Mapoly0015s0001



Description

MYC

Reference DB

Database ID Description
GO GO:0046983 Protein dimerization activity
OrthoMCL OG5_162137
PFAM PF00010 Helix-loop-helix DNA-binding domain
PANTHER PTHR11514 MYC
PANTHER PTHR11514:SF33

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpBHLH30 transcription factor, bHLH Mapoly0015s0001.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0015s0001.1 scaffold_15:21674..26467  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0015s0001.1  

Gene structure:

mRNA scaffold_15:21674..26467  ( + strand )
five_prime_UTR scaffold_15:21674..23230  ( + strand )
CDS scaffold_15:23231..24130  ( + strand )
CDS scaffold_15:24816..25295  ( + strand )
CDS scaffold_15:25857..25928  ( + strand )
three_prime_UTR scaffold_15:25929..26467  ( + strand )

Sequences:

Gene

>Mapoly0015s0001.1
AGATGGGCGACCAATGATGGTCGTCCATCGAGAAATGAATTTTATAGTGCTGTGAAAGAGGAAATGAAAGGCGGTCTGAAGGTGCTGCGTGTCAGAGAAGAGGATGGGTTCTGGCACCTTTTCAGAAGCCAAGCGAAGGAAAGCGGGCGCGGCTCGGGCTCGGGCTCGGGCTCGGGGCTGAAAGGTTTTCTCGGGAGCCGAAAGTACCATGCGGCCACGGGCACGCTTCACCGGCGGCCAGGGGCGGAGGTGGTGCAGTGGCAGGGCAGGGCAGGGCAGTGGTGCATGCCTTGGCTCGGCCGCGAGAGAGATCTAGAGAGAGATGAGGATATGAGCTTGGGCCATAGTTGGGGCGCGGCCAAGACGGGGCCAGAGGAGGCGCCGACGAAAGGCCACGTTGCGCTGACGTTCGGCTTCTCTCCTGAGCAGTTGCAGCGCTCTCTCCTCGCGCTCGAGGGAGCGGAAAGAAAAACAGTATCGAAGGCTCGAATCATGGCCCCGAGGGGGAGGGCGAGGGCGAGGGGAGGGAGGGTGGCCTTGTCTTGGATGGCATGACAGCGGAGTGGAGCTCCTCGAAAGAGGCAGCCGAGGCATATCTATGGGGGCTGCTGGGGCGGGCTGGCTGGCTCGCTGGCTGGCTGGCCGGGTGACGCAGTCCCCAAGGCGCGGCCCCAGCCCCCAGCAGGCCCCACCCCGCGAGCCTCCTCGCATTCCACCAGTCCGTCTATTTCTCTCGGAGGGAACACCAAGACCACTTCTTCCTTTATCAGACATGGACGATCAGATCCGTGGATAACGACTGATCGCCTCTTCTCCTCCCCTCCCTGCGCGCTCATTATTTTCACCGCTTCTTTCCTCCCGTCCCAGGAGGATGGTGTCTTTACTCGGCCTCCATGGGAGTTTATCGCCCGCTGCTTCCGTCCAGGCCAGAGCTCCGGAGAGTTGTTAATGGGATTTCTAACCTCCTCTACATCTGCTTTCCAGACAACAACTGCTTGTGCTTCTCTATTCTAGACACACGTTCTAGTCCTAGTAGGTAGCTAGATCACGGTGTGATGATGATGCTACTCGGGCGCGGTCTGTCTCTTGCCTCCAGGAGCCTGAGCCGAGCCTCCATCTCTTCTCATCGCATCGCAACCCGCAACAAGAGCAGCACGGCATGCGGACGGGTGGCCAATGGCACTAGCTTATTGCGCCACTAACCAGTAGGACTGACATGGCCCCCTGCGCTCCCGGAATGGTCAGGTGGACTGAACCGGAATTGGGTAATGGAGTAGGCATCTTGGCGACCTTACCGCTCGCCTCGCGCTCATATACGTACCACCTGCGGCAAAAAATTACCGCTCAGCGTTCTTCTCGCATCTTCTCGACGCTCGCTTTTCGTTAGCCAGGCCCGGGTGCTTAGATACGAAGAAGATGTCGATAGAGCTGCAGCTGAAACCCTTCTCATCGCGATCGCCATCGACCCGGTTGAAAGGCCCGCCCGTAACATCCTCTAATTCTGTCTCTCTTTCATGAGGATCTCTTCCTTCTCCTTGAGATCCATCTTCTAGCTACATGTCGGAGATGTTTTCATGGATCAATAACGCATGCGCAGACTCCGGAAGCACTTTCTCAACCTTCGTGAGCAACGACAGCATCGTTGCCGGACAAGATTTTGGCCGGATGCTCGGATCCGTCTCTCGTGAGGTTCATCTGAATGAGAAGTCCATGTATAGGCTCATACCGTGGGCAGAAAATGCAATATGCTTTCGACCGGGAACTGCGGAGGGCGGTAATCAGCTTGACGACGCCCATGGTTTTTGGTCCACATATGCAGGTGCCGTTCAAGACCAACAATCTAAGCAACAATCTGCAACATCTAAACTAGATTCAGTTCCTGCAACGCCTCCACTACTCTCTGATATCGTGACGCTGGTAAGCGCAACAACGGACCGTGACAAAGTTGGGCAATTACCGAATGAGTTTGCAACTTTCATTGACAGTCTCCCTATTCCTTATGGTTCCTCGAGCACAGGGATTCAAGGCCAATTTTCTTTCGGGGCCAACTCGACTCTCTCGGCAGCAGTCACAGAGACAGAACCATCAATTAGACCCAAAATAGAAATCGGAAATTCCGAAGCTCACCCTAAACTTAGGGCACTCCATTCTGTGTGCATAGAGGCGAAAGACGATCAGGTGAAGAAGATACTTTCCAAATGCGGTAAGTGGACACAATCAGCGGCGGCTAACAAGTCATTGCAGTGGACCACCGTAGGGTTAGAGAAACCCAAAGTCCACGGACGAACAAAGGGGGATTTGTCAAAGAAGACCGAAGGGCCAGGAAGACAGCATCACAAAAGTTTTCGTCCGGTGCCGTCCGAGAAAGCTGAGCACGTGCAGAGGGAACGCGAACGGAGGATTCAGTTAAGAGCAATGTATAAAACACTGGACACCTTGGTACCTGCTCAATCTAGGGTATGTTCTCTCTCCTCGGTAAAGCGATGCATTTGCACTGCTGAACCTGCTGCTGCCTGCGGCATTTTGTTTTTGTTTATGTTTTTTTTCTCTCTCCTGCTTGCACAGAACTTGATAATCTATACAGGAGAAACATATTTTATCAGCTTCCCTCTACGTGCGAGAATTAATAAATGTCGAGACCGTTAGGATTTTTTTCTGAACAAACGATGAGGTTTATTCTGTTGAATGACGCTGGTCTTCAGCGTTGAGAGGATATGCAACACTGCGCTTTAGGTCACTGAGCACTGGCACGGCTGGTTGGGGAATTAGTGCTGAGAAGAACAAGTCTCTCTCTCGTGTCTAGTGTCTTGAACAGTTAGAGATGAACGCGAAGCAAATGCTTATCTGATCAGACCTAAATACCAGCTATCATTTGTGATTCCTGGGTCGGTGCAATCTAACGGACAAGGGTTTAGACTCATTTATGGACATTTTGCAATCGAATTCAAAACGTATGAGTAGCCGAGTCTTGTCCTTAGTAGATATCGTCTCCGTCGAGTATCAGTGAACGAACTCCAGAAATGCGTTCTTCTTTAATTGCTTTTTAGTACTAGTAGTAGTGGAGGTTTGTAATGCACTACTGTTCGATGACGTTGCATGCCTCTAACTGCAACATGTCTATGAAATCTCTCATTGTCAAAAGACAGCAAAGCGGGACCGAACGACAATTGTCAACGATGCCTTGAACTATGTGAAAGAGATGCGTAAGAAGTTGGAGATGCTGCAAGCTTACAAGTCAAAGCCGGTCATGTCACTGGCCTTATCTGAGCTCATTGCCCAGAATATTGAAAAGAGAAACAATCAAGCATCACAGCTTATAACATCCGGCGTCAGAGGAAAAACATCATCTCCAACAAGCAATTCCACGGTTGATATCGAGCACACGGAGGGGGATATCGGGACTGATGGAACCGCTGGCGACACTTCAGTTGTACTTGTGACTCCTGAGGTCAACGTCTTTATGGCTTCTAGTGATCAAGTGGTGATCAACATAAATTGTGGGCCGAGGCCCGACTTACTCAGCAGGATACTGAAGGCACTGGATCTCCTACACCTCGATGTCTCCCACTACACGTTCAGCAGGCTGTGCACACAGTTCGTGAACTGTCATTTCGCGGCAAAGGTATGCTTCTTAATTGAAATCATTTGTAATGTCATTGGTCGCACAAGTATATCATTTTGTCCGTGGTGGAGCTCAGTAGGAAGTGTGATATTAGTGGCATTCATTTCTCAAAGTGTAATTTATGTAAGCAAAAGAATTCGGACTACGTACCAAAAACAATGTGAATACCTGCGAAATACGAATTATACACCTGTATTGCAAACGTTTTTGCGCCGAGTAAACTGTGAAAAATGAATCCAGATTGATGTTGAAGATTTCGTACACAAGAATCCTGTTGAATCATGTTTCGAAGGGTTAAGGTTTTTTCAATCCTTCAGTAATTCAAGAAGGAGGTCCGTGGAAGATAAATCATCACTTCGATCAATAATTGTCCCAAAAATTGAGTTCAACATTACATTCGTGACGTATGCCATTCTGTGACGATTCTCATGTTTCTACGACAAAAAATGTTCACAATTGGAAAAATCAAGCAGCAAGGAAAATCTGGGTGTGAACTGACCAGTAGGGTATGCTCAATATGTCTTTCTAATTCTGCACGAAATTTCTTGATGTCTGGAGCAGATCAGAACGAGTGCTGATACTACCCGTCTAACAGAAATCATCACGGAAGTACTTGGTGACTCACTTGTATAAAGGCAGCTCGGAGTCTGCAGATAATACCTGAATCATCGAGACTACGAAGAGAAAGCGAGTATGCAGCGTATGGAAGCGGGACGTGTTGAAAGCATCTGGTGAACTGGGAGGTAGACGCTTAGCATATTCTACAGATAGTCACCAAGTCAGTCTCATCCAGCTCTGCTGACTTCAAGCTTAGTCCGTGGAGAGAACCTTCTGAATATAAAATATGCCTGCTAAAAGAATGGAGAGGACCCTGTTAAGTGTGTTGGGACTGGACATCGGTGTATATGCTTCGCAAGTCTATAGTGAGAGTGCTTCAGAGTTTCATCAAATCAGAATAGATTTTCAGTAGAAACTGTTGAAAGCCAGCATATAGCTACTTTTTGCATTTGAACTTTGCGATTCACAGTCGCATATGATCGTATAAATAGGCGTTGTAAAGGTCAGTATCTAGCGTCGAATGGTTTACATTCTATGAATTCGTAGACATGCTTTCACTTGGATATTAAGTGGCAGACATTTTAAAGCCCTTGAGTGTGAAATCGATAAACCCG

mRNA

>Mapoly0015s0001.1
AGATGGGCGACCAATGATGGTCGTCCATCGAGAAATGAATTTTATAGTGCTGTGAAAGAGGAAATGAAAGGCGGTCTGAAGGTGCTGCGTGTCAGAGAAGAGGATGGGTTCTGGCACCTTTTCAGAAGCCAAGCGAAGGAAAGCGGGCGCGGCTCGGGCTCGGGCTCGGGCTCGGGGCTGAAAGGTTTTCTCGGGAGCCGAAAGTACCATGCGGCCACGGGCACGCTTCACCGGCGGCCAGGGGCGGAGGTGGTGCAGTGGCAGGGCAGGGCAGGGCAGTGGTGCATGCCTTGGCTCGGCCGCGAGAGAGATCTAGAGAGAGATGAGGATATGAGCTTGGGCCATAGTTGGGGCGCGGCCAAGACGGGGCCAGAGGAGGCGCCGACGAAAGGCCACGTTGCGCTGACGTTCGGCTTCTCTCCTGAGCAGTTGCAGCGCTCTCTCCTCGCGCTCGAGGGAGCGGAAAGAAAAACAGTATCGAAGGCTCGAATCATGGCCCCGAGGGGGAGGGCGAGGGCGAGGGGAGGGAGGGTGGCCTTGTCTTGGATGGCATGACAGCGGAGTGGAGCTCCTCGAAAGAGGCAGCCGAGGCATATCTATGGGGGCTGCTGGGGCGGGCTGGCTGGCTCGCTGGCTGGCTGGCCGGGTGACGCAGTCCCCAAGGCGCGGCCCCAGCCCCCAGCAGGCCCCACCCCGCGAGCCTCCTCGCATTCCACCAGTCCGTCTATTTCTCTCGGAGGGAACACCAAGACCACTTCTTCCTTTATCAGACATGGACGATCAGATCCGTGGATAACGACTGATCGCCTCTTCTCCTCCCCTCCCTGCGCGCTCATTATTTTCACCGCTTCTTTCCTCCCGTCCCAGGAGGATGGTGTCTTTACTCGGCCTCCATGGGAGTTTATCGCCCGCTGCTTCCGTCCAGGCCAGAGCTCCGGAGAGTTGTTAATGGGATTTCTAACCTCCTCTACATCTGCTTTCCAGACAACAACTGCTTGTGCTTCTCTATTCTAGACACACGTTCTAGTCCTAGTAGGTAGCTAGATCACGGTGTGATGATGATGCTACTCGGGCGCGGTCTGTCTCTTGCCTCCAGGAGCCTGAGCCGAGCCTCCATCTCTTCTCATCGCATCGCAACCCGCAACAAGAGCAGCACGGCATGCGGACGGGTGGCCAATGGCACTAGCTTATTGCGCCACTAACCAGTAGGACTGACATGGCCCCCTGCGCTCCCGGAATGGTCAGGTGGACTGAACCGGAATTGGGTAATGGAGTAGGCATCTTGGCGACCTTACCGCTCGCCTCGCGCTCATATACGTACCACCTGCGGCAAAAAATTACCGCTCAGCGTTCTTCTCGCATCTTCTCGACGCTCGCTTTTCGTTAGCCAGGCCCGGGTGCTTAGATACGAAGAAGATGTCGATAGAGCTGCAGCTGAAACCCTTCTCATCGCGATCGCCATCGACCCGGTTGAAAGGCCCGCCCGTAACATCCTCTAATTCTGTCTCTCTTTCATGAGGATCTCTTCCTTCTCCTTGAGATCCATCTTCTAGCTACATGTCGGAGATGTTTTCATGGATCAATAACGCATGCGCAGACTCCGGAAGCACTTTCTCAACCTTCGTGAGCAACGACAGCATCGTTGCCGGACAAGATTTTGGCCGGATGCTCGGATCCGTCTCTCGTGAGGTTCATCTGAATGAGAAGTCCATGTATAGGCTCATACCGTGGGCAGAAAATGCAATATGCTTTCGACCGGGAACTGCGGAGGGCGGTAATCAGCTTGACGACGCCCATGGTTTTTGGTCCACATATGCAGGTGCCGTTCAAGACCAACAATCTAAGCAACAATCTGCAACATCTAAACTAGATTCAGTTCCTGCAACGCCTCCACTACTCTCTGATATCGTGACGCTGGTAAGCGCAACAACGGACCGTGACAAAGTTGGGCAATTACCGAATGAGTTTGCAACTTTCATTGACAGTCTCCCTATTCCTTATGGTTCCTCGAGCACAGGGATTCAAGGCCAATTTTCTTTCGGGGCCAACTCGACTCTCTCGGCAGCAGTCACAGAGACAGAACCATCAATTAGACCCAAAATAGAAATCGGAAATTCCGAAGCTCACCCTAAACTTAGGGCACTCCATTCTGTGTGCATAGAGGCGAAAGACGATCAGGTGAAGAAGATACTTTCCAAATGCGGTAAGTGGACACAATCAGCGGCGGCTAACAAGTCATTGCAGTGGACCACCGTAGGGTTAGAGAAACCCAAAGTCCACGGACGAACAAAGGGGGATTTGTCAAAGAAGACCGAAGGGCCAGGAAGACAGCATCACAAAAGTTTTCGTCCGGTGCCGTCCGAGAAAGCTGAGCACGTGCAGAGGGAACGCGAACGGAGGATTCAGTTAAGAGCAATGTATAAAACACTGGACACCTTGGTACCTGCTCAATCTAGGACAGCAAAGCGGGACCGAACGACAATTGTCAACGATGCCTTGAACTATGTGAAAGAGATGCGTAAGAAGTTGGAGATGCTGCAAGCTTACAAGTCAAAGCCGGTCATGTCACTGGCCTTATCTGAGCTCATTGCCCAGAATATTGAAAAGAGAAACAATCAAGCATCACAGCTTATAACATCCGGCGTCAGAGGAAAAACATCATCTCCAACAAGCAATTCCACGGTTGATATCGAGCACACGGAGGGGGATATCGGGACTGATGGAACCGCTGGCGACACTTCAGTTGTACTTGTGACTCCTGAGGTCAACGTCTTTATGGCTTCTAGTGATCAAGTGGTGATCAACATAAATTGTGGGCCGAGGCCCGACTTACTCAGCAGGATACTGAAGGCACTGGATCTCCTACACCTCGATGTCTCCCACTACACGTTCAGCAGGCTGTGCACACAGTTCGTGAACTGTCATTTCGCGGCAAAGATCAGAACGAGTGCTGATACTACCCGTCTAACAGAAATCATCACGGAAGTACTTGGTGACTCACTTGTATAAAGGCAGCTCGGAGTCTGCAGATAATACCTGAATCATCGAGACTACGAAGAGAAAGCGAGTATGCAGCGTATGGAAGCGGGACGTGTTGAAAGCATCTGGTGAACTGGGAGGTAGACGCTTAGCATATTCTACAGATAGTCACCAAGTCAGTCTCATCCAGCTCTGCTGACTTCAAGCTTAGTCCGTGGAGAGAACCTTCTGAATATAAAATATGCCTGCTAAAAGAATGGAGAGGACCCTGTTAAGTGTGTTGGGACTGGACATCGGTGTATATGCTTCGCAAGTCTATAGTGAGAGTGCTTCAGAGTTTCATCAAATCAGAATAGATTTTCAGTAGAAACTGTTGAAAGCCAGCATATAGCTACTTTTTGCATTTGAACTTTGCGATTCACAGTCGCATATGATCGTATAAATAGGCGTTGTAAAGGTCAGTATCTAGCGTCGAATGGTTTACATTCTATGAATTCGTAGACATGCTTTCACTTGGATATTAAGTGGCAGACATTTTAAAGCCCTTGAGTGTGAAATCGATAAACCCG

CDS

>Mapoly0015s0001.1
ATGTCGGAGATGTTTTCATGGATCAATAACGCATGCGCAGACTCCGGAAGCACTTTCTCAACCTTCGTGAGCAACGACAGCATCGTTGCCGGACAAGATTTTGGCCGGATGCTCGGATCCGTCTCTCGTGAGGTTCATCTGAATGAGAAGTCCATGTATAGGCTCATACCGTGGGCAGAAAATGCAATATGCTTTCGACCGGGAACTGCGGAGGGCGGTAATCAGCTTGACGACGCCCATGGTTTTTGGTCCACATATGCAGGTGCCGTTCAAGACCAACAATCTAAGCAACAATCTGCAACATCTAAACTAGATTCAGTTCCTGCAACGCCTCCACTACTCTCTGATATCGTGACGCTGGTAAGCGCAACAACGGACCGTGACAAAGTTGGGCAATTACCGAATGAGTTTGCAACTTTCATTGACAGTCTCCCTATTCCTTATGGTTCCTCGAGCACAGGGATTCAAGGCCAATTTTCTTTCGGGGCCAACTCGACTCTCTCGGCAGCAGTCACAGAGACAGAACCATCAATTAGACCCAAAATAGAAATCGGAAATTCCGAAGCTCACCCTAAACTTAGGGCACTCCATTCTGTGTGCATAGAGGCGAAAGACGATCAGGTGAAGAAGATACTTTCCAAATGCGGTAAGTGGACACAATCAGCGGCGGCTAACAAGTCATTGCAGTGGACCACCGTAGGGTTAGAGAAACCCAAAGTCCACGGACGAACAAAGGGGGATTTGTCAAAGAAGACCGAAGGGCCAGGAAGACAGCATCACAAAAGTTTTCGTCCGGTGCCGTCCGAGAAAGCTGAGCACGTGCAGAGGGAACGCGAACGGAGGATTCAGTTAAGAGCAATGTATAAAACACTGGACACCTTGGTACCTGCTCAATCTAGGACAGCAAAGCGGGACCGAACGACAATTGTCAACGATGCCTTGAACTATGTGAAAGAGATGCGTAAGAAGTTGGAGATGCTGCAAGCTTACAAGTCAAAGCCGGTCATGTCACTGGCCTTATCTGAGCTCATTGCCCAGAATATTGAAAAGAGAAACAATCAAGCATCACAGCTTATAACATCCGGCGTCAGAGGAAAAACATCATCTCCAACAAGCAATTCCACGGTTGATATCGAGCACACGGAGGGGGATATCGGGACTGATGGAACCGCTGGCGACACTTCAGTTGTACTTGTGACTCCTGAGGTCAACGTCTTTATGGCTTCTAGTGATCAAGTGGTGATCAACATAAATTGTGGGCCGAGGCCCGACTTACTCAGCAGGATACTGAAGGCACTGGATCTCCTACACCTCGATGTCTCCCACTACACGTTCAGCAGGCTGTGCACACAGTTCGTGAACTGTCATTTCGCGGCAAAGATCAGAACGAGTGCTGATACTACCCGTCTAACAGAAATCATCACGGAAGTACTTGGTGACTCACTTGTATAA

Protein

>Mapoly0015s0001.1
MSEMFSWINNACADSGSTFSTFVSNDSIVAGQDFGRMLGSVSREVHLNEKSMYRLIPWAENAICFRPGTAEGGNQLDDAHGFWSTYAGAVQDQQSKQQSATSKLDSVPATPPLLSDIVTLVSATTDRDKVGQLPNEFATFIDSLPIPYGSSSTGIQGQFSFGANSTLSAAVTETEPSIRPKIEIGNSEAHPKLRALHSVCIEAKDDQVKKILSKCGKWTQSAAANKSLQWTTVGLEKPKVHGRTKGDLSKKTEGPGRQHHKSFRPVPSEKAEHVQRERERRIQLRAMYKTLDTLVPAQSRTAKRDRTTIVNDALNYVKEMRKKLEMLQAYKSKPVMSLALSELIAQNIEKRNNQASQLITSGVRGKTSSPTSNSTVDIEHTEGDIGTDGTAGDTSVVLVTPEVNVFMASSDQVVININCGPRPDLLSRILKALDLLHLDVSHYTFSRLCTQFVNCHFAAKIRTSADTTRLTEIITEVLGDSLV

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>