTGCGACAACCTTACTGGCAAAATTCTCATGTGCTAGTCTAGAAACCAATGTGATACAGCAAACGTCACCCAGGGCCTTGTCATATAAGTGAATTTTTTAGTATCCTTGGTGAAGGTTTTTAGAATCATAAGTCATTAATTAGTTTGACGAGTTTTAGGGGTTAATACAAATAGCTGGCGATGGTAATTGAAAAGGAAATTTGCGTGTTTTAGCGGCCAAGTTAGTTGAATTGTCTTTCTCTGAGTTCTCTAAATGCGGTTGTTCGTTGGTGTGCAACAGCTATTGGTTTTAACGTGGAGACTGTACAATACAACAATATCAAGTTCCAAGTGTGGGACCTTGGTAGGGTTCTCTATTTCTATTTTATGCAACCAAGATGAAAAGATGTTGGTTTATACGAATTTTGGCCCAGTGTACTATTGGCTTGTTACCATTCACTTTACTATTGCTAGACAACTTCTTTCTTATCGGTTGCTTAAAATGTGTGCATGTGGTGTGGAACTCTTCGTCGCCGGTTGCAGGTGGTCAAACGAGTATAAGGTACATTCTGAGGACTTTCTTCCATGAATGAGGACTTTTTCCGATGAAAGTGTAGCCCCCGTTTGTGATAAATGGAATGGAGTGTGGGAGAGATCTTGAAGTTTTATGACTCTTTTCAACGATGGAGGTTGACAGTCACGCCCACTTGAAGACTACTTGTGTTGATTTACACATCCGATCATGTCACATCTGATTATATGTGTCCTAGTCTGTACCTGCTTATGTTCCTTGAGGTCTGTTACCAGCTTCCGATGTCGTTCGTCCTGAAAAGTTAATCTTCTTGTCAGTGAATGTCCAAATAAGTGTTAGAAACATGCATATTGGTTTGGAATGGTGATCTTGGAGATAATTGGTGAAGTTAGCATTGGTTGTTATGGCCTTTACTCGATATTTTTCCAGGTGGAATATCTTTTAGGACTCAACTGTCATTTTATTCAATCGACTTACAGTCCAAGAACGTTTAAGTGTTAACTCAAGTTAACAAACTGGATGCAGACCTTATTGGAGATGCTATTTCCCCAATACGCAAGCAGTCATTTATGTCGTAGACTCAAGCGATACCGATAGGATGGCCACAGCGAAGGAAGAATTTCATGCCATTTTAGAGGTGAAGCCTGCCTTTATTTTGAAAACGTAACGATGACAGTAACATAATTTGAGCTCGAATTGACGCGGGTGCATTCTTCTCCCCTCTTTACGCGTTTCAGCACTTCCTTGCACCTGCTTTTACTTCCTGAACTCAAGAAGTATTGTGTTAACAGTCCAATTTTTTGATATTTACAGGAAGAGGAACTAAAAGATGCCGTGGTTCTCATCTATGCCAACAAGCAGGTTTGTTGGCCTCATCATTTGTCCGTTTTTGAAGAATCTTACATGATTATCAGTAGGAAAGCGTCCTTTTCCATATCGTGGTATCTACATCTTCTCGATGATATTGCTGCCAATAAAAACTTAGGTTTTCTATCTGCGAAGTCTGTTCATCGCATTGTTTTTCTCAATGGTTCTTGAGTAATATATGGTCGTCTGTGAATGGATCACTGCAGAACCTTATCGCTGATGAATTGTTTTCTGGACAGGATCTTCCTGGAGCTCTAGATGATGCATCTGTCACAGAGGCCCTAAATTTGCATAAGATCAAAAACCGGCAGTGGGCTATATTCAAAACTTCAGCTGTTAAGGGAGAAGGGCTCTTTGAGGGTCTTGATTGGTATGCTTGACAATTAGCACACAATACCCAGAGAAAAGCGTGTTGTTATGAGCCTTAAGTCCGTTGGAAGTTTAGTGTTTAGTACCTTTTAGATGGTAGCCATGAAATTGTTTTCGACACCATACACCTCAGAATTTGCGTTTAGGTTTATTCCTCGTATTTACTGTATCGTATATTCATTTGGTTTGCAGGCTCAGTGACACTCTAAAAGCAAGAGGCAGATAACTGAAGGTATGTGCAATATTCTGAATTTGGGGTACATGGTTATATGGCATTTACCACCTTATGCTTTACCCTGGCTTCTCTTTACGAAAAAATTGTGTAGCTGGATCACCAGGCATAGCTCATGTCATGAGGACTAAGAGATCGACGTGCTCTTTGTTGTCTGGAAGTCGTGTATTCCTTGAGTTTCGCTTCCGTATTACTTGATTGGTTGTTTTCATAGCCGTTACCTAAGTAACAAGTGTGGCTGTTTTACTTCCAGAAGCTCGACTCTGGCCAGAATTTTGCATCCAAATCTTCGGGCAGGGAGGCAGCATTGTGTTTTCTTCAACTCGAAGACGCCGCAAAGTCGGTCTTCAACACTCAGTTTCCGAGGTTGAGTCGTGTGGCTACATTCATATTCTCACAACGTTTATCTGATAATCTCAGCATTGCAAGGAGGGAGCGTTCAGTTCTGGATAACGGAGGCCGAAAGTATCTTGATAGAATTTAACCTTCAAAACGTTCACCTCAGTTCCGACCTGTTGATTGTAAGGAGGGAGGGGCCATAGTTTGTAGGGTACTTTTGCTAGGAAATACGTACATATCTATGCAATCTTCACGGTTGCTGAATAGAAAATTATGCCTCTCTACCGTCATTTGGTATGGGAAGACAGAAACCACCTTTACCTAGCATAAGGAATTGGAGTCTATCATTATAGTATAGAATTTAGTTTCAAAAGCGGTCAGTGTTGACGATCAACCAGGTTTACTTGGACATAATTTTACTGATTTTGATGGCAGAAGGTGTTCAAGGAGTTGAAGTAATCCGTAGGTTTTTGAAGTTAGAGGTTTGACCTTGGTTGTATTCATAATTTGGCAAATGCCGCCAGCTTATGTGATGTCAATACTCCGTAATGCATAAATTCCGGTGGCATATTTCAGAAGAAAATT

mRNA

>Mapoly0013s0177.1
TGGTTCAAAACTGCGAGGCGCGGGTCGAGGCTCGGGAACGCTGCTCGGGTCGGGAGTCGGGAGCGTCGTGGTCGTGCGTCGTCGTGGCGGCTCACGTCGATCGAGGGCCGAGGGTCACCGGAGACGCCAGGAGCGAGCGAGGTTGCGTTGCGAGGGGAGGCAGCGAGCGAGGGAGCGAGGGAGCGAGAGAGTGTGCTTCGGGAGCCCTCGGGCAAATGAATGGGGGAAGAGCGCTGGGTTGGGGACTGCTCGCTGCATCTGCCTCCTCCTCCTCCTCCTCGAGTCGTTGAATCGTGAAATTGGGTGGCTTTCGTTGTGGTGCCTCGACCTCCGGTCAGCTCTTCGCTCCTGTTCGGTCGGTGGATCGGTGGTGAGGCGTATGTTTGTGCTCGTCGATCGTCGTGGTCATCGTCGTCCATCGAAGCCGATGCGATTTCGGATGGCCGAGTGGGTGGAGCGAGTTGTGGTCGCGCAGGCGAAGTTGTGATGTGATTTGATGTGATCCGACCAGACCAGACCAGACCAGACGAGAACACGACAGCATTGGTTGGTTCCGCTAGACTACGGTATGATCTGATCTGCGCCACCGTTGAGCTCGGTCGCGGTGGGGAGGGGCTGGAGGTTGTTATTTCCAAGTCTGGGGAGCTGCAAGCGTTTGAGGGAAGGTGGAGTGGTGCTTTGCGCTGAGCGGACCGCTGTAAGCTGGGCGGGCCAACAGAGGAGTCACGATGGGAATTTTTTTGTCGAAATTGTTTTCTCAGTTATTTGGAGACAAGGAGGCTCGGATTCTCGTGCTAGGGCTCGACAATGCGGGAAAGACTACCATTCTCTATCGCCTGCAGGTGGGAGAGGTGGTAGCTACTATACCAACTATTGGTTTTAACGTGGAGACTGTACAATACAACAATATCAAGTTCCAAGTGTGGGACCTTGGTGGTCAAACGAGTATAAGACCTTATTGGAGATGCTATTTCCCCAATACGCAAGCAGTCATTTATGTCGTAGACTCAAGCGATACCGATAGGATGGCCACAGCGAAGGAAGAATTTCATGCCATTTTAGAGGAAGAGGAACTAAAAGATGCCGTGGTTCTCATCTATGCCAACAAGCAGGATCTTCCTGGAGCTCTAGATGATGCATCTGTCACAGAGGCCCTAAATTTGCATAAGATCAAAAACCGGCAGTGGGCTATATTCAAAACTTCAGCTGTTAAGGGAGAAGGGCTCTTTGAGGGTCTTGATTGGCTCAGTGACACTCTAAAAGCAAGAGGCAGATAACTGAAGAAGCTCGACTCTGGCCAGAATTTTGCATCCAAATCTTCGGGCAGGGAGGCAGCATTGTGTTTTCTTCAACTCGAAGACGCCGCAAAGTCGGTCTTCAACACTCAGTTTCCGAGGTTGAGTCGTGTGGCTACATTCATATTCTCACAACGTTTATCTGATAATCTCAGCATTGCAAGGAGGGAGCGTTCAGTTCTGGATAACGGAGGCCGAAAGTATCTTGATAGAATTTAACCTTCAAAACGTTCACCTCAGTTCCGACCTGTTGATTGTAAGGAGGGAGGGGCCATAGTTTGTAGGGTACTTTTGCTAGGAAATACGTACATATCTATGCAATCTTCACGGTTGCTGAATAGAAAATTATGCCTCTCTACCGTCATTTGGTATGGGAAGACAGAAACCACCTTTACCTAGCATAAGGAATTGGAGTCTATCATTATAGTATAGAATTTAGTTTCAAAAGCGGTCAGTGTTGACGATCAACCAGGTTTACTTGGACATAATTTTACTGATTTTGATGGCAGAAGGTGTTCAAGGAGTTGAAGTAATCCGTAGGTTTTTGAAGTTAGAGGTTTGACCTTGGTTGTATTCATAATTTGGCAAATGCCGCCAGCTTATGTGATGTCAATACTCCGTAATGCATAAATTCCGGTGGCATATTTCAGAAGAAAATT

CDS

>Mapoly0013s0177.1
ATGGGAATTTTTTTGTCGAAATTGTTTTCTCAGTTATTTGGAGACAAGGAGGCTCGGATTCTCGTGCTAGGGCTCGACAATGCGGGAAAGACTACCATTCTCTATCGCCTGCAGGTGGGAGAGGTGGTAGCTACTATACCAACTATTGGTTTTAACGTGGAGACTGTACAATACAACAATATCAAGTTCCAAGTGTGGGACCTTGGTGGTCAAACGAGTATAAGACCTTATTGGAGATGCTATTTCCCCAATACGCAAGCAGTCATTTATGTCGTAGACTCAAGCGATACCGATAGGATGGCCACAGCGAAGGAAGAATTTCATGCCATTTTAGAGGAAGAGGAACTAAAAGATGCCGTGGTTCTCATCTATGCCAACAAGCAGGATCTTCCTGGAGCTCTAGATGATGCATCTGTCACAGAGGCCCTAAATTTGCATAAGATCAAAAACCGGCAGTGGGCTATATTCAAAACTTCAGCTGTTAAGGGAGAAGGGCTCTTTGAGGGTCTTGATTGGCTCAGTGACACTCTAAAAGCAAGAGGCAGATAA

Protein

>Mapoly0013s0177.1
MGIFLSKLFSQLFGDKEARILVLGLDNAGKTTILYRLQVGEVVATIPTIGFNVETVQYNNIKFQVWDLGGQTSIRPYWRCYFPNTQAVIYVVDSSDTDRMATAKEEFHAILEEEELKDAVVLIYANKQDLPGALDDASVTEALNLHKIKNRQWAIFKTSAVKGEGLFEGLDWLSDTLKARGR

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>