Mapoly0015s0003



Description

Helix-loop-helix DNA-binding domain

Reference DB

Database ID Description
GO GO:0046983 Protein dimerization activity
OrthoMCL OG5_143051
PFAM PF00010 Helix-loop-helix DNA-binding domain
PANTHER PTHR31945 FAMILY NOT NAMED
PANTHER PTHR31945:SF5

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpBHLH29 transcription factor, bHLH Mapoly0015s0003.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0015s0003.1 scaffold_15:44061..49871  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
Mapoly0015s0003.2 scaffold_15:44042..57044  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
Mapoly0015s0003.3 scaffold_15:44061..57044  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
Mapoly0015s0003.4 scaffold_15:44061..55672  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
Mapoly0015s0003.5 scaffold_15:44061..55672  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
Mapoly0015s0003.6 scaffold_15:44061..49871  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0015s0003.1  

Gene structure:

mRNA scaffold_15:44061..49871  ( + strand )
five_prime_UTR scaffold_15:44061..44785  ( + strand )
CDS scaffold_15:44786..45649  ( + strand )
CDS scaffold_15:47559..47825  ( + strand )
CDS scaffold_15:48186..48356  ( + strand )
CDS scaffold_15:49439..49525  ( + strand )
three_prime_UTR scaffold_15:49526..49871  ( + strand )

Sequences:

Gene

>Mapoly0015s0003.1
GGAAAGTAAGCATTGTCAACTAGCCGGCGCTCCGCGGGCAAAGCCGAGTGAAGGGCCGTAATGCGGTGGACACACGGCGTCGCGGACGGCAAAGATTGGAGAGGCGGTGAGGTGCGGTGAGGGGAGGTGAGGTGAAAGGAACGGTACGATCGATAGGCTGGAAGGCATGGCATGGCGCTCGAGCTCGAGCGCTCGCTGGCGCTGAGGCTGAGGCTGAGGCCGCGCGGGTCGGCCTCGCGCTCTTGGTCTAGTTCGCCGCGGACCGGTCGTCTCGTCGCCTACTTTCCCTTCGGTGGTGCACTGCTGCGGCGTTGTGTACTGTAGTGTTCTCCGCCTCGTTCTCGAGGGTGAGCACGCTGATCTTTGTCCTCATCGAGATCATCGGGGCGAGAGTCCACGCTCGTCCATATCTGGAATCCAGACCGAAAGTAAGCATTGAAATTGGTTTGTCGGTGGGTGCGTGCGTGCGAGGCAGCGAACGAATCAGATTTTCGCCAATTATTCACTACACCTCAAGACCTCCATTCTTGAGAATCACTGGTTCCGAGGCCGGACGAGATAACTCGAACAGGCAGCCGGCCAGCCGGCGTCTCTGGAGCAGAAATCAGGCCAAGGAATGCGAGAACTGCTGTCTTTCTTGTACTTACGACTGCTCCTCCGAGTCTACACGAGGGCCCAACATGTGAAGGTCCTATGAAGAGTCTTATTTGAAGCAGGCTCGTGACATGCATTCCATTGTGGGTCGAGGACGGAGGCCTGCGTTTCGGGAGGAGCAGGGATGGAAAGAACACAGTTCGCCCCACACACCTCTGTCACCTAATTTCCATGCCGATCCGTTGTTCGGCACACCTAGTGGGTCATTGCAGGATATTCTTCGCTCCGTCCACATGGTCGAAGGCTCCGCTTTTGTGAGTGTCCCGAAAAGTTCCGGGTCTCAAGCACCACCAGATATTATCGCCCCTCAGCAGCAGCAACAGGTCAGTTCAACCGCTCGGAACGTAAGCGTCGACGCTCCCGTGATAGATGATGGATTGGGCAAGCTGCAAAGGAAGCAACTGCAATGTCACACAAGCTCTTCGTGGGATCACAATATGAGGAATGAGCACGTCTTCGAAGGTTATCCGCATGTTGGACTTGCGGATATCTCCAACACTCAACTGCAGCTCGACAGCTTCAAGCCCGTTGGCACATGGACTGATACGCCAGGCGCTGATCACGAACAGCAATGGACCGATCTGCGCAGGAGCTCTAAGACGACCATGCTCTCACCTGGTCCCAATCTCGATAGTGGCACTTGTCAGCCGTCCGTATGGCGAGAACGCTGGTCCGATAGTTCCAGGGTGCACGCGTCTTCGCATCAGGAGAGACACAGAGCTGCAGCGCCAGCAGCGGGAGCAGCAGCAGCAGCAGCGCACCTGGAAGAATCCACAGATGGAGGTAGTGATCCCATGGACGAAAAAAATTCACGGCGCTTCTCCAACACCGCGGGTTATTGTTCCTCCCGAAATCTTTTCTCCGAACGCAAACGACGTAAGAAGATGAACGACGGCTTGTATTCCTTGCGCTCTATAGTTCCAAACATCAGCAAGGTAAGACATCTTTTATCTTCCAGGAAGATGACCCCGCAAGCTTTCAGCTAGAGGTGACACGTTCGTTCGTTGACTATGAGCACTTGTACACTTATGGCTTACTTCGTCGTCGTTTCTATCGCATCGATGGAATTTACAGCAGGCTCGAACTTAGTGGCGAATTCATCACGAGAAGCCTTTGAAAGGATCCTGTCACTCATGTTCTCCAGCTCGCTACACATAGAAGAGGCTAGGTACCTATCCTCACCGGAATTAGCACAATCTTCTCTTCAAAATGCCCACAGCTTAGATTCATAACTCGCCAGTGCCAAAATCCTTCACCTAGAGCTCTCAAACCAATATAGATAGCGGAATTCAAGACATGCATATACATCATGAAGCTTTGTCATCCCCGCCTTTCGAATCCCTCCTCCTTGAGAATCTCGCTGACACAAGGCCCTTCCTAAAGACATCTTCTGTTGATATTGTCAACTTGAACAATCGTTTACAGCTAGTACTGACGGACTTGAGACTAACCCATATGAAAGTGTTAAAATTAGTCCAGTTACTCAGCTTGCATTCAGTTACAACCTCAATTCAACATCAATGATGTTCTCCCGAGACCAGTCGGGAGAACATTGACATGTATCAAGATGGATCCAGATCCTTGACAAAGATAATTGGTGCAACCTTGCGTTGTTCTCCCGAGGCTAGTCGGGAGAACATTGGCATGTATCAAGATGGATCCAGATCCTTGGCAAAGATAATTGGTGCAACCCTTGCGTTGTTCTCCCGAGGCCAGTCGGGAGAACATTGACATGCATCAAGATGGATCCAGATCCTTGACAAAGACAATTGGTGCAACCTTGCGTTACTCTCTGAGATGTCAAGCTGGTAATGCTTAGCATCTCCTTTGCTGTCAGATGGCATCTGATCCAGACGCCATTCGTCCTCGCCTTAGACAACGAAATCGCTGACATAATTGCTTGCCGGCCAGTCTGACCTCCTACATTTCCGTCTTTATTCATCCTCATCTTATTTCTATTACTCCTAGTTGATATAGTTGTAGAACATTTCATAACCCCAACTGTTGGGACCAGATTCAGCAATTCGCGGCTTAAAAATCGCAAGCCGGCGAGCTTTTCGCTGCTGTCTAAACCGGAATATTTTGTTTTGTTTTGATAGAAACAGTTCACCATGGGGAGTGGACTTTAGGCGGCGGTGATGGTTCATTCCTTCTTGCAGTAAACGTCCAAGAGATTGTGGATGGAGCCGCAGTAACTGGATTGTTCATCCATTGAAAGCTCCACAAAAGCCGGATGTCATATGCGCTTGACCATAACCACGTACAATAATGGCTTCCGCACTTGGTGAAACATCCCTCGGCTTCCAGTTTCATGGGAATGAAAGACCTTTCTATCCAAGAATTGCATCGGAGTACGCTGTTGTCTCATAATGCTGTCCACTAAGATTCGTGAAGAGACGTTTATTTTTAGGCCACAACATGCACGTATTGCCTGTACTACTCACAGATCGTGAGGGTATCCATTTATAGTATTGCACTGTCACACCTGATTCTTGCGGATGCGATCCTCGAAAATATTGGAGCATTGTACGTGGAGATTGCATCTAGAACTCATTATGGGTACCATCAAGATGACATCCCGAAGTAGACCTCCTACATATTCGGACTTGAGACGATGACAAAGATCAATAGTATACCTATTGACCCGATGGGTTCAAAGTCCGTATGGAACTGACAAATTCTCAGACTTTAGATCAGTAGTGAAGACCTCGGCCTTGACAGACGAGTGCTGCAGTCGATTGTGTACTATTTTTTGCGATTGTCAGTTATTTGGACTTCTACAAAGTTTGCGGGTTACTTGGGCTGATTGATCTCATCTATTCATTTCTGTTGTTAAAATTATAGATGGATAAAGCATCGATCATCGGAGACGCAATTAAGTACGTAATGGAGTTAGAGAGACAAGTGAAGGAGCTGGAGGGGGAGATGGAACTTGACGAGCAAAGGAAAAACAAGATAAACTCAAGCTCCGATACTCTGGGCTCCTTGGCCGCTACGGGTGTCCAGCATGGCGGAGATGCAGCAGCACAGAATGACAAAGATGTGGACTGGAATAAAAATTCGGGAGGAAATGTTTCCAAGTTAGACACGAAAGATCAGCCTAACGTTACGGTGAGTCTGGATGTAAGGATTCCAGCAAATCGTTGGGAATGAGCCCAATCAATCAAGAATGAAGAAATCCATTTGAAATATATTGAAATATGTACAGATCCGACTGCATAGGTACCTGGACCCCTTCACCCCAAAGAATCGCTAGCCCTTGAATTCACTGCGCGTATCAGAAATTCAAATCCAACTTCATGAAATCCATCTCACGAAAATTTCCTAACTGCGTTGGCGGTCATGTAAGTCGTAGATGATATTCGCCTAGAGGCAATTAATTCAACGTTAAAAGACTCTTCGAATTCTATGACCTCGTCTATCACAGGATGGCGAATTTCACTGTTCATCGTATTCCTTGTTCTTTGGCAGCTGGAGCTCTCCAAGATGAAGACCGGAATGTACAATTTGCGGATGTTCTATCAACAGCAGCCCGGCATTTTCATGCACATGACGCAAGCTATTGAGAGTTTGGATCTGAACATCCTTAACTCTCATGTATCGACCTGTGATGGCTATGTTGTGCACTCCATGATTGCCAAGGTATGTACAGGTGCTTAGCCTTATGAATGTTCCTAGTTTTCAACTTCTTCAGATACAAAAATCGAAATGGTTTAAGATGCACTGGCATCAGAAATTGGCACTTGTGTATGCTTCAAACGTCTAGAACGTCTTTCTCACCCACTCAATGGCGAAAATGTTGCCCTCGACAGCCAGATTTAGGGGTAGTAATTTGCGGCAGCCCCTACCTGTTAGCAATCTGATAATATTGTATCGACAGCAAATCAAAGAAATCCAGACTAGAATATGATATATTCTGCCAATTACGGATTTCGTGTGTTCTGGACCGGCTCTTGAATATATGTCGGACGCAGAACCTAGACCTTGGGTCATGTAGATTCCGAATCGAAGCTCGAAGTTTTCAATTTTTCTTTGTGTTGTGAGCCTCTACATTATTGTCATAAGGGCTGCGCCTCAATAATTATATCTTCCTATGCACAGCTCAATAGGGGACTCACAGATTAAATAATAATACCGTAGATCTGTATAATAGAGAAGTATGAGATTCTGTATCAACTTAAACATGGTTGGACCTAAAAATTTGCATCATTGACTGCTGCCATTAAAGTCAGCCATGTAGTCCTAAAGCAGCTTGAAACAAATTCTCTCTGATATATGAACCACTAATTATATAAACAATACTAATGTATAGCAGTACTATATTCTTGTTTGTTAGTCTAGCATGCACCTTAATGGGCACATGAACGCACGAATTCTTGAATGGTATGTCGGCTCTAGCAGTAAGTTGTATCTGACAATCTCTTTTACGCTTTTAAGTAGGTTTTCTGAATTTGAGTTCAACCTCGGTAGCGAGTTCACCCTGAAACCAAGTTCAAGATCACCTGTTGCCTTCTGGCTTGATTGCATGAGAAGTTTTACTTGGATACATCCAACATTCTGGGTCTTGGATCCTGGGAGTTCGTCCTGATATCGAAGGCAAATTCATGGTAGAGATAAACACATTTTCTTTTGTAAGGGAATGAATCCTATGTAATATTATTTCCTTGCCTAGAGCATGAATAGATTTTTCAGTTTGTCACTCTCATAATTCACTTCGATTTCAGGATGCACTCCAGGTTCCAGGACCAAGAACTTTAACACATCTAAAGCAGAGAAATATCAGGCAAACAAATGGTGAAAACTATTTCTAGCTGACGATACATGGCTAGGCTGGAACTCTGAAATAACGGAGATAAAAAAGTTCGTAGATCGAAAGTCAATACTTGTTTTGCAGAGAGCATCTTTACACCTTCAAGTACTTTTGTTCACTTTCCATCTACCATCAAAAGACAGCATCCTTTACCTCTTCTTGAAGTGTTCACAGTCTTGTCCAGAAATAAGCTTCAGCAAACTACTTGTGTATGGTAAAGAGAACTGCGGCCTAGTAGGAATATATTGTGTATTGTTGAGTGTCTAGCAATCAGCAATATGCTTTGAGTATATAAGATAGACCCTTGATCAGACTCCTTCCTCGAATTACTAATTATACAGACCATC

mRNA

>Mapoly0015s0003.1
GGAAAGTAAGCATTGTCAACTAGCCGGCGCTCCGCGGGCAAAGCCGAGTGAAGGGCCGTAATGCGGTGGACACACGGCGTCGCGGACGGCAAAGATTGGAGAGGCGGTGAGGTGCGGTGAGGGGAGGTGAGGTGAAAGGAACGGTACGATCGATAGGCTGGAAGGCATGGCATGGCGCTCGAGCTCGAGCGCTCGCTGGCGCTGAGGCTGAGGCTGAGGCCGCGCGGGTCGGCCTCGCGCTCTTGGTCTAGTTCGCCGCGGACCGGTCGTCTCGTCGCCTACTTTCCCTTCGGTGGTGCACTGCTGCGGCGTTGTGTACTGTAGTGTTCTCCGCCTCGTTCTCGAGGGTGAGCACGCTGATCTTTGTCCTCATCGAGATCATCGGGGCGAGAGTCCACGCTCGTCCATATCTGGAATCCAGACCGAAAGTAAGCATTGAAATTGGTTTGTCGGTGGGTGCGTGCGTGCGAGGCAGCGAACGAATCAGATTTTCGCCAATTATTCACTACACCTCAAGACCTCCATTCTTGAGAATCACTGGTTCCGAGGCCGGACGAGATAACTCGAACAGGCAGCCGGCCAGCCGGCGTCTCTGGAGCAGAAATCAGGCCAAGGAATGCGAGAACTGCTGTCTTTCTTGTACTTACGACTGCTCCTCCGAGTCTACACGAGGGCCCAACATGTGAAGGTCCTATGAAGAGTCTTATTTGAAGCAGGCTCGTGACATGCATTCCATTGTGGGTCGAGGACGGAGGCCTGCGTTTCGGGAGGAGCAGGGATGGAAAGAACACAGTTCGCCCCACACACCTCTGTCACCTAATTTCCATGCCGATCCGTTGTTCGGCACACCTAGTGGGTCATTGCAGGATATTCTTCGCTCCGTCCACATGGTCGAAGGCTCCGCTTTTGTGAGTGTCCCGAAAAGTTCCGGGTCTCAAGCACCACCAGATATTATCGCCCCTCAGCAGCAGCAACAGGTCAGTTCAACCGCTCGGAACGTAAGCGTCGACGCTCCCGTGATAGATGATGGATTGGGCAAGCTGCAAAGGAAGCAACTGCAATGTCACACAAGCTCTTCGTGGGATCACAATATGAGGAATGAGCACGTCTTCGAAGGTTATCCGCATGTTGGACTTGCGGATATCTCCAACACTCAACTGCAGCTCGACAGCTTCAAGCCCGTTGGCACATGGACTGATACGCCAGGCGCTGATCACGAACAGCAATGGACCGATCTGCGCAGGAGCTCTAAGACGACCATGCTCTCACCTGGTCCCAATCTCGATAGTGGCACTTGTCAGCCGTCCGTATGGCGAGAACGCTGGTCCGATAGTTCCAGGGTGCACGCGTCTTCGCATCAGGAGAGACACAGAGCTGCAGCGCCAGCAGCGGGAGCAGCAGCAGCAGCAGCGCACCTGGAAGAATCCACAGATGGAGGTAGTGATCCCATGGACGAAAAAAATTCACGGCGCTTCTCCAACACCGCGGGTTATTGTTCCTCCCGAAATCTTTTCTCCGAACGCAAACGACGTAAGAAGATGAACGACGGCTTGTATTCCTTGCGCTCTATAGTTCCAAACATCAGCAAGATGGATAAAGCATCGATCATCGGAGACGCAATTAAGTACGTAATGGAGTTAGAGAGACAAGTGAAGGAGCTGGAGGGGGAGATGGAACTTGACGAGCAAAGGAAAAACAAGATAAACTCAAGCTCCGATACTCTGGGCTCCTTGGCCGCTACGGGTGTCCAGCATGGCGGAGATGCAGCAGCACAGAATGACAAAGATGTGGACTGGAATAAAAATTCGGGAGGAAATGTTTCCAAGTTAGACACGAAAGATCAGCCTAACGTTACGCTGGAGCTCTCCAAGATGAAGACCGGAATGTACAATTTGCGGATGTTCTATCAACAGCAGCCCGGCATTTTCATGCACATGACGCAAGCTATTGAGAGTTTGGATCTGAACATCCTTAACTCTCATGTATCGACCTGTGATGGCTATGTTGTGCACTCCATGATTGCCAAGGATGCACTCCAGGTTCCAGGACCAAGAACTTTAACACATCTAAAGCAGAGAAATATCAGGCAAACAAATGGTGAAAACTATTTCTAGCTGACGATACATGGCTAGGCTGGAACTCTGAAATAACGGAGATAAAAAAGTTCGTAGATCGAAAGTCAATACTTGTTTTGCAGAGAGCATCTTTACACCTTCAAGTACTTTTGTTCACTTTCCATCTACCATCAAAAGACAGCATCCTTTACCTCTTCTTGAAGTGTTCACAGTCTTGTCCAGAAATAAGCTTCAGCAAACTACTTGTGTATGGTAAAGAGAACTGCGGCCTAGTAGGAATATATTGTGTATTGTTGAGTGTCTAGCAATCAGCAATATGCTTTGAGTATATAAGATAGACCCTTGATCAGACTCCTTCCTCGAATTACTAATTATACAGACCATC

CDS

>Mapoly0015s0003.1
ATGCATTCCATTGTGGGTCGAGGACGGAGGCCTGCGTTTCGGGAGGAGCAGGGATGGAAAGAACACAGTTCGCCCCACACACCTCTGTCACCTAATTTCCATGCCGATCCGTTGTTCGGCACACCTAGTGGGTCATTGCAGGATATTCTTCGCTCCGTCCACATGGTCGAAGGCTCCGCTTTTGTGAGTGTCCCGAAAAGTTCCGGGTCTCAAGCACCACCAGATATTATCGCCCCTCAGCAGCAGCAACAGGTCAGTTCAACCGCTCGGAACGTAAGCGTCGACGCTCCCGTGATAGATGATGGATTGGGCAAGCTGCAAAGGAAGCAACTGCAATGTCACACAAGCTCTTCGTGGGATCACAATATGAGGAATGAGCACGTCTTCGAAGGTTATCCGCATGTTGGACTTGCGGATATCTCCAACACTCAACTGCAGCTCGACAGCTTCAAGCCCGTTGGCACATGGACTGATACGCCAGGCGCTGATCACGAACAGCAATGGACCGATCTGCGCAGGAGCTCTAAGACGACCATGCTCTCACCTGGTCCCAATCTCGATAGTGGCACTTGTCAGCCGTCCGTATGGCGAGAACGCTGGTCCGATAGTTCCAGGGTGCACGCGTCTTCGCATCAGGAGAGACACAGAGCTGCAGCGCCAGCAGCGGGAGCAGCAGCAGCAGCAGCGCACCTGGAAGAATCCACAGATGGAGGTAGTGATCCCATGGACGAAAAAAATTCACGGCGCTTCTCCAACACCGCGGGTTATTGTTCCTCCCGAAATCTTTTCTCCGAACGCAAACGACGTAAGAAGATGAACGACGGCTTGTATTCCTTGCGCTCTATAGTTCCAAACATCAGCAAGATGGATAAAGCATCGATCATCGGAGACGCAATTAAGTACGTAATGGAGTTAGAGAGACAAGTGAAGGAGCTGGAGGGGGAGATGGAACTTGACGAGCAAAGGAAAAACAAGATAAACTCAAGCTCCGATACTCTGGGCTCCTTGGCCGCTACGGGTGTCCAGCATGGCGGAGATGCAGCAGCACAGAATGACAAAGATGTGGACTGGAATAAAAATTCGGGAGGAAATGTTTCCAAGTTAGACACGAAAGATCAGCCTAACGTTACGCTGGAGCTCTCCAAGATGAAGACCGGAATGTACAATTTGCGGATGTTCTATCAACAGCAGCCCGGCATTTTCATGCACATGACGCAAGCTATTGAGAGTTTGGATCTGAACATCCTTAACTCTCATGTATCGACCTGTGATGGCTATGTTGTGCACTCCATGATTGCCAAGGATGCACTCCAGGTTCCAGGACCAAGAACTTTAACACATCTAAAGCAGAGAAATATCAGGCAAACAAATGGTGAAAACTATTTCTAG

Protein

>Mapoly0015s0003.1
MHSIVGRGRRPAFREEQGWKEHSSPHTPLSPNFHADPLFGTPSGSLQDILRSVHMVEGSAFVSVPKSSGSQAPPDIIAPQQQQQVSSTARNVSVDAPVIDDGLGKLQRKQLQCHTSSSWDHNMRNEHVFEGYPHVGLADISNTQLQLDSFKPVGTWTDTPGADHEQQWTDLRRSSKTTMLSPGPNLDSGTCQPSVWRERWSDSSRVHASSHQERHRAAAPAAGAAAAAAHLEESTDGGSDPMDEKNSRRFSNTAGYCSSRNLFSERKRRKKMNDGLYSLRSIVPNISKMDKASIIGDAIKYVMELERQVKELEGEMELDEQRKNKINSSSDTLGSLAATGVQHGGDAAAQNDKDVDWNKNSGGNVSKLDTKDQPNVTLELSKMKTGMYNLRMFYQQQPGIFMHMTQAIESLDLNILNSHVSTCDGYVVHSMIAKDALQVPGPRTLTHLKQRNIRQTNGENYF

Mapoly0015s0003.2  

Gene structure:

mRNA scaffold_15:44042..57044  ( + strand )
five_prime_UTR scaffold_15:44042..44785  ( + strand )
CDS scaffold_15:44786..45649  ( + strand )
CDS scaffold_15:47559..47825  ( + strand )
CDS scaffold_15:48186..48356  ( + strand )
CDS scaffold_15:56043..56117  ( + strand )
three_prime_UTR scaffold_15:56118..57044  ( + strand )

Sequences:

Gene

>Mapoly0015s0003.2
CTGTTTTGGGAACCGATTCGGAAAGTAAGCATTGTCAACTAGCCGGCGCTCCGCGGGCAAAGCCGAGTGAAGGGCCGTAATGCGGTGGACACACGGCGTCGCGGACGGCAAAGATTGGAGAGGCGGTGAGGTGCGGTGAGGGGAGGTGAGGTGAAAGGAACGGTACGATCGATAGGCTGGAAGGCATGGCATGGCGCTCGAGCTCGAGCGCTCGCTGGCGCTGAGGCTGAGGCTGAGGCCGCGCGGGTCGGCCTCGCGCTCTTGGTCTAGTTCGCCGCGGACCGGTCGTCTCGTCGCCTACTTTCCCTTCGGTGGTGCACTGCTGCGGCGTTGTGTACTGTAGTGTTCTCCGCCTCGTTCTCGAGGGTGAGCACGCTGATCTTTGTCCTCATCGAGATCATCGGGGCGAGAGTCCACGCTCGTCCATATCTGGAATCCAGACCGAAAGTAAGCATTGAAATTGGTTTGTCGGTGGGTGCGTGCGTGCGAGGCAGCGAACGAATCAGATTTTCGCCAATTATTCACTACACCTCAAGACCTCCATTCTTGAGAATCACTGGTTCCGAGGCCGGACGAGATAACTCGAACAGGCAGCCGGCCAGCCGGCGTCTCTGGAGCAGAAATCAGGCCAAGGAATGCGAGAACTGCTGTCTTTCTTGTACTTACGACTGCTCCTCCGAGTCTACACGAGGGCCCAACATGTGAAGGTCCTATGAAGAGTCTTATTTGAAGCAGGCTCGTGACATGCATTCCATTGTGGGTCGAGGACGGAGGCCTGCGTTTCGGGAGGAGCAGGGATGGAAAGAACACAGTTCGCCCCACACACCTCTGTCACCTAATTTCCATGCCGATCCGTTGTTCGGCACACCTAGTGGGTCATTGCAGGATATTCTTCGCTCCGTCCACATGGTCGAAGGCTCCGCTTTTGTGAGTGTCCCGAAAAGTTCCGGGTCTCAAGCACCACCAGATATTATCGCCCCTCAGCAGCAGCAACAGGTCAGTTCAACCGCTCGGAACGTAAGCGTCGACGCTCCCGTGATAGATGATGGATTGGGCAAGCTGCAAAGGAAGCAACTGCAATGTCACACAAGCTCTTCGTGGGATCACAATATGAGGAATGAGCACGTCTTCGAAGGTTATCCGCATGTTGGACTTGCGGATATCTCCAACACTCAACTGCAGCTCGACAGCTTCAAGCCCGTTGGCACATGGACTGATACGCCAGGCGCTGATCACGAACAGCAATGGACCGATCTGCGCAGGAGCTCTAAGACGACCATGCTCTCACCTGGTCCCAATCTCGATAGTGGCACTTGTCAGCCGTCCGTATGGCGAGAACGCTGGTCCGATAGTTCCAGGGTGCACGCGTCTTCGCATCAGGAGAGACACAGAGCTGCAGCGCCAGCAGCGGGAGCAGCAGCAGCAGCAGCGCACCTGGAAGAATCCACAGATGGAGGTAGTGATCCCATGGACGAAAAAAATTCACGGCGCTTCTCCAACACCGCGGGTTATTGTTCCTCCCGAAATCTTTTCTCCGAACGCAAACGACGTAAGAAGATGAACGACGGCTTGTATTCCTTGCGCTCTATAGTTCCAAACATCAGCAAGGTAAGACATCTTTTATCTTCCAGGAAGATGACCCCGCAAGCTTTCAGCTAGAGGTGACACGTTCGTTCGTTGACTATGAGCACTTGTACACTTATGGCTTACTTCGTCGTCGTTTCTATCGCATCGATGGAATTTACAGCAGGCTCGAACTTAGTGGCGAATTCATCACGAGAAGCCTTTGAAAGGATCCTGTCACTCATGTTCTCCAGCTCGCTACACATAGAAGAGGCTAGGTACCTATCCTCACCGGAATTAGCACAATCTTCTCTTCAAAATGCCCACAGCTTAGATTCATAACTCGCCAGTGCCAAAATCCTTCACCTAGAGCTCTCAAACCAATATAGATAGCGGAATTCAAGACATGCATATACATCATGAAGCTTTGTCATCCCCGCCTTTCGAATCCCTCCTCCTTGAGAATCTCGCTGACACAAGGCCCTTCCTAAAGACATCTTCTGTTGATATTGTCAACTTGAACAATCGTTTACAGCTAGTACTGACGGACTTGAGACTAACCCATATGAAAGTGTTAAAATTAGTCCAGTTACTCAGCTTGCATTCAGTTACAACCTCAATTCAACATCAATGATGTTCTCCCGAGACCAGTCGGGAGAACATTGACATGTATCAAGATGGATCCAGATCCTTGACAAAGATAATTGGTGCAACCTTGCGTTGTTCTCCCGAGGCTAGTCGGGAGAACATTGGCATGTATCAAGATGGATCCAGATCCTTGGCAAAGATAATTGGTGCAACCCTTGCGTTGTTCTCCCGAGGCCAGTCGGGAGAACATTGACATGCATCAAGATGGATCCAGATCCTTGACAAAGACAATTGGTGCAACCTTGCGTTACTCTCTGAGATGTCAAGCTGGTAATGCTTAGCATCTCCTTTGCTGTCAGATGGCATCTGATCCAGACGCCATTCGTCCTCGCCTTAGACAACGAAATCGCTGACATAATTGCTTGCCGGCCAGTCTGACCTCCTACATTTCCGTCTTTATTCATCCTCATCTTATTTCTATTACTCCTAGTTGATATAGTTGTAGAACATTTCATAACCCCAACTGTTGGGACCAGATTCAGCAATTCGCGGCTTAAAAATCGCAAGCCGGCGAGCTTTTCGCTGCTGTCTAAACCGGAATATTTTGTTTTGTTTTGATAGAAACAGTTCACCATGGGGAGTGGACTTTAGGCGGCGGTGATGGTTCATTCCTTCTTGCAGTAAACGTCCAAGAGATTGTGGATGGAGCCGCAGTAACTGGATTGTTCATCCATTGAAAGCTCCACAAAAGCCGGATGTCATATGCGCTTGACCATAACCACGTACAATAATGGCTTCCGCACTTGGTGAAACATCCCTCGGCTTCCAGTTTCATGGGAATGAAAGACCTTTCTATCCAAGAATTGCATCGGAGTACGCTGTTGTCTCATAATGCTGTCCACTAAGATTCGTGAAGAGACGTTTATTTTTAGGCCACAACATGCACGTATTGCCTGTACTACTCACAGATCGTGAGGGTATCCATTTATAGTATTGCACTGTCACACCTGATTCTTGCGGATGCGATCCTCGAAAATATTGGAGCATTGTACGTGGAGATTGCATCTAGAACTCATTATGGGTACCATCAAGATGACATCCCGAAGTAGACCTCCTACATATTCGGACTTGAGACGATGACAAAGATCAATAGTATACCTATTGACCCGATGGGTTCAAAGTCCGTATGGAACTGACAAATTCTCAGACTTTAGATCAGTAGTGAAGACCTCGGCCTTGACAGACGAGTGCTGCAGTCGATTGTGTACTATTTTTTGCGATTGTCAGTTATTTGGACTTCTACAAAGTTTGCGGGTTACTTGGGCTGATTGATCTCATCTATTCATTTCTGTTGTTAAAATTATAGATGGATAAAGCATCGATCATCGGAGACGCAATTAAGTACGTAATGGAGTTAGAGAGACAAGTGAAGGAGCTGGAGGGGGAGATGGAACTTGACGAGCAAAGGAAAAACAAGATAAACTCAAGCTCCGATACTCTGGGCTCCTTGGCCGCTACGGGTGTCCAGCATGGCGGAGATGCAGCAGCACAGAATGACAAAGATGTGGACTGGAATAAAAATTCGGGAGGAAATGTTTCCAAGTTAGACACGAAAGATCAGCCTAACGTTACGGTGAGTCTGGATGTAAGGATTCCAGCAAATCGTTGGGAATGAGCCCAATCAATCAAGAATGAAGAAATCCATTTGAAATATATTGAAATATGTACAGATCCGACTGCATAGGTACCTGGACCCCTTCACCCCAAAGAATCGCTAGCCCTTGAATTCACTGCGCGTATCAGAAATTCAAATCCAACTTCATGAAATCCATCTCACGAAAATTTCCTAACTGCGTTGGCGGTCATGTAAGTCGTAGATGATATTCGCCTAGAGGCAATTAATTCAACGTTAAAAGACTCTTCGAATTCTATGACCTCGTCTATCACAGGATGGCGAATTTCACTGTTCATCGTATTCCTTGTTCTTTGGCAGCTGGAGCTCTCCAAGATGAAGACCGGAATGTACAATTTGCGGATGTTCTATCAACAGCAGCCCGGCATTTTCATGCACATGACGCAAGCTATTGAGAGTTTGGATCTGAACATCCTTAACTCTCATGTATCGACCTGTGATGGCTATGTTGTGCACTCCATGATTGCCAAGGTATGTACAGGTGCTTAGCCTTATGAATGTTCCTAGTTTTCAACTTCTTCAGATACAAAAATCGAAATGGTTTAAGATGCACTGGCATCAGAAATTGGCACTTGTGTATGCTTCAAACGTCTAGAACGTCTTTCTCACCCACTCAATGGCGAAAATGTTGCCCTCGACAGCCAGATTTAGGGGTAGTAATTTGCGGCAGCCCCTACCTGTTAGCAATCTGATAATATTGTATCGACAGCAAATCAAAGAAATCCAGACTAGAATATGATATATTCTGCCAATTACGGATTTCGTGTGTTCTGGACCGGCTCTTGAATATATGTCGGACGCAGAACCTAGACCTTGGGTCATGTAGATTCCGAATCGAAGCTCGAAGTTTTCAATTTTTCTTTGTGTTGTGAGCCTCTACATTATTGTCATAAGGGCTGCGCCTCAATAATTATATCTTCCTATGCACAGCTCAATAGGGGACTCACAGATTAAATAATAATACCGTAGATCTGTATAATAGAGAAGTATGAGATTCTGTATCAACTTAAACATGGTTGGACCTAAAAATTTGCATCATTGACTGCTGCCATTAAAGTCAGCCATGTAGTCCTAAAGCAGCTTGAAACAAATTCTCTCTGATATATGAACCACTAATTATATAAACAATACTAATGTATAGCAGTACTATATTCTTGTTTGTTAGTCTAGCATGCACCTTAATGGGCACATGAACGCACGAATTCTTGAATGGTATGTCGGCTCTAGCAGTAAGTTGTATCTGACAATCTCTTTTACGCTTTTAAGTAGGTTTTCTGAATTTGAGTTCAACCTCGGTAGCGAGTTCACCCTGAAACCAAGTTCAAGATCACCTGTTGCCTTCTGGCTTGATTGCATGAGAAGTTTTACTTGGATACATCCAACATTCTGGGTCTTGGATCCTGGGAGTTCGTCCTGATATCGAAGGCAAATTCATGGTAGAGATAAACACATTTTCTTTTGTAAGGGAATGAATCCTATGTAATATTATTTCCTTGCCTAGAGCATGAATAGATTTTTCAGTTTGTCACTCTCATAATTCACTTCGATTTCAGGATGCACTCCAGGTTCCAGGACCAAGAACTTTAACACATCTAAAGCAGAGAAATATCAGGCAAACAAATGGTGAAAACTATTTCTAGCTGACGATACATGGCTAGGCTGGAACTCTGAAATAACGGAGATAAAAAAGTTCGTAGATCGAAAGTCAATACTTGTTTTGCAGAGAGCATCTTTACACCTTCAAGTACTTTTGTTCACTTTCCATCTACCATCAAAAGACAGCATCCTTTACCTCTTCTTGAAGTGTTCACAGTCTTGTCCAGAAATAAGCTTCAGCAAACTACTTGTGTATGGTAAAGAGAACTGCGGCCTAGTAGGAATATATTGTGTATTGTTGAGTGTCTAGCAATCAGCAATATGCTTTGAGTATATAAGATAGACCCTTGATCAGACTCCTTCCTCGAATTACTAATTATACAGACCATCCAAATCAATCAAGCGCACGCTCTTTGACGGATTATGCTTGTCAGTGAGTTGCAGCTTTGTCCAATATAGCTGGTTCCAAATTTAACGAGTAATTCTCAGGACGTCAGGTGCATGCTTTCATGTTTCTGCAATGAGAATCCTTGGATGTACGATTACGTGCATTCGATTTCGTCATGATTCCCCAAGTAATATTATGATAACAAGTGCATTATACTGAGAATCTAACCACGCGCCATATATACTTAGATCCTCCACTTCCTTCATGCTTCATTGGGTATGCTCGGTGTTGAAGGCTCCTGCGTGTTTCACACAGTAGGAGCCTTCTGTAACTTACTGGAATCAGTAAAGGGCTTGATCAATACGAAGGGCATGATACGTCTTCCGAAGGGCTCGAAAATTTAGAGCCTTTTTGTACACAGGAGTTTAAGTGCTTCGAGTACATGGGGTTTTCGTCTCCAAAATTCTAAGTAATGTTTGAACTTTAGCATATCGAAGTCTTTTTGGTAAGGTTTATGAGGATTTCAAACCTTCAAAGCCTTAACAATGCTTTATGGTTGTCTTAACTTCTTCGTTTCCTTCTTCGTTTCCTTCTTCGTGGTTTTAGTTCCAAGGCCTCTCTGGTGTCTGCGTTATAAACCTTCAAACCGGCTCCCCCCTGCAGCGCTTTTCAGTGTTAAAAACCCGACTTGCGTGAAGTTCTATTGTTTGCTGTTTGAGTAAATCCTTCCACCACCGTTACACGATAGAAGGATAAATTACAACTTATGCTTCCACGTTAAGCAGATTGTCCAGTCCTATAGATTAAAACAAGGATTCTTTCCATCACACTTGGGTCGAAACAATCCATGGTTGGGTTTGATGGTGACTCGATCTCTTGTCACCTTGCCACTATTCAAATGAAAACCTTCTGAAAAGGACGTAAAAGTCACTTTATGTGCAGAGATATGGCTCGTCTTTACGAAAGCCATAATTACAGCATGACCCCTGTTATTTCCTGTAATTTCGATTCTCTATGCCCCTTGAGCTTTCAAGAGCTTTTATCTTCTCGACGAGCAAAATCTTAGGTTCCTAGGATCTCAGGTTGCAACTGCAGCTTTACAAAACACATTCTCTCGATACGGTACTCAAGAACCTATAATGGAAAGACTCCTTGTTTTGGATGCTACTGAGTCGGCTAAGTATCACAATCAGCTAATATGCTGATTGTGATAAAGGTTTAGTACTGCATATAGAGAACAAGTTCAGAGTTTCAGTCCAAACTTGTTTATGTGAATACATGCTCAGAGTCATTATCTTGTTTTAGGCATGCATAAATCTGATCCTCCCAAAAAAGAGAGGCGTTACCTTCATCAAACGAAGTTTGCACTTCTCGACAAATATATCACATAATAAATACCTTTAGGTTTGATTTATATGGACATACAGATACGTAGATATTAGCCTTTCATGCTTCTTTCATTCTCAGTGCGTAAGCTTCTGTTATCGAGGTTCTCTCCAGTGTATACAGACCCAATGGTGCTCGAGCATAGTGCTCAGAGGCATCAGTTTACGGAGTTGCTTAAATACTTTGGGGAGTCTAAATTTAGTGACTTATTATCCCTTCTGAGCTTAACGTTTCCGGACAGTTGGCAGATTCGATATTGTACAGATATTAATTAAAGCCAAACACCCTTCGGAGTGCTTAGTCATAAGCGCTCAGCGTAGTTTGAGCATCCAGACCCCAGCATGATCAGGTGCCTACTTTCCGTGACTGGATTCTTCGTGCTTAAAACTTTCTCGGCACTCTCACAATCAGCATTTACGGCACAGCACAATCAGCACAAGATCGTGCTTTTCAAGCACGCTCTTTCATCGCTAAGATCTTAAATGTCCTGATTCTTGTGGTGGGCATACAGAGCTAGCAGATGCAGAAACATATATTCTTTAAGCATATTTGGGATTATTTGTTATTGAGCGCCTCAATAACATCATAACCAGATCTTGACATTCAGAGTTGCCAGCATTCTGGGTACCGGAGACTTGGTTGTTTTAGCAGCTTTCGTCAGCTTATATCTGGTTTTAGGCCCTCCGACGGACATTCTAAAATTTCAGCACCCTCGAGATTCTGTTTCTTTAACTCCTCGGATTCGAGTTTCACGTCCAACGAATTAGTTTAATAGCTGCTGTAAGTTCCAAGTGAGGTTGGGATGAATGGACAGAAACATGAGTTGATCTTTCAGGAACTAAGGCCACGAATAAACTCACGCAAGCCGTTCAAGACTTTCTGATGGATCTTAGGCAGAACTGAAGTGGACTGTGCAAAAAAACACCTCCGGAGAATAGACCCTGAGAATGTACATCTTTATAACATTATTATAAGCAACCGGATATAGCAATCGGATACACTCATGTGATCTTTATCAATATTACTTAACCACTGTAAGTTTTTAAGAAATTTCAGAAATCATATAGATATCTCTTTCTGATAAAGACAGGAATCGAGATTTTTCAACAATCTCAATCTGCTCGAAGAACTCTCAGATCATTTAGGCTTTTTAACAGCTGTTCAGTTCCTTCTTTCAAATCTTGAAGCAGTAAGAGTACTCGTTCGGGCCGTGAGGAGAAGTGACTTCAAATCTTGCTGGTCTTCAAAATTCTTGTGGCCAACACTAATAGATTCTAGCCAGTTTGATTTTACTTGAATAAACTTAACTTCAACCCTTGTAGTTCCTTTTATGTTTGAGAATCAATATTTTCACTATCATAGTCAGTTCACTGCTAACTTTCAAGCAATTTGTTTCTGGTCCTTATGGCATCCTGCCGAACATTTCACTGCTTCTACTCCATCAGTTCCCCCGACTTAAGGCAAAACAGATTGCTGATATGTGATGCTTTAATACTACTCATACTCAGTCTATTATTCCTCACTGCTTCTACCCACGTCGGCGTCACGTTCTTTTATCGTTTCGAGCAACTCGAATGCTATTGGAGCCCTCACTGCCCCGGTCTTCGAGCTCTTTAGAGTAGATATGAACGTTACCACACTACTCATCTCTCCAGCCACACACAGAAACGTCAAAAACCCAGGCATGGTTTAGAAAACACTCTCACCGGACACGATGGGCACCTTCGAGTTGGACCTTAGGTAATATTGTTATGCCTGTTATTGGCAGAATGTCATGTTTCTATTGGGGCCATATTGTTCTTGCTGTATTTTAAGCGTTTTGTCAAAACTGATGTTTACTTTTTTTCATTGGTGGATCGATGCTTTCATCGTTTCCTACCTTGATTTGATGTCTTTCATAGGTCATATTGCCCTTCGCCACATTTTAATCCTGACCTTGTATGGTGGAGCTCCTGAATAAGTATTGGCCTGGTGTTATTACTAGCACGGTTCCTGACAGGAGTTGTCTTGGTAGCTTGAGATTAAGTCTACATCGATCAACTGATGGTAGATCCTCTAGGCTAACGTCGTTCGATCCTCTTAAGCTTATACAAAGAATATCGTCTTTTTAATTGCAGAAGACAGTAGTGAGTGCTTTCATTCGGTCTGTATCTTCGATTATACTTATCCAGGCATGGCATGGGCATGGCATACCCTACATGAGTAGAAAGCAGTGTCCTAGGAGACTGAATTGCCCACAAACCTTAGCTTAGTGAGTTACCAATCGGTGTATGTCCTTTCTAAAGATACCCACACTTGGTCTTGACGAGCAGTCGTGATAATGTTGATATCAACTTCAGTTTAGCTATTTGAGCGGCTGAGCTACTCGAGTAATAAAACTAAATGTATTATTTCCCTCACACAGACATACTTTTTAGCTCCTTCAGAACTTTCAGTTACCTACCGAGATGCTTGAACTCTGTTCTATTCAATATTACTAACGGCGCCATATCGCAGTTCGTTTTCAACTGCTAATAACGATATCCTTTTCCGTCGAGGCTTTTAAACGTCTCAAAATATTGTCTTCTGTATCCTTAGCTTAAGTTCGTAGCGATTTGAGTGCTTTGATGTCGGTACTTGAAGTCCTCCAGGTGGCTAGCATGTAGGGACTAAGCCAGGTAATATAGTTCAGATGCATTCACTTCCAGCAAACCATGTGACAAGATTTCATATGACTGCATTTTCCACCATTTTTTGAGAGATCAGATTGCTATGTATGGGGACTCTAGCCCAAATACTTGGAGCACACGCCGGTGCTTGAATCCAAGATGTTCAACAAAGTCTACCTCTCCGAGAAACTGATCATGAGAAGACTTAGTTGAATCCCCTATATTGTCTTCAATTCACTCAGACAGTGGCCTCAGATAAACTGAGCAATGGAGGGTACAACACTAGAGTGATCTGCGAGGGCGAATGATCAGTCGATCAGAGCCCACTTAACGGCACCCCTCAGAAGCGCCATATATTTGAGGCATATATTAGCTCAGAGAAGAGCTAGATACTGTGGAGGGTATAGTTCCACCCTCAAATGCCAACATGGACATGATAAGAGTTTTATGGTGATTAGAAATAATACTTATTGACGATGGAAGTGTTCAAGCAAGAAGAATTGTCCGAATCCTTCTCCATTGCATGCCAAAGTTCGTAGCAGCTAACAAACCCACTTAGAGTATCCTCTGAAGTGGTCTGTAGACAAGCGATTCAAGTTTCAAGGCGTAGCAATTGTAGAGATGCTACGCCTATCGTGGCATCTGTAGAGAAGGAATCAAATGTGTATTTCGATGCCTTCATATATCCTAATTCGGGACCTTTTTTTTCCAACGCGAGCAATGTAGGGAATGGAATACCTGTAAGAGCTCTAGTGTCTCCAGGCTATACACACTCTAAACCGTAGAAAGATAAACATTCTAACCGCCGAAGCACAGATCACTGAAGTTCATGTTCTTTCTTTGAAAGCTGGTGGACTCAGCCTCTCCATTCTACTCACGGCAGTCGTATTACCTGTGCGAAAATACGATGGAGATGTTACGGTTATCTAGCGTGACCGATATTGTTAGCGATTTTGCTCTGTTCGGGTGTTTACTGACCTGACCAAATTCAATCATTACTGAATCGTTGAAAGTTGGAGGGTCCGGATGCATGATTGACCCATGTGCTTTACCTATGGGCTGTATACCTACCATATTTATATTTGAATCCAACCAGTTGTAGTTGGCTCAGATAGATTGCTGACTATAATGGTCGAGCTCAATGTGTCTTATCCACAGAATTGTGCCTCGTGACTAACAGGCACCCATAATTTGCCAGCAGAGAATGTCTTGAACCGATGAGGAACGAGGGTTAAATATCGTCTGATGATACTTAGCCGCCTTCCGAATGTTCCCCCACCTTTTAAGGAACAAGATAGTTCATGGTGGAACCGGTTCATGTGTTCGGTAATTTCTGCGGAAAGAGCAGCTTTTAAATATATATCTTTCTCTGAATATTATCGCTCTGATCAAACTCTAAAAACTACCCTTTGTTGATCTGAGGTTTTTTTTTGGTGGCAGAAGAGCAGAATAGCGTAAATTCGAAAACTGTAAATTCAAGGGGGCCCATTGTTATTTCGGGATCTTGAACAATTTTTGCTACTACTCATCGACTAGCTCACAAGTTTGATTAAGCGCCTGAATGAACATTGAAGTTCACTCTTTTCAACCATCCCAATTAGATCTCGGCGTGGACCAGCTGCAGCTCTCCTAGGTTGTGAGTAACCACAACGTTGTACTTCCCAAGATCGAAACTATCATCTGAAGTCAAGTTTTTTCCAATAGCTTGTACGTCGATAAGCGCGATCTCGTTAAGCTTATACTCTGGAAGTAGCCATCTATGATTTATCTATTTATTTTATTGAAAATGTATATATATATATATATATATATATGAGACAGAAGCGATAATAGCAGATATAATGATCGGTCTTCTTCCTACCGTCAAACTGAACTGAACGCTACGACAGCTGCGTCCAATTCTATACATTACACTTAAGAGGTCTTCTCGTCGTAGCTGATATTAGAGAGACTTGCAGTGTATGTATATATGGATGTTCTTCCTAATATGTTTCACAGTATTTTTCACCTGATTAGCTGCTACAACACCGTTATCTCCGCAGTCCGCAACGTAACTGATCATCTTGTTGTTCGCTGAGCAACCTGGACACACATGTACACGTTACAATAACCGTGATAATTTTTTTCAACCTGTGCCAGATGACGAGCTGGGACGACACCGTGGTAGGAGATGTGGAGAAACATATTTTGGGACTTGTTAGGCAGTATCAGTGACAGGCCTCTAGGCCAATCACTAAAGTAAGTGATTCGCCCCTGAAGCTTCAAGGGTGAGATTGACGGGATTGGCATGTAACGGGTCAATTGATCTGAAGAGTACGGTACTTGTTGGATTGATTCTAGTTTCCCACTTGTGTAACTCGATGGAGGATGTGCGATGCTTACATATAGTGACGTCCTATCACTAGTTGGTACTTACTTTGTTTGCGAAAATATGGGAACATGTATCCGTGTTATGTGCTGCAATATGAGTTAACGGCTGCAAGGTGATTGGTCTGCCATGGCACTACACGCTGATGCTTCTACTGATTTTATCGAGTAATGCACAGGGTTGAGCCTCCAATAACTTTTAGAAGAGAGTGAGTGCTACTATCGGCCTTTTTGTTCTGTGTTTGCAGAGTTTCGTGTATATACGCGTTTATCCAGATTTTCAACACTTTTGTCTCAGATTTTCCTGATGTGATAGCAGTGCTTGCAATCGAGTAGCAAGAGAAGTCTTTGTTACAAATATCTTCCTCAAGGCGGCAGTATATTCAGGTCCCTCAGAACTGAAATACTTCTTGACTTCTTTATACTGAGGCCTGAAGGTCGAACCCGAATGGATGACCACTCACACATCAAGCATGAAGGAAAGAAAATCAGGTTTCAATAAAATATATGTTCTCAAGCATTTGACTTTTTTGTAAGTAGAGATACGAATGGATGAGGTGGAGTTATAGTACAAAGGAGGGAACATAAATGGTGACCTGTTTCAAATTGGGAGTAAATGATTAATGTATCGAAAAGTATGAGAATCCCCGTCGAGCGAGCTAATTTCGTGCTAACGTACAATACCCTAACAATTAATAAAAAAAAATGCAAAATATTTAATACAAAAATTTCAGAACCAAAATTAAAAACCAATGTAAAAAACAAGTGAAGGAC

mRNA

>Mapoly0015s0003.2
CTGTTTTGGGAACCGATTCGGAAAGTAAGCATTGTCAACTAGCCGGCGCTCCGCGGGCAAAGCCGAGTGAAGGGCCGTAATGCGGTGGACACACGGCGTCGCGGACGGCAAAGATTGGAGAGGCGGTGAGGTGCGGTGAGGGGAGGTGAGGTGAAAGGAACGGTACGATCGATAGGCTGGAAGGCATGGCATGGCGCTCGAGCTCGAGCGCTCGCTGGCGCTGAGGCTGAGGCTGAGGCCGCGCGGGTCGGCCTCGCGCTCTTGGTCTAGTTCGCCGCGGACCGGTCGTCTCGTCGCCTACTTTCCCTTCGGTGGTGCACTGCTGCGGCGTTGTGTACTGTAGTGTTCTCCGCCTCGTTCTCGAGGGTGAGCACGCTGATCTTTGTCCTCATCGAGATCATCGGGGCGAGAGTCCACGCTCGTCCATATCTGGAATCCAGACCGAAAGTAAGCATTGAAATTGGTTTGTCGGTGGGTGCGTGCGTGCGAGGCAGCGAACGAATCAGATTTTCGCCAATTATTCACTACACCTCAAGACCTCCATTCTTGAGAATCACTGGTTCCGAGGCCGGACGAGATAACTCGAACAGGCAGCCGGCCAGCCGGCGTCTCTGGAGCAGAAATCAGGCCAAGGAATGCGAGAACTGCTGTCTTTCTTGTACTTACGACTGCTCCTCCGAGTCTACACGAGGGCCCAACATGTGAAGGTCCTATGAAGAGTCTTATTTGAAGCAGGCTCGTGACATGCATTCCATTGTGGGTCGAGGACGGAGGCCTGCGTTTCGGGAGGAGCAGGGATGGAAAGAACACAGTTCGCCCCACACACCTCTGTCACCTAATTTCCATGCCGATCCGTTGTTCGGCACACCTAGTGGGTCATTGCAGGATATTCTTCGCTCCGTCCACATGGTCGAAGGCTCCGCTTTTGTGAGTGTCCCGAAAAGTTCCGGGTCTCAAGCACCACCAGATATTATCGCCCCTCAGCAGCAGCAACAGGTCAGTTCAACCGCTCGGAACGTAAGCGTCGACGCTCCCGTGATAGATGATGGATTGGGCAAGCTGCAAAGGAAGCAACTGCAATGTCACACAAGCTCTTCGTGGGATCACAATATGAGGAATGAGCACGTCTTCGAAGGTTATCCGCATGTTGGACTTGCGGATATCTCCAACACTCAACTGCAGCTCGACAGCTTCAAGCCCGTTGGCACATGGACTGATACGCCAGGCGCTGATCACGAACAGCAATGGACCGATCTGCGCAGGAGCTCTAAGACGACCATGCTCTCACCTGGTCCCAATCTCGATAGTGGCACTTGTCAGCCGTCCGTATGGCGAGAACGCTGGTCCGATAGTTCCAGGGTGCACGCGTCTTCGCATCAGGAGAGACACAGAGCTGCAGCGCCAGCAGCGGGAGCAGCAGCAGCAGCAGCGCACCTGGAAGAATCCACAGATGGAGGTAGTGATCCCATGGACGAAAAAAATTCACGGCGCTTCTCCAACACCGCGGGTTATTGTTCCTCCCGAAATCTTTTCTCCGAACGCAAACGACGTAAGAAGATGAACGACGGCTTGTATTCCTTGCGCTCTATAGTTCCAAACATCAGCAAGATGGATAAAGCATCGATCATCGGAGACGCAATTAAGTACGTAATGGAGTTAGAGAGACAAGTGAAGGAGCTGGAGGGGGAGATGGAACTTGACGAGCAAAGGAAAAACAAGATAAACTCAAGCTCCGATACTCTGGGCTCCTTGGCCGCTACGGGTGTCCAGCATGGCGGAGATGCAGCAGCACAGAATGACAAAGATGTGGACTGGAATAAAAATTCGGGAGGAAATGTTTCCAAGTTAGACACGAAAGATCAGCCTAACGTTACGCTGGAGCTCTCCAAGATGAAGACCGGAATGTACAATTTGCGGATGTTCTATCAACAGCAGCCCGGCATTTTCATGCACATGACGCAAGCTATTGAGAGTTTGGATCTGAACATCCTTAACTCTCATGTATCGACCTGTGATGGCTATGTTGTGCACTCCATGATTGCCAAGATGACGAGCTGGGACGACACCGTGGTAGGAGATGTGGAGAAACATATTTTGGGACTTGTTAGGCAGTATCAGTGACAGGCCTCTAGGCCAATCACTAAAGTAAGTGATTCGCCCCTGAAGCTTCAAGGGTGAGATTGACGGGATTGGCATGTAACGGGTCAATTGATCTGAAGAGTACGGTACTTGTTGGATTGATTCTAGTTTCCCACTTGTGTAACTCGATGGAGGATGTGCGATGCTTACATATAGTGACGTCCTATCACTAGTTGGTACTTACTTTGTTTGCGAAAATATGGGAACATGTATCCGTGTTATGTGCTGCAATATGAGTTAACGGCTGCAAGGTGATTGGTCTGCCATGGCACTACACGCTGATGCTTCTACTGATTTTATCGAGTAATGCACAGGGTTGAGCCTCCAATAACTTTTAGAAGAGAGTGAGTGCTACTATCGGCCTTTTTGTTCTGTGTTTGCAGAGTTTCGTGTATATACGCGTTTATCCAGATTTTCAACACTTTTGTCTCAGATTTTCCTGATGTGATAGCAGTGCTTGCAATCGAGTAGCAAGAGAAGTCTTTGTTACAAATATCTTCCTCAAGGCGGCAGTATATTCAGGTCCCTCAGAACTGAAATACTTCTTGACTTCTTTATACTGAGGCCTGAAGGTCGAACCCGAATGGATGACCACTCACACATCAAGCATGAAGGAAAGAAAATCAGGTTTCAATAAAATATATGTTCTCAAGCATTTGACTTTTTTGTAAGTAGAGATACGAATGGATGAGGTGGAGTTATAGTACAAAGGAGGGAACATAAATGGTGACCTGTTTCAAATTGGGAGTAAATGATTAATGTATCGAAAAGTATGAGAATCCCCGTCGAGCGAGCTAATTTCGTGCTAACGTACAATACCCTAACAATTAATAAAAAAAAATGCAAAATATTTAATACAAAAATTTCAGAACCAAAATTAAAAACCAATGTAAAAAACAAGTGAAGGAC

CDS

>Mapoly0015s0003.2
ATGCATTCCATTGTGGGTCGAGGACGGAGGCCTGCGTTTCGGGAGGAGCAGGGATGGAAAGAACACAGTTCGCCCCACACACCTCTGTCACCTAATTTCCATGCCGATCCGTTGTTCGGCACACCTAGTGGGTCATTGCAGGATATTCTTCGCTCCGTCCACATGGTCGAAGGCTCCGCTTTTGTGAGTGTCCCGAAAAGTTCCGGGTCTCAAGCACCACCAGATATTATCGCCCCTCAGCAGCAGCAACAGGTCAGTTCAACCGCTCGGAACGTAAGCGTCGACGCTCCCGTGATAGATGATGGATTGGGCAAGCTGCAAAGGAAGCAACTGCAATGTCACACAAGCTCTTCGTGGGATCACAATATGAGGAATGAGCACGTCTTCGAAGGTTATCCGCATGTTGGACTTGCGGATATCTCCAACACTCAACTGCAGCTCGACAGCTTCAAGCCCGTTGGCACATGGACTGATACGCCAGGCGCTGATCACGAACAGCAATGGACCGATCTGCGCAGGAGCTCTAAGACGACCATGCTCTCACCTGGTCCCAATCTCGATAGTGGCACTTGTCAGCCGTCCGTATGGCGAGAACGCTGGTCCGATAGTTCCAGGGTGCACGCGTCTTCGCATCAGGAGAGACACAGAGCTGCAGCGCCAGCAGCGGGAGCAGCAGCAGCAGCAGCGCACCTGGAAGAATCCACAGATGGAGGTAGTGATCCCATGGACGAAAAAAATTCACGGCGCTTCTCCAACACCGCGGGTTATTGTTCCTCCCGAAATCTTTTCTCCGAACGCAAACGACGTAAGAAGATGAACGACGGCTTGTATTCCTTGCGCTCTATAGTTCCAAACATCAGCAAGATGGATAAAGCATCGATCATCGGAGACGCAATTAAGTACGTAATGGAGTTAGAGAGACAAGTGAAGGAGCTGGAGGGGGAGATGGAACTTGACGAGCAAAGGAAAAACAAGATAAACTCAAGCTCCGATACTCTGGGCTCCTTGGCCGCTACGGGTGTCCAGCATGGCGGAGATGCAGCAGCACAGAATGACAAAGATGTGGACTGGAATAAAAATTCGGGAGGAAATGTTTCCAAGTTAGACACGAAAGATCAGCCTAACGTTACGCTGGAGCTCTCCAAGATGAAGACCGGAATGTACAATTTGCGGATGTTCTATCAACAGCAGCCCGGCATTTTCATGCACATGACGCAAGCTATTGAGAGTTTGGATCTGAACATCCTTAACTCTCATGTATCGACCTGTGATGGCTATGTTGTGCACTCCATGATTGCCAAGATGACGAGCTGGGACGACACCGTGGTAGGAGATGTGGAGAAACATATTTTGGGACTTGTTAGGCAGTATCAGTGA

Protein

>Mapoly0015s0003.2
MHSIVGRGRRPAFREEQGWKEHSSPHTPLSPNFHADPLFGTPSGSLQDILRSVHMVEGSAFVSVPKSSGSQAPPDIIAPQQQQQVSSTARNVSVDAPVIDDGLGKLQRKQLQCHTSSSWDHNMRNEHVFEGYPHVGLADISNTQLQLDSFKPVGTWTDTPGADHEQQWTDLRRSSKTTMLSPGPNLDSGTCQPSVWRERWSDSSRVHASSHQERHRAAAPAAGAAAAAAHLEESTDGGSDPMDEKNSRRFSNTAGYCSSRNLFSERKRRKKMNDGLYSLRSIVPNISKMDKASIIGDAIKYVMELERQVKELEGEMELDEQRKNKINSSSDTLGSLAATGVQHGGDAAAQNDKDVDWNKNSGGNVSKLDTKDQPNVTLELSKMKTGMYNLRMFYQQQPGIFMHMTQAIESLDLNILNSHVSTCDGYVVHSMIAKMTSWDDTVVGDVEKHILGLVRQYQ

Mapoly0015s0003.3  

Gene structure:

mRNA scaffold_15:44061..57044  ( + strand )
five_prime_UTR scaffold_15:44061..44785  ( + strand )
CDS scaffold_15:44786..45649  ( + strand )
CDS scaffold_15:47559..47825  ( + strand )
CDS scaffold_15:48186..48356  ( + strand )
CDS scaffold_15:56043..56117  ( + strand )
three_prime_UTR scaffold_15:56118..56141  ( + strand )
three_prime_UTR scaffold_15:56519..57044  ( + strand )

Sequences:

Gene

>Mapoly0015s0003.3
GGAAAGTAAGCATTGTCAACTAGCCGGCGCTCCGCGGGCAAAGCCGAGTGAAGGGCCGTAATGCGGTGGACACACGGCGTCGCGGACGGCAAAGATTGGAGAGGCGGTGAGGTGCGGTGAGGGGAGGTGAGGTGAAAGGAACGGTACGATCGATAGGCTGGAAGGCATGGCATGGCGCTCGAGCTCGAGCGCTCGCTGGCGCTGAGGCTGAGGCTGAGGCCGCGCGGGTCGGCCTCGCGCTCTTGGTCTAGTTCGCCGCGGACCGGTCGTCTCGTCGCCTACTTTCCCTTCGGTGGTGCACTGCTGCGGCGTTGTGTACTGTAGTGTTCTCCGCCTCGTTCTCGAGGGTGAGCACGCTGATCTTTGTCCTCATCGAGATCATCGGGGCGAGAGTCCACGCTCGTCCATATCTGGAATCCAGACCGAAAGTAAGCATTGAAATTGGTTTGTCGGTGGGTGCGTGCGTGCGAGGCAGCGAACGAATCAGATTTTCGCCAATTATTCACTACACCTCAAGACCTCCATTCTTGAGAATCACTGGTTCCGAGGCCGGACGAGATAACTCGAACAGGCAGCCGGCCAGCCGGCGTCTCTGGAGCAGAAATCAGGCCAAGGAATGCGAGAACTGCTGTCTTTCTTGTACTTACGACTGCTCCTCCGAGTCTACACGAGGGCCCAACATGTGAAGGTCCTATGAAGAGTCTTATTTGAAGCAGGCTCGTGACATGCATTCCATTGTGGGTCGAGGACGGAGGCCTGCGTTTCGGGAGGAGCAGGGATGGAAAGAACACAGTTCGCCCCACACACCTCTGTCACCTAATTTCCATGCCGATCCGTTGTTCGGCACACCTAGTGGGTCATTGCAGGATATTCTTCGCTCCGTCCACATGGTCGAAGGCTCCGCTTTTGTGAGTGTCCCGAAAAGTTCCGGGTCTCAAGCACCACCAGATATTATCGCCCCTCAGCAGCAGCAACAGGTCAGTTCAACCGCTCGGAACGTAAGCGTCGACGCTCCCGTGATAGATGATGGATTGGGCAAGCTGCAAAGGAAGCAACTGCAATGTCACACAAGCTCTTCGTGGGATCACAATATGAGGAATGAGCACGTCTTCGAAGGTTATCCGCATGTTGGACTTGCGGATATCTCCAACACTCAACTGCAGCTCGACAGCTTCAAGCCCGTTGGCACATGGACTGATACGCCAGGCGCTGATCACGAACAGCAATGGACCGATCTGCGCAGGAGCTCTAAGACGACCATGCTCTCACCTGGTCCCAATCTCGATAGTGGCACTTGTCAGCCGTCCGTATGGCGAGAACGCTGGTCCGATAGTTCCAGGGTGCACGCGTCTTCGCATCAGGAGAGACACAGAGCTGCAGCGCCAGCAGCGGGAGCAGCAGCAGCAGCAGCGCACCTGGAAGAATCCACAGATGGAGGTAGTGATCCCATGGACGAAAAAAATTCACGGCGCTTCTCCAACACCGCGGGTTATTGTTCCTCCCGAAATCTTTTCTCCGAACGCAAACGACGTAAGAAGATGAACGACGGCTTGTATTCCTTGCGCTCTATAGTTCCAAACATCAGCAAGGTAAGACATCTTTTATCTTCCAGGAAGATGACCCCGCAAGCTTTCAGCTAGAGGTGACACGTTCGTTCGTTGACTATGAGCACTTGTACACTTATGGCTTACTTCGTCGTCGTTTCTATCGCATCGATGGAATTTACAGCAGGCTCGAACTTAGTGGCGAATTCATCACGAGAAGCCTTTGAAAGGATCCTGTCACTCATGTTCTCCAGCTCGCTACACATAGAAGAGGCTAGGTACCTATCCTCACCGGAATTAGCACAATCTTCTCTTCAAAATGCCCACAGCTTAGATTCATAACTCGCCAGTGCCAAAATCCTTCACCTAGAGCTCTCAAACCAATATAGATAGCGGAATTCAAGACATGCATATACATCATGAAGCTTTGTCATCCCCGCCTTTCGAATCCCTCCTCCTTGAGAATCTCGCTGACACAAGGCCCTTCCTAAAGACATCTTCTGTTGATATTGTCAACTTGAACAATCGTTTACAGCTAGTACTGACGGACTTGAGACTAACCCATATGAAAGTGTTAAAATTAGTCCAGTTACTCAGCTTGCATTCAGTTACAACCTCAATTCAACATCAATGATGTTCTCCCGAGACCAGTCGGGAGAACATTGACATGTATCAAGATGGATCCAGATCCTTGACAAAGATAATTGGTGCAACCTTGCGTTGTTCTCCCGAGGCTAGTCGGGAGAACATTGGCATGTATCAAGATGGATCCAGATCCTTGGCAAAGATAATTGGTGCAACCCTTGCGTTGTTCTCCCGAGGCCAGTCGGGAGAACATTGACATGCATCAAGATGGATCCAGATCCTTGACAAAGACAATTGGTGCAACCTTGCGTTACTCTCTGAGATGTCAAGCTGGTAATGCTTAGCATCTCCTTTGCTGTCAGATGGCATCTGATCCAGACGCCATTCGTCCTCGCCTTAGACAACGAAATCGCTGACATAATTGCTTGCCGGCCAGTCTGACCTCCTACATTTCCGTCTTTATTCATCCTCATCTTATTTCTATTACTCCTAGTTGATATAGTTGTAGAACATTTCATAACCCCAACTGTTGGGACCAGATTCAGCAATTCGCGGCTTAAAAATCGCAAGCCGGCGAGCTTTTCGCTGCTGTCTAAACCGGAATATTTTGTTTTGTTTTGATAGAAACAGTTCACCATGGGGAGTGGACTTTAGGCGGCGGTGATGGTTCATTCCTTCTTGCAGTAAACGTCCAAGAGATTGTGGATGGAGCCGCAGTAACTGGATTGTTCATCCATTGAAAGCTCCACAAAAGCCGGATGTCATATGCGCTTGACCATAACCACGTACAATAATGGCTTCCGCACTTGGTGAAACATCCCTCGGCTTCCAGTTTCATGGGAATGAAAGACCTTTCTATCCAAGAATTGCATCGGAGTACGCTGTTGTCTCATAATGCTGTCCACTAAGATTCGTGAAGAGACGTTTATTTTTAGGCCACAACATGCACGTATTGCCTGTACTACTCACAGATCGTGAGGGTATCCATTTATAGTATTGCACTGTCACACCTGATTCTTGCGGATGCGATCCTCGAAAATATTGGAGCATTGTACGTGGAGATTGCATCTAGAACTCATTATGGGTACCATCAAGATGACATCCCGAAGTAGACCTCCTACATATTCGGACTTGAGACGATGACAAAGATCAATAGTATACCTATTGACCCGATGGGTTCAAAGTCCGTATGGAACTGACAAATTCTCAGACTTTAGATCAGTAGTGAAGACCTCGGCCTTGACAGACGAGTGCTGCAGTCGATTGTGTACTATTTTTTGCGATTGTCAGTTATTTGGACTTCTACAAAGTTTGCGGGTTACTTGGGCTGATTGATCTCATCTATTCATTTCTGTTGTTAAAATTATAGATGGATAAAGCATCGATCATCGGAGACGCAATTAAGTACGTAATGGAGTTAGAGAGACAAGTGAAGGAGCTGGAGGGGGAGATGGAACTTGACGAGCAAAGGAAAAACAAGATAAACTCAAGCTCCGATACTCTGGGCTCCTTGGCCGCTACGGGTGTCCAGCATGGCGGAGATGCAGCAGCACAGAATGACAAAGATGTGGACTGGAATAAAAATTCGGGAGGAAATGTTTCCAAGTTAGACACGAAAGATCAGCCTAACGTTACGGTGAGTCTGGATGTAAGGATTCCAGCAAATCGTTGGGAATGAGCCCAATCAATCAAGAATGAAGAAATCCATTTGAAATATATTGAAATATGTACAGATCCGACTGCATAGGTACCTGGACCCCTTCACCCCAAAGAATCGCTAGCCCTTGAATTCACTGCGCGTATCAGAAATTCAAATCCAACTTCATGAAATCCATCTCACGAAAATTTCCTAACTGCGTTGGCGGTCATGTAAGTCGTAGATGATATTCGCCTAGAGGCAATTAATTCAACGTTAAAAGACTCTTCGAATTCTATGACCTCGTCTATCACAGGATGGCGAATTTCACTGTTCATCGTATTCCTTGTTCTTTGGCAGCTGGAGCTCTCCAAGATGAAGACCGGAATGTACAATTTGCGGATGTTCTATCAACAGCAGCCCGGCATTTTCATGCACATGACGCAAGCTATTGAGAGTTTGGATCTGAACATCCTTAACTCTCATGTATCGACCTGTGATGGCTATGTTGTGCACTCCATGATTGCCAAGGTATGTACAGGTGCTTAGCCTTATGAATGTTCCTAGTTTTCAACTTCTTCAGATACAAAAATCGAAATGGTTTAAGATGCACTGGCATCAGAAATTGGCACTTGTGTATGCTTCAAACGTCTAGAACGTCTTTCTCACCCACTCAATGGCGAAAATGTTGCCCTCGACAGCCAGATTTAGGGGTAGTAATTTGCGGCAGCCCCTACCTGTTAGCAATCTGATAATATTGTATCGACAGCAAATCAAAGAAATCCAGACTAGAATATGATATATTCTGCCAATTACGGATTTCGTGTGTTCTGGACCGGCTCTTGAATATATGTCGGACGCAGAACCTAGACCTTGGGTCATGTAGATTCCGAATCGAAGCTCGAAGTTTTCAATTTTTCTTTGTGTTGTGAGCCTCTACATTATTGTCATAAGGGCTGCGCCTCAATAATTATATCTTCCTATGCACAGCTCAATAGGGGACTCACAGATTAAATAATAATACCGTAGATCTGTATAATAGAGAAGTATGAGATTCTGTATCAACTTAAACATGGTTGGACCTAAAAATTTGCATCATTGACTGCTGCCATTAAAGTCAGCCATGTAGTCCTAAAGCAGCTTGAAACAAATTCTCTCTGATATATGAACCACTAATTATATAAACAATACTAATGTATAGCAGTACTATATTCTTGTTTGTTAGTCTAGCATGCACCTTAATGGGCACATGAACGCACGAATTCTTGAATGGTATGTCGGCTCTAGCAGTAAGTTGTATCTGACAATCTCTTTTACGCTTTTAAGTAGGTTTTCTGAATTTGAGTTCAACCTCGGTAGCGAGTTCACCCTGAAACCAAGTTCAAGATCACCTGTTGCCTTCTGGCTTGATTGCATGAGAAGTTTTACTTGGATACATCCAACATTCTGGGTCTTGGATCCTGGGAGTTCGTCCTGATATCGAAGGCAAATTCATGGTAGAGATAAACACATTTTCTTTTGTAAGGGAATGAATCCTATGTAATATTATTTCCTTGCCTAGAGCATGAATAGATTTTTCAGTTTGTCACTCTCATAATTCACTTCGATTTCAGGATGCACTCCAGGTTCCAGGACCAAGAACTTTAACACATCTAAAGCAGAGAAATATCAGGCAAACAAATGGTGAAAACTATTTCTAGCTGACGATACATGGCTAGGCTGGAACTCTGAAATAACGGAGATAAAAAAGTTCGTAGATCGAAAGTCAATACTTGTTTTGCAGAGAGCATCTTTACACCTTCAAGTACTTTTGTTCACTTTCCATCTACCATCAAAAGACAGCATCCTTTACCTCTTCTTGAAGTGTTCACAGTCTTGTCCAGAAATAAGCTTCAGCAAACTACTTGTGTATGGTAAAGAGAACTGCGGCCTAGTAGGAATATATTGTGTATTGTTGAGTGTCTAGCAATCAGCAATATGCTTTGAGTATATAAGATAGACCCTTGATCAGACTCCTTCCTCGAATTACTAATTATACAGACCATCCAAATCAATCAAGCGCACGCTCTTTGACGGATTATGCTTGTCAGTGAGTTGCAGCTTTGTCCAATATAGCTGGTTCCAAATTTAACGAGTAATTCTCAGGACGTCAGGTGCATGCTTTCATGTTTCTGCAATGAGAATCCTTGGATGTACGATTACGTGCATTCGATTTCGTCATGATTCCCCAAGTAATATTATGATAACAAGTGCATTATACTGAGAATCTAACCACGCGCCATATATACTTAGATCCTCCACTTCCTTCATGCTTCATTGGGTATGCTCGGTGTTGAAGGCTCCTGCGTGTTTCACACAGTAGGAGCCTTCTGTAACTTACTGGAATCAGTAAAGGGCTTGATCAATACGAAGGGCATGATACGTCTTCCGAAGGGCTCGAAAATTTAGAGCCTTTTTGTACACAGGAGTTTAAGTGCTTCGAGTACATGGGGTTTTCGTCTCCAAAATTCTAAGTAATGTTTGAACTTTAGCATATCGAAGTCTTTTTGGTAAGGTTTATGAGGATTTCAAACCTTCAAAGCCTTAACAATGCTTTATGGTTGTCTTAACTTCTTCGTTTCCTTCTTCGTTTCCTTCTTCGTGGTTTTAGTTCCAAGGCCTCTCTGGTGTCTGCGTTATAAACCTTCAAACCGGCTCCCCCCTGCAGCGCTTTTCAGTGTTAAAAACCCGACTTGCGTGAAGTTCTATTGTTTGCTGTTTGAGTAAATCCTTCCACCACCGTTACACGATAGAAGGATAAATTACAACTTATGCTTCCACGTTAAGCAGATTGTCCAGTCCTATAGATTAAAACAAGGATTCTTTCCATCACACTTGGGTCGAAACAATCCATGGTTGGGTTTGATGGTGACTCGATCTCTTGTCACCTTGCCACTATTCAAATGAAAACCTTCTGAAAAGGACGTAAAAGTCACTTTATGTGCAGAGATATGGCTCGTCTTTACGAAAGCCATAATTACAGCATGACCCCTGTTATTTCCTGTAATTTCGATTCTCTATGCCCCTTGAGCTTTCAAGAGCTTTTATCTTCTCGACGAGCAAAATCTTAGGTTCCTAGGATCTCAGGTTGCAACTGCAGCTTTACAAAACACATTCTCTCGATACGGTACTCAAGAACCTATAATGGAAAGACTCCTTGTTTTGGATGCTACTGAGTCGGCTAAGTATCACAATCAGCTAATATGCTGATTGTGATAAAGGTTTAGTACTGCATATAGAGAACAAGTTCAGAGTTTCAGTCCAAACTTGTTTATGTGAATACATGCTCAGAGTCATTATCTTGTTTTAGGCATGCATAAATCTGATCCTCCCAAAAAAGAGAGGCGTTACCTTCATCAAACGAAGTTTGCACTTCTCGACAAATATATCACATAATAAATACCTTTAGGTTTGATTTATATGGACATACAGATACGTAGATATTAGCCTTTCATGCTTCTTTCATTCTCAGTGCGTAAGCTTCTGTTATCGAGGTTCTCTCCAGTGTATACAGACCCAATGGTGCTCGAGCATAGTGCTCAGAGGCATCAGTTTACGGAGTTGCTTAAATACTTTGGGGAGTCTAAATTTAGTGACTTATTATCCCTTCTGAGCTTAACGTTTCCGGACAGTTGGCAGATTCGATATTGTACAGATATTAATTAAAGCCAAACACCCTTCGGAGTGCTTAGTCATAAGCGCTCAGCGTAGTTTGAGCATCCAGACCCCAGCATGATCAGGTGCCTACTTTCCGTGACTGGATTCTTCGTGCTTAAAACTTTCTCGGCACTCTCACAATCAGCATTTACGGCACAGCACAATCAGCACAAGATCGTGCTTTTCAAGCACGCTCTTTCATCGCTAAGATCTTAAATGTCCTGATTCTTGTGGTGGGCATACAGAGCTAGCAGATGCAGAAACATATATTCTTTAAGCATATTTGGGATTATTTGTTATTGAGCGCCTCAATAACATCATAACCAGATCTTGACATTCAGAGTTGCCAGCATTCTGGGTACCGGAGACTTGGTTGTTTTAGCAGCTTTCGTCAGCTTATATCTGGTTTTAGGCCCTCCGACGGACATTCTAAAATTTCAGCACCCTCGAGATTCTGTTTCTTTAACTCCTCGGATTCGAGTTTCACGTCCAACGAATTAGTTTAATAGCTGCTGTAAGTTCCAAGTGAGGTTGGGATGAATGGACAGAAACATGAGTTGATCTTTCAGGAACTAAGGCCACGAATAAACTCACGCAAGCCGTTCAAGACTTTCTGATGGATCTTAGGCAGAACTGAAGTGGACTGTGCAAAAAAACACCTCCGGAGAATAGACCCTGAGAATGTACATCTTTATAACATTATTATAAGCAACCGGATATAGCAATCGGATACACTCATGTGATCTTTATCAATATTACTTAACCACTGTAAGTTTTTAAGAAATTTCAGAAATCATATAGATATCTCTTTCTGATAAAGACAGGAATCGAGATTTTTCAACAATCTCAATCTGCTCGAAGAACTCTCAGATCATTTAGGCTTTTTAACAGCTGTTCAGTTCCTTCTTTCAAATCTTGAAGCAGTAAGAGTACTCGTTCGGGCCGTGAGGAGAAGTGACTTCAAATCTTGCTGGTCTTCAAAATTCTTGTGGCCAACACTAATAGATTCTAGCCAGTTTGATTTTACTTGAATAAACTTAACTTCAACCCTTGTAGTTCCTTTTATGTTTGAGAATCAATATTTTCACTATCATAGTCAGTTCACTGCTAACTTTCAAGCAATTTGTTTCTGGTCCTTATGGCATCCTGCCGAACATTTCACTGCTTCTACTCCATCAGTTCCCCCGACTTAAGGCAAAACAGATTGCTGATATGTGATGCTTTAATACTACTCATACTCAGTCTATTATTCCTCACTGCTTCTACCCACGTCGGCGTCACGTTCTTTTATCGTTTCGAGCAACTCGAATGCTATTGGAGCCCTCACTGCCCCGGTCTTCGAGCTCTTTAGAGTAGATATGAACGTTACCACACTACTCATCTCTCCAGCCACACACAGAAACGTCAAAAACCCAGGCATGGTTTAGAAAACACTCTCACCGGACACGATGGGCACCTTCGAGTTGGACCTTAGGTAATATTGTTATGCCTGTTATTGGCAGAATGTCATGTTTCTATTGGGGCCATATTGTTCTTGCTGTATTTTAAGCGTTTTGTCAAAACTGATGTTTACTTTTTTTCATTGGTGGATCGATGCTTTCATCGTTTCCTACCTTGATTTGATGTCTTTCATAGGTCATATTGCCCTTCGCCACATTTTAATCCTGACCTTGTATGGTGGAGCTCCTGAATAAGTATTGGCCTGGTGTTATTACTAGCACGGTTCCTGACAGGAGTTGTCTTGGTAGCTTGAGATTAAGTCTACATCGATCAACTGATGGTAGATCCTCTAGGCTAACGTCGTTCGATCCTCTTAAGCTTATACAAAGAATATCGTCTTTTTAATTGCAGAAGACAGTAGTGAGTGCTTTCATTCGGTCTGTATCTTCGATTATACTTATCCAGGCATGGCATGGGCATGGCATACCCTACATGAGTAGAAAGCAGTGTCCTAGGAGACTGAATTGCCCACAAACCTTAGCTTAGTGAGTTACCAATCGGTGTATGTCCTTTCTAAAGATACCCACACTTGGTCTTGACGAGCAGTCGTGATAATGTTGATATCAACTTCAGTTTAGCTATTTGAGCGGCTGAGCTACTCGAGTAATAAAACTAAATGTATTATTTCCCTCACACAGACATACTTTTTAGCTCCTTCAGAACTTTCAGTTACCTACCGAGATGCTTGAACTCTGTTCTATTCAATATTACTAACGGCGCCATATCGCAGTTCGTTTTCAACTGCTAATAACGATATCCTTTTCCGTCGAGGCTTTTAAACGTCTCAAAATATTGTCTTCTGTATCCTTAGCTTAAGTTCGTAGCGATTTGAGTGCTTTGATGTCGGTACTTGAAGTCCTCCAGGTGGCTAGCATGTAGGGACTAAGCCAGGTAATATAGTTCAGATGCATTCACTTCCAGCAAACCATGTGACAAGATTTCATATGACTGCATTTTCCACCATTTTTTGAGAGATCAGATTGCTATGTATGGGGACTCTAGCCCAAATACTTGGAGCACACGCCGGTGCTTGAATCCAAGATGTTCAACAAAGTCTACCTCTCCGAGAAACTGATCATGAGAAGACTTAGTTGAATCCCCTATATTGTCTTCAATTCACTCAGACAGTGGCCTCAGATAAACTGAGCAATGGAGGGTACAACACTAGAGTGATCTGCGAGGGCGAATGATCAGTCGATCAGAGCCCACTTAACGGCACCCCTCAGAAGCGCCATATATTTGAGGCATATATTAGCTCAGAGAAGAGCTAGATACTGTGGAGGGTATAGTTCCACCCTCAAATGCCAACATGGACATGATAAGAGTTTTATGGTGATTAGAAATAATACTTATTGACGATGGAAGTGTTCAAGCAAGAAGAATTGTCCGAATCCTTCTCCATTGCATGCCAAAGTTCGTAGCAGCTAACAAACCCACTTAGAGTATCCTCTGAAGTGGTCTGTAGACAAGCGATTCAAGTTTCAAGGCGTAGCAATTGTAGAGATGCTACGCCTATCGTGGCATCTGTAGAGAAGGAATCAAATGTGTATTTCGATGCCTTCATATATCCTAATTCGGGACCTTTTTTTTCCAACGCGAGCAATGTAGGGAATGGAATACCTGTAAGAGCTCTAGTGTCTCCAGGCTATACACACTCTAAACCGTAGAAAGATAAACATTCTAACCGCCGAAGCACAGATCACTGAAGTTCATGTTCTTTCTTTGAAAGCTGGTGGACTCAGCCTCTCCATTCTACTCACGGCAGTCGTATTACCTGTGCGAAAATACGATGGAGATGTTACGGTTATCTAGCGTGACCGATATTGTTAGCGATTTTGCTCTGTTCGGGTGTTTACTGACCTGACCAAATTCAATCATTACTGAATCGTTGAAAGTTGGAGGGTCCGGATGCATGATTGACCCATGTGCTTTACCTATGGGCTGTATACCTACCATATTTATATTTGAATCCAACCAGTTGTAGTTGGCTCAGATAGATTGCTGACTATAATGGTCGAGCTCAATGTGTCTTATCCACAGAATTGTGCCTCGTGACTAACAGGCACCCATAATTTGCCAGCAGAGAATGTCTTGAACCGATGAGGAACGAGGGTTAAATATCGTCTGATGATACTTAGCCGCCTTCCGAATGTTCCCCCACCTTTTAAGGAACAAGATAGTTCATGGTGGAACCGGTTCATGTGTTCGGTAATTTCTGCGGAAAGAGCAGCTTTTAAATATATATCTTTCTCTGAATATTATCGCTCTGATCAAACTCTAAAAACTACCCTTTGTTGATCTGAGGTTTTTTTTTGGTGGCAGAAGAGCAGAATAGCGTAAATTCGAAAACTGTAAATTCAAGGGGGCCCATTGTTATTTCGGGATCTTGAACAATTTTTGCTACTACTCATCGACTAGCTCACAAGTTTGATTAAGCGCCTGAATGAACATTGAAGTTCACTCTTTTCAACCATCCCAATTAGATCTCGGCGTGGACCAGCTGCAGCTCTCCTAGGTTGTGAGTAACCACAACGTTGTACTTCCCAAGATCGAAACTATCATCTGAAGTCAAGTTTTTTCCAATAGCTTGTACGTCGATAAGCGCGATCTCGTTAAGCTTATACTCTGGAAGTAGCCATCTATGATTTATCTATTTATTTTATTGAAAATGTATATATATATATATATATATATATGAGACAGAAGCGATAATAGCAGATATAATGATCGGTCTTCTTCCTACCGTCAAACTGAACTGAACGCTACGACAGCTGCGTCCAATTCTATACATTACACTTAAGAGGTCTTCTCGTCGTAGCTGATATTAGAGAGACTTGCAGTGTATGTATATATGGATGTTCTTCCTAATATGTTTCACAGTATTTTTCACCTGATTAGCTGCTACAACACCGTTATCTCCGCAGTCCGCAACGTAACTGATCATCTTGTTGTTCGCTGAGCAACCTGGACACACATGTACACGTTACAATAACCGTGATAATTTTTTTCAACCTGTGCCAGATGACGAGCTGGGACGACACCGTGGTAGGAGATGTGGAGAAACATATTTTGGGACTTGTTAGGCAGTATCAGTGACAGGCCTCTAGGCCAATCACTAAAGTAAGTGATTCGCCCCTGAAGCTTCAAGGGTGAGATTGACGGGATTGGCATGTAACGGGTCAATTGATCTGAAGAGTACGGTACTTGTTGGATTGATTCTAGTTTCCCACTTGTGTAACTCGATGGAGGATGTGCGATGCTTACATATAGTGACGTCCTATCACTAGTTGGTACTTACTTTGTTTGCGAAAATATGGGAACATGTATCCGTGTTATGTGCTGCAATATGAGTTAACGGCTGCAAGGTGATTGGTCTGCCATGGCACTACACGCTGATGCTTCTACTGATTTTATCGAGTAATGCACAGGGTTGAGCCTCCAATAACTTTTAGAAGAGAGTGAGTGCTACTATCGGCCTTTTTGTTCTGTGTTTGCAGAGTTTCGTGTATATACGCGTTTATCCAGATTTTCAACACTTTTGTCTCAGATTTTCCTGATGTGATAGCAGTGCTTGCAATCGAGTAGCAAGAGAAGTCTTTGTTACAAATATCTTCCTCAAGGCGGCAGTATATTCAGGTCCCTCAGAACTGAAATACTTCTTGACTTCTTTATACTGAGGCCTGAAGGTCGAACCCGAATGGATGACCACTCACACATCAAGCATGAAGGAAAGAAAATCAGGTTTCAATAAAATATATGTTCTCAAGCATTTGACTTTTTTGTAAGTAGAGATACGAATGGATGAGGTGGAGTTATAGTACAAAGGAGGGAACATAAATGGTGACCTGTTTCAAATTGGGAGTAAATGATTAATGTATCGAAAAGTATGAGAATCCCCGTCGAGCGAGCTAATTTCGTGCTAACGTACAATACCCTAACAATTAATAAAAAAAAATGCAAAATATTTAATACAAAAATTTCAGAACCAAAATTAAAAACCAATGTAAAAAACAAGTGAAGGAC

mRNA

>Mapoly0015s0003.3
GGAAAGTAAGCATTGTCAACTAGCCGGCGCTCCGCGGGCAAAGCCGAGTGAAGGGCCGTAATGCGGTGGACACACGGCGTCGCGGACGGCAAAGATTGGAGAGGCGGTGAGGTGCGGTGAGGGGAGGTGAGGTGAAAGGAACGGTACGATCGATAGGCTGGAAGGCATGGCATGGCGCTCGAGCTCGAGCGCTCGCTGGCGCTGAGGCTGAGGCTGAGGCCGCGCGGGTCGGCCTCGCGCTCTTGGTCTAGTTCGCCGCGGACCGGTCGTCTCGTCGCCTACTTTCCCTTCGGTGGTGCACTGCTGCGGCGTTGTGTACTGTAGTGTTCTCCGCCTCGTTCTCGAGGGTGAGCACGCTGATCTTTGTCCTCATCGAGATCATCGGGGCGAGAGTCCACGCTCGTCCATATCTGGAATCCAGACCGAAAGTAAGCATTGAAATTGGTTTGTCGGTGGGTGCGTGCGTGCGAGGCAGCGAACGAATCAGATTTTCGCCAATTATTCACTACACCTCAAGACCTCCATTCTTGAGAATCACTGGTTCCGAGGCCGGACGAGATAACTCGAACAGGCAGCCGGCCAGCCGGCGTCTCTGGAGCAGAAATCAGGCCAAGGAATGCGAGAACTGCTGTCTTTCTTGTACTTACGACTGCTCCTCCGAGTCTACACGAGGGCCCAACATGTGAAGGTCCTATGAAGAGTCTTATTTGAAGCAGGCTCGTGACATGCATTCCATTGTGGGTCGAGGACGGAGGCCTGCGTTTCGGGAGGAGCAGGGATGGAAAGAACACAGTTCGCCCCACACACCTCTGTCACCTAATTTCCATGCCGATCCGTTGTTCGGCACACCTAGTGGGTCATTGCAGGATATTCTTCGCTCCGTCCACATGGTCGAAGGCTCCGCTTTTGTGAGTGTCCCGAAAAGTTCCGGGTCTCAAGCACCACCAGATATTATCGCCCCTCAGCAGCAGCAACAGGTCAGTTCAACCGCTCGGAACGTAAGCGTCGACGCTCCCGTGATAGATGATGGATTGGGCAAGCTGCAAAGGAAGCAACTGCAATGTCACACAAGCTCTTCGTGGGATCACAATATGAGGAATGAGCACGTCTTCGAAGGTTATCCGCATGTTGGACTTGCGGATATCTCCAACACTCAACTGCAGCTCGACAGCTTCAAGCCCGTTGGCACATGGACTGATACGCCAGGCGCTGATCACGAACAGCAATGGACCGATCTGCGCAGGAGCTCTAAGACGACCATGCTCTCACCTGGTCCCAATCTCGATAGTGGCACTTGTCAGCCGTCCGTATGGCGAGAACGCTGGTCCGATAGTTCCAGGGTGCACGCGTCTTCGCATCAGGAGAGACACAGAGCTGCAGCGCCAGCAGCGGGAGCAGCAGCAGCAGCAGCGCACCTGGAAGAATCCACAGATGGAGGTAGTGATCCCATGGACGAAAAAAATTCACGGCGCTTCTCCAACACCGCGGGTTATTGTTCCTCCCGAAATCTTTTCTCCGAACGCAAACGACGTAAGAAGATGAACGACGGCTTGTATTCCTTGCGCTCTATAGTTCCAAACATCAGCAAGATGGATAAAGCATCGATCATCGGAGACGCAATTAAGTACGTAATGGAGTTAGAGAGACAAGTGAAGGAGCTGGAGGGGGAGATGGAACTTGACGAGCAAAGGAAAAACAAGATAAACTCAAGCTCCGATACTCTGGGCTCCTTGGCCGCTACGGGTGTCCAGCATGGCGGAGATGCAGCAGCACAGAATGACAAAGATGTGGACTGGAATAAAAATTCGGGAGGAAATGTTTCCAAGTTAGACACGAAAGATCAGCCTAACGTTACGCTGGAGCTCTCCAAGATGAAGACCGGAATGTACAATTTGCGGATGTTCTATCAACAGCAGCCCGGCATTTTCATGCACATGACGCAAGCTATTGAGAGTTTGGATCTGAACATCCTTAACTCTCATGTATCGACCTGTGATGGCTATGTTGTGCACTCCATGATTGCCAAGATGACGAGCTGGGACGACACCGTGGTAGGAGATGTGGAGAAACATATTTTGGGACTTGTTAGGCAGTATCAGTGACAGGCCTCTAGGCCAATCACTAAAAGTTTCGTGTATATACGCGTTTATCCAGATTTTCAACACTTTTGTCTCAGATTTTCCTGATGTGATAGCAGTGCTTGCAATCGAGTAGCAAGAGAAGTCTTTGTTACAAATATCTTCCTCAAGGCGGCAGTATATTCAGGTCCCTCAGAACTGAAATACTTCTTGACTTCTTTATACTGAGGCCTGAAGGTCGAACCCGAATGGATGACCACTCACACATCAAGCATGAAGGAAAGAAAATCAGGTTTCAATAAAATATATGTTCTCAAGCATTTGACTTTTTTGTAAGTAGAGATACGAATGGATGAGGTGGAGTTATAGTACAAAGGAGGGAACATAAATGGTGACCTGTTTCAAATTGGGAGTAAATGATTAATGTATCGAAAAGTATGAGAATCCCCGTCGAGCGAGCTAATTTCGTGCTAACGTACAATACCCTAACAATTAATAAAAAAAAATGCAAAATATTTAATACAAAAATTTCAGAACCAAAATTAAAAACCAATGTAAAAAACAAGTGAAGGAC

CDS

>Mapoly0015s0003.3
ATGCATTCCATTGTGGGTCGAGGACGGAGGCCTGCGTTTCGGGAGGAGCAGGGATGGAAAGAACACAGTTCGCCCCACACACCTCTGTCACCTAATTTCCATGCCGATCCGTTGTTCGGCACACCTAGTGGGTCATTGCAGGATATTCTTCGCTCCGTCCACATGGTCGAAGGCTCCGCTTTTGTGAGTGTCCCGAAAAGTTCCGGGTCTCAAGCACCACCAGATATTATCGCCCCTCAGCAGCAGCAACAGGTCAGTTCAACCGCTCGGAACGTAAGCGTCGACGCTCCCGTGATAGATGATGGATTGGGCAAGCTGCAAAGGAAGCAACTGCAATGTCACACAAGCTCTTCGTGGGATCACAATATGAGGAATGAGCACGTCTTCGAAGGTTATCCGCATGTTGGACTTGCGGATATCTCCAACACTCAACTGCAGCTCGACAGCTTCAAGCCCGTTGGCACATGGACTGATACGCCAGGCGCTGATCACGAACAGCAATGGACCGATCTGCGCAGGAGCTCTAAGACGACCATGCTCTCACCTGGTCCCAATCTCGATAGTGGCACTTGTCAGCCGTCCGTATGGCGAGAACGCTGGTCCGATAGTTCCAGGGTGCACGCGTCTTCGCATCAGGAGAGACACAGAGCTGCAGCGCCAGCAGCGGGAGCAGCAGCAGCAGCAGCGCACCTGGAAGAATCCACAGATGGAGGTAGTGATCCCATGGACGAAAAAAATTCACGGCGCTTCTCCAACACCGCGGGTTATTGTTCCTCCCGAAATCTTTTCTCCGAACGCAAACGACGTAAGAAGATGAACGACGGCTTGTATTCCTTGCGCTCTATAGTTCCAAACATCAGCAAGATGGATAAAGCATCGATCATCGGAGACGCAATTAAGTACGTAATGGAGTTAGAGAGACAAGTGAAGGAGCTGGAGGGGGAGATGGAACTTGACGAGCAAAGGAAAAACAAGATAAACTCAAGCTCCGATACTCTGGGCTCCTTGGCCGCTACGGGTGTCCAGCATGGCGGAGATGCAGCAGCACAGAATGACAAAGATGTGGACTGGAATAAAAATTCGGGAGGAAATGTTTCCAAGTTAGACACGAAAGATCAGCCTAACGTTACGCTGGAGCTCTCCAAGATGAAGACCGGAATGTACAATTTGCGGATGTTCTATCAACAGCAGCCCGGCATTTTCATGCACATGACGCAAGCTATTGAGAGTTTGGATCTGAACATCCTTAACTCTCATGTATCGACCTGTGATGGCTATGTTGTGCACTCCATGATTGCCAAGATGACGAGCTGGGACGACACCGTGGTAGGAGATGTGGAGAAACATATTTTGGGACTTGTTAGGCAGTATCAGTGA

Protein

>Mapoly0015s0003.3
MHSIVGRGRRPAFREEQGWKEHSSPHTPLSPNFHADPLFGTPSGSLQDILRSVHMVEGSAFVSVPKSSGSQAPPDIIAPQQQQQVSSTARNVSVDAPVIDDGLGKLQRKQLQCHTSSSWDHNMRNEHVFEGYPHVGLADISNTQLQLDSFKPVGTWTDTPGADHEQQWTDLRRSSKTTMLSPGPNLDSGTCQPSVWRERWSDSSRVHASSHQERHRAAAPAAGAAAAAAHLEESTDGGSDPMDEKNSRRFSNTAGYCSSRNLFSERKRRKKMNDGLYSLRSIVPNISKMDKASIIGDAIKYVMELERQVKELEGEMELDEQRKNKINSSSDTLGSLAATGVQHGGDAAAQNDKDVDWNKNSGGNVSKLDTKDQPNVTLELSKMKTGMYNLRMFYQQQPGIFMHMTQAIESLDLNILNSHVSTCDGYVVHSMIAKMTSWDDTVVGDVEKHILGLVRQYQ

Mapoly0015s0003.4  

Gene structure:

mRNA scaffold_15:44061..55672  ( + strand )
five_prime_UTR scaffold_15:44061..44785  ( + strand )
CDS scaffold_15:44786..45649  ( + strand )
CDS scaffold_15:47559..47867  ( + strand )
three_prime_UTR scaffold_15:47868..47936  ( + strand )
three_prime_UTR scaffold_15:48186..48356  ( + strand )
three_prime_UTR scaffold_15:55344..55672  ( + strand )

Sequences:

Gene

>Mapoly0015s0003.4
GGAAAGTAAGCATTGTCAACTAGCCGGCGCTCCGCGGGCAAAGCCGAGTGAAGGGCCGTAATGCGGTGGACACACGGCGTCGCGGACGGCAAAGATTGGAGAGGCGGTGAGGTGCGGTGAGGGGAGGTGAGGTGAAAGGAACGGTACGATCGATAGGCTGGAAGGCATGGCATGGCGCTCGAGCTCGAGCGCTCGCTGGCGCTGAGGCTGAGGCTGAGGCCGCGCGGGTCGGCCTCGCGCTCTTGGTCTAGTTCGCCGCGGACCGGTCGTCTCGTCGCCTACTTTCCCTTCGGTGGTGCACTGCTGCGGCGTTGTGTACTGTAGTGTTCTCCGCCTCGTTCTCGAGGGTGAGCACGCTGATCTTTGTCCTCATCGAGATCATCGGGGCGAGAGTCCACGCTCGTCCATATCTGGAATCCAGACCGAAAGTAAGCATTGAAATTGGTTTGTCGGTGGGTGCGTGCGTGCGAGGCAGCGAACGAATCAGATTTTCGCCAATTATTCACTACACCTCAAGACCTCCATTCTTGAGAATCACTGGTTCCGAGGCCGGACGAGATAACTCGAACAGGCAGCCGGCCAGCCGGCGTCTCTGGAGCAGAAATCAGGCCAAGGAATGCGAGAACTGCTGTCTTTCTTGTACTTACGACTGCTCCTCCGAGTCTACACGAGGGCCCAACATGTGAAGGTCCTATGAAGAGTCTTATTTGAAGCAGGCTCGTGACATGCATTCCATTGTGGGTCGAGGACGGAGGCCTGCGTTTCGGGAGGAGCAGGGATGGAAAGAACACAGTTCGCCCCACACACCTCTGTCACCTAATTTCCATGCCGATCCGTTGTTCGGCACACCTAGTGGGTCATTGCAGGATATTCTTCGCTCCGTCCACATGGTCGAAGGCTCCGCTTTTGTGAGTGTCCCGAAAAGTTCCGGGTCTCAAGCACCACCAGATATTATCGCCCCTCAGCAGCAGCAACAGGTCAGTTCAACCGCTCGGAACGTAAGCGTCGACGCTCCCGTGATAGATGATGGATTGGGCAAGCTGCAAAGGAAGCAACTGCAATGTCACACAAGCTCTTCGTGGGATCACAATATGAGGAATGAGCACGTCTTCGAAGGTTATCCGCATGTTGGACTTGCGGATATCTCCAACACTCAACTGCAGCTCGACAGCTTCAAGCCCGTTGGCACATGGACTGATACGCCAGGCGCTGATCACGAACAGCAATGGACCGATCTGCGCAGGAGCTCTAAGACGACCATGCTCTCACCTGGTCCCAATCTCGATAGTGGCACTTGTCAGCCGTCCGTATGGCGAGAACGCTGGTCCGATAGTTCCAGGGTGCACGCGTCTTCGCATCAGGAGAGACACAGAGCTGCAGCGCCAGCAGCGGGAGCAGCAGCAGCAGCAGCGCACCTGGAAGAATCCACAGATGGAGGTAGTGATCCCATGGACGAAAAAAATTCACGGCGCTTCTCCAACACCGCGGGTTATTGTTCCTCCCGAAATCTTTTCTCCGAACGCAAACGACGTAAGAAGATGAACGACGGCTTGTATTCCTTGCGCTCTATAGTTCCAAACATCAGCAAGGTAAGACATCTTTTATCTTCCAGGAAGATGACCCCGCAAGCTTTCAGCTAGAGGTGACACGTTCGTTCGTTGACTATGAGCACTTGTACACTTATGGCTTACTTCGTCGTCGTTTCTATCGCATCGATGGAATTTACAGCAGGCTCGAACTTAGTGGCGAATTCATCACGAGAAGCCTTTGAAAGGATCCTGTCACTCATGTTCTCCAGCTCGCTACACATAGAAGAGGCTAGGTACCTATCCTCACCGGAATTAGCACAATCTTCTCTTCAAAATGCCCACAGCTTAGATTCATAACTCGCCAGTGCCAAAATCCTTCACCTAGAGCTCTCAAACCAATATAGATAGCGGAATTCAAGACATGCATATACATCATGAAGCTTTGTCATCCCCGCCTTTCGAATCCCTCCTCCTTGAGAATCTCGCTGACACAAGGCCCTTCCTAAAGACATCTTCTGTTGATATTGTCAACTTGAACAATCGTTTACAGCTAGTACTGACGGACTTGAGACTAACCCATATGAAAGTGTTAAAATTAGTCCAGTTACTCAGCTTGCATTCAGTTACAACCTCAATTCAACATCAATGATGTTCTCCCGAGACCAGTCGGGAGAACATTGACATGTATCAAGATGGATCCAGATCCTTGACAAAGATAATTGGTGCAACCTTGCGTTGTTCTCCCGAGGCTAGTCGGGAGAACATTGGCATGTATCAAGATGGATCCAGATCCTTGGCAAAGATAATTGGTGCAACCCTTGCGTTGTTCTCCCGAGGCCAGTCGGGAGAACATTGACATGCATCAAGATGGATCCAGATCCTTGACAAAGACAATTGGTGCAACCTTGCGTTACTCTCTGAGATGTCAAGCTGGTAATGCTTAGCATCTCCTTTGCTGTCAGATGGCATCTGATCCAGACGCCATTCGTCCTCGCCTTAGACAACGAAATCGCTGACATAATTGCTTGCCGGCCAGTCTGACCTCCTACATTTCCGTCTTTATTCATCCTCATCTTATTTCTATTACTCCTAGTTGATATAGTTGTAGAACATTTCATAACCCCAACTGTTGGGACCAGATTCAGCAATTCGCGGCTTAAAAATCGCAAGCCGGCGAGCTTTTCGCTGCTGTCTAAACCGGAATATTTTGTTTTGTTTTGATAGAAACAGTTCACCATGGGGAGTGGACTTTAGGCGGCGGTGATGGTTCATTCCTTCTTGCAGTAAACGTCCAAGAGATTGTGGATGGAGCCGCAGTAACTGGATTGTTCATCCATTGAAAGCTCCACAAAAGCCGGATGTCATATGCGCTTGACCATAACCACGTACAATAATGGCTTCCGCACTTGGTGAAACATCCCTCGGCTTCCAGTTTCATGGGAATGAAAGACCTTTCTATCCAAGAATTGCATCGGAGTACGCTGTTGTCTCATAATGCTGTCCACTAAGATTCGTGAAGAGACGTTTATTTTTAGGCCACAACATGCACGTATTGCCTGTACTACTCACAGATCGTGAGGGTATCCATTTATAGTATTGCACTGTCACACCTGATTCTTGCGGATGCGATCCTCGAAAATATTGGAGCATTGTACGTGGAGATTGCATCTAGAACTCATTATGGGTACCATCAAGATGACATCCCGAAGTAGACCTCCTACATATTCGGACTTGAGACGATGACAAAGATCAATAGTATACCTATTGACCCGATGGGTTCAAAGTCCGTATGGAACTGACAAATTCTCAGACTTTAGATCAGTAGTGAAGACCTCGGCCTTGACAGACGAGTGCTGCAGTCGATTGTGTACTATTTTTTGCGATTGTCAGTTATTTGGACTTCTACAAAGTTTGCGGGTTACTTGGGCTGATTGATCTCATCTATTCATTTCTGTTGTTAAAATTATAGATGGATAAAGCATCGATCATCGGAGACGCAATTAAGTACGTAATGGAGTTAGAGAGACAAGTGAAGGAGCTGGAGGGGGAGATGGAACTTGACGAGCAAAGGAAAAACAAGATAAACTCAAGCTCCGATACTCTGGGCTCCTTGGCCGCTACGGGTGTCCAGCATGGCGGAGATGCAGCAGCACAGAATGACAAAGATGTGGACTGGAATAAAAATTCGGGAGGAAATGTTTCCAAGTTAGACACGAAAGATCAGCCTAACGTTACGGTGAGTCTGGATGTAAGGATTCCAGCAAATCGTTGGGAATGAGCCCAATCAATCAAGAATGAAGAAATCCATTTGAAATATATTGAAATATGTACAGATCCGACTGCATAGGTACCTGGACCCCTTCACCCCAAAGAATCGCTAGCCCTTGAATTCACTGCGCGTATCAGAAATTCAAATCCAACTTCATGAAATCCATCTCACGAAAATTTCCTAACTGCGTTGGCGGTCATGTAAGTCGTAGATGATATTCGCCTAGAGGCAATTAATTCAACGTTAAAAGACTCTTCGAATTCTATGACCTCGTCTATCACAGGATGGCGAATTTCACTGTTCATCGTATTCCTTGTTCTTTGGCAGCTGGAGCTCTCCAAGATGAAGACCGGAATGTACAATTTGCGGATGTTCTATCAACAGCAGCCCGGCATTTTCATGCACATGACGCAAGCTATTGAGAGTTTGGATCTGAACATCCTTAACTCTCATGTATCGACCTGTGATGGCTATGTTGTGCACTCCATGATTGCCAAGGTATGTACAGGTGCTTAGCCTTATGAATGTTCCTAGTTTTCAACTTCTTCAGATACAAAAATCGAAATGGTTTAAGATGCACTGGCATCAGAAATTGGCACTTGTGTATGCTTCAAACGTCTAGAACGTCTTTCTCACCCACTCAATGGCGAAAATGTTGCCCTCGACAGCCAGATTTAGGGGTAGTAATTTGCGGCAGCCCCTACCTGTTAGCAATCTGATAATATTGTATCGACAGCAAATCAAAGAAATCCAGACTAGAATATGATATATTCTGCCAATTACGGATTTCGTGTGTTCTGGACCGGCTCTTGAATATATGTCGGACGCAGAACCTAGACCTTGGGTCATGTAGATTCCGAATCGAAGCTCGAAGTTTTCAATTTTTCTTTGTGTTGTGAGCCTCTACATTATTGTCATAAGGGCTGCGCCTCAATAATTATATCTTCCTATGCACAGCTCAATAGGGGACTCACAGATTAAATAATAATACCGTAGATCTGTATAATAGAGAAGTATGAGATTCTGTATCAACTTAAACATGGTTGGACCTAAAAATTTGCATCATTGACTGCTGCCATTAAAGTCAGCCATGTAGTCCTAAAGCAGCTTGAAACAAATTCTCTCTGATATATGAACCACTAATTATATAAACAATACTAATGTATAGCAGTACTATATTCTTGTTTGTTAGTCTAGCATGCACCTTAATGGGCACATGAACGCACGAATTCTTGAATGGTATGTCGGCTCTAGCAGTAAGTTGTATCTGACAATCTCTTTTACGCTTTTAAGTAGGTTTTCTGAATTTGAGTTCAACCTCGGTAGCGAGTTCACCCTGAAACCAAGTTCAAGATCACCTGTTGCCTTCTGGCTTGATTGCATGAGAAGTTTTACTTGGATACATCCAACATTCTGGGTCTTGGATCCTGGGAGTTCGTCCTGATATCGAAGGCAAATTCATGGTAGAGATAAACACATTTTCTTTTGTAAGGGAATGAATCCTATGTAATATTATTTCCTTGCCTAGAGCATGAATAGATTTTTCAGTTTGTCACTCTCATAATTCACTTCGATTTCAGGATGCACTCCAGGTTCCAGGACCAAGAACTTTAACACATCTAAAGCAGAGAAATATCAGGCAAACAAATGGTGAAAACTATTTCTAGCTGACGATACATGGCTAGGCTGGAACTCTGAAATAACGGAGATAAAAAAGTTCGTAGATCGAAAGTCAATACTTGTTTTGCAGAGAGCATCTTTACACCTTCAAGTACTTTTGTTCACTTTCCATCTACCATCAAAAGACAGCATCCTTTACCTCTTCTTGAAGTGTTCACAGTCTTGTCCAGAAATAAGCTTCAGCAAACTACTTGTGTATGGTAAAGAGAACTGCGGCCTAGTAGGAATATATTGTGTATTGTTGAGTGTCTAGCAATCAGCAATATGCTTTGAGTATATAAGATAGACCCTTGATCAGACTCCTTCCTCGAATTACTAATTATACAGACCATCCAAATCAATCAAGCGCACGCTCTTTGACGGATTATGCTTGTCAGTGAGTTGCAGCTTTGTCCAATATAGCTGGTTCCAAATTTAACGAGTAATTCTCAGGACGTCAGGTGCATGCTTTCATGTTTCTGCAATGAGAATCCTTGGATGTACGATTACGTGCATTCGATTTCGTCATGATTCCCCAAGTAATATTATGATAACAAGTGCATTATACTGAGAATCTAACCACGCGCCATATATACTTAGATCCTCCACTTCCTTCATGCTTCATTGGGTATGCTCGGTGTTGAAGGCTCCTGCGTGTTTCACACAGTAGGAGCCTTCTGTAACTTACTGGAATCAGTAAAGGGCTTGATCAATACGAAGGGCATGATACGTCTTCCGAAGGGCTCGAAAATTTAGAGCCTTTTTGTACACAGGAGTTTAAGTGCTTCGAGTACATGGGGTTTTCGTCTCCAAAATTCTAAGTAATGTTTGAACTTTAGCATATCGAAGTCTTTTTGGTAAGGTTTATGAGGATTTCAAACCTTCAAAGCCTTAACAATGCTTTATGGTTGTCTTAACTTCTTCGTTTCCTTCTTCGTTTCCTTCTTCGTGGTTTTAGTTCCAAGGCCTCTCTGGTGTCTGCGTTATAAACCTTCAAACCGGCTCCCCCCTGCAGCGCTTTTCAGTGTTAAAAACCCGACTTGCGTGAAGTTCTATTGTTTGCTGTTTGAGTAAATCCTTCCACCACCGTTACACGATAGAAGGATAAATTACAACTTATGCTTCCACGTTAAGCAGATTGTCCAGTCCTATAGATTAAAACAAGGATTCTTTCCATCACACTTGGGTCGAAACAATCCATGGTTGGGTTTGATGGTGACTCGATCTCTTGTCACCTTGCCACTATTCAAATGAAAACCTTCTGAAAAGGACGTAAAAGTCACTTTATGTGCAGAGATATGGCTCGTCTTTACGAAAGCCATAATTACAGCATGACCCCTGTTATTTCCTGTAATTTCGATTCTCTATGCCCCTTGAGCTTTCAAGAGCTTTTATCTTCTCGACGAGCAAAATCTTAGGTTCCTAGGATCTCAGGTTGCAACTGCAGCTTTACAAAACACATTCTCTCGATACGGTACTCAAGAACCTATAATGGAAAGACTCCTTGTTTTGGATGCTACTGAGTCGGCTAAGTATCACAATCAGCTAATATGCTGATTGTGATAAAGGTTTAGTACTGCATATAGAGAACAAGTTCAGAGTTTCAGTCCAAACTTGTTTATGTGAATACATGCTCAGAGTCATTATCTTGTTTTAGGCATGCATAAATCTGATCCTCCCAAAAAAGAGAGGCGTTACCTTCATCAAACGAAGTTTGCACTTCTCGACAAATATATCACATAATAAATACCTTTAGGTTTGATTTATATGGACATACAGATACGTAGATATTAGCCTTTCATGCTTCTTTCATTCTCAGTGCGTAAGCTTCTGTTATCGAGGTTCTCTCCAGTGTATACAGACCCAATGGTGCTCGAGCATAGTGCTCAGAGGCATCAGTTTACGGAGTTGCTTAAATACTTTGGGGAGTCTAAATTTAGTGACTTATTATCCCTTCTGAGCTTAACGTTTCCGGACAGTTGGCAGATTCGATATTGTACAGATATTAATTAAAGCCAAACACCCTTCGGAGTGCTTAGTCATAAGCGCTCAGCGTAGTTTGAGCATCCAGACCCCAGCATGATCAGGTGCCTACTTTCCGTGACTGGATTCTTCGTGCTTAAAACTTTCTCGGCACTCTCACAATCAGCATTTACGGCACAGCACAATCAGCACAAGATCGTGCTTTTCAAGCACGCTCTTTCATCGCTAAGATCTTAAATGTCCTGATTCTTGTGGTGGGCATACAGAGCTAGCAGATGCAGAAACATATATTCTTTAAGCATATTTGGGATTATTTGTTATTGAGCGCCTCAATAACATCATAACCAGATCTTGACATTCAGAGTTGCCAGCATTCTGGGTACCGGAGACTTGGTTGTTTTAGCAGCTTTCGTCAGCTTATATCTGGTTTTAGGCCCTCCGACGGACATTCTAAAATTTCAGCACCCTCGAGATTCTGTTTCTTTAACTCCTCGGATTCGAGTTTCACGTCCAACGAATTAGTTTAATAGCTGCTGTAAGTTCCAAGTGAGGTTGGGATGAATGGACAGAAACATGAGTTGATCTTTCAGGAACTAAGGCCACGAATAAACTCACGCAAGCCGTTCAAGACTTTCTGATGGATCTTAGGCAGAACTGAAGTGGACTGTGCAAAAAAACACCTCCGGAGAATAGACCCTGAGAATGTACATCTTTATAACATTATTATAAGCAACCGGATATAGCAATCGGATACACTCATGTGATCTTTATCAATATTACTTAACCACTGTAAGTTTTTAAGAAATTTCAGAAATCATATAGATATCTCTTTCTGATAAAGACAGGAATCGAGATTTTTCAACAATCTCAATCTGCTCGAAGAACTCTCAGATCATTTAGGCTTTTTAACAGCTGTTCAGTTCCTTCTTTCAAATCTTGAAGCAGTAAGAGTACTCGTTCGGGCCGTGAGGAGAAGTGACTTCAAATCTTGCTGGTCTTCAAAATTCTTGTGGCCAACACTAATAGATTCTAGCCAGTTTGATTTTACTTGAATAAACTTAACTTCAACCCTTGTAGTTCCTTTTATGTTTGAGAATCAATATTTTCACTATCATAGTCAGTTCACTGCTAACTTTCAAGCAATTTGTTTCTGGTCCTTATGGCATCCTGCCGAACATTTCACTGCTTCTACTCCATCAGTTCCCCCGACTTAAGGCAAAACAGATTGCTGATATGTGATGCTTTAATACTACTCATACTCAGTCTATTATTCCTCACTGCTTCTACCCACGTCGGCGTCACGTTCTTTTATCGTTTCGAGCAACTCGAATGCTATTGGAGCCCTCACTGCCCCGGTCTTCGAGCTCTTTAGAGTAGATATGAACGTTACCACACTACTCATCTCTCCAGCCACACACAGAAACGTCAAAAACCCAGGCATGGTTTAGAAAACACTCTCACCGGACACGATGGGCACCTTCGAGTTGGACCTTAGGTAATATTGTTATGCCTGTTATTGGCAGAATGTCATGTTTCTATTGGGGCCATATTGTTCTTGCTGTATTTTAAGCGTTTTGTCAAAACTGATGTTTACTTTTTTTCATTGGTGGATCGATGCTTTCATCGTTTCCTACCTTGATTTGATGTCTTTCATAGGTCATATTGCCCTTCGCCACATTTTAATCCTGACCTTGTATGGTGGAGCTCCTGAATAAGTATTGGCCTGGTGTTATTACTAGCACGGTTCCTGACAGGAGTTGTCTTGGTAGCTTGAGATTAAGTCTACATCGATCAACTGATGGTAGATCCTCTAGGCTAACGTCGTTCGATCCTCTTAAGCTTATACAAAGAATATCGTCTTTTTAATTGCAGAAGACAGTAGTGAGTGCTTTCATTCGGTCTGTATCTTCGATTATACTTATCCAGGCATGGCATGGGCATGGCATACCCTACATGAGTAGAAAGCAGTGTCCTAGGAGACTGAATTGCCCACAAACCTTAGCTTAGTGAGTTACCAATCGGTGTATGTCCTTTCTAAAGATACCCACACTTGGTCTTGACGAGCAGTCGTGATAATGTTGATATCAACTTCAGTTTAGCTATTTGAGCGGCTGAGCTACTCGAGTAATAAAACTAAATGTATTATTTCCCTCACACAGACATACTTTTTAGCTCCTTCAGAACTTTCAGTTACCTACCGAGATGCTTGAACTCTGTTCTATTCAATATTACTAACGGCGCCATATCGCAGTTCGTTTTCAACTGCTAATAACGATATCCTTTTCCGTCGAGGCTTTTAAACGTCTCAAAATATTGTCTTCTGTATCCTTAGCTTAAGTTCGTAGCGATTTGAGTGCTTTGATGTCGGTACTTGAAGTCCTCCAGGTGGCTAGCATGTAGGGACTAAGCCAGGTAATATAGTTCAGATGCATTCACTTCCAGCAAACCATGTGACAAGATTTCATATGACTGCATTTTCCACCATTTTTTGAGAGATCAGATTGCTATGTATGGGGACTCTAGCCCAAATACTTGGAGCACACGCCGGTGCTTGAATCCAAGATGTTCAACAAAGTCTACCTCTCCGAGAAACTGATCATGAGAAGACTTAGTTGAATCCCCTATATTGTCTTCAATTCACTCAGACAGTGGCCTCAGATAAACTGAGCAATGGAGGGTACAACACTAGAGTGATCTGCGAGGGCGAATGATCAGTCGATCAGAGCCCACTTAACGGCACCCCTCAGAAGCGCCATATATTTGAGGCATATATTAGCTCAGAGAAGAGCTAGATACTGTGGAGGGTATAGTTCCACCCTCAAATGCCAACATGGACATGATAAGAGTTTTATGGTGATTAGAAATAATACTTATTGACGATGGAAGTGTTCAAGCAAGAAGAATTGTCCGAATCCTTCTCCATTGCATGCCAAAGTTCGTAGCAGCTAACAAACCCACTTAGAGTATCCTCTGAAGTGGTCTGTAGACAAGCGATTCAAGTTTCAAGGCGTAGCAATTGTAGAGATGCTACGCCTATCGTGGCATCTGTAGAGAAGGAATCAAATGTGTATTTCGATGCCTTCATATATCCTAATTCGGGACCTTTTTTTTCCAACGCGAGCAATGTAGGGAATGGAATACCTGTAAGAGCTCTAGTGTCTCCAGGCTATACACACTCTAAACCGTAGAAAGATAAACATTCTAACCGCCGAAGCACAGATCACTGAAGTTCATGTTCTTTCTTTGAAAGCTGGTGGACTCAGCCTCTCCATTCTACTCACGGCAGTCGTATTACCTGTGCGAAAATACGATGGAGATGTTACGGTTATCTAGCGTGACCGATATTGTTAGCGATTTTGCTCTGTTCGGGTGTTTACTGACCTGACCAAATTCAATCATTACTGAATCGTTGAAAGTTGGAGGGTCCGGATGCATGATTGACCCATGTGCTTTACCTATGGGCTGTATACCTACCATATTTATATTTGAATCCAACCAGTTGTAGTTGGCTCAGATAGATTGCTGACTATAATGGTCGAGCTCAATGTGTCTTATCCACAGAATTGTGCCTCGTGACTAACAGGCACCCATAATTTGCCAGCAGAGAATGTCTTGAACCGATGAGGAACGAGGGTTAAATATCGTCTGATGATACTTAGCCGCCTTCCGAATGTTCCCCCACCTTTTAAGGAACAAGATAGTTCATGGTGGAACCGGTTCATGTGTTCGGTAATTTCTGCGGAAAGAGCAGCTTTTAAATATATATCTTTCTCTGAATATTATCGCTCTGATCAAACTCTAAAAACTACCCTTTGTTGATCTGAGGTTTTTTTTTGGTGGCAGAAGAGCAGAATAGCGTAAATTCGAAAACTGTAAATTCAAGGGGGCCCATTGTTATTTCGGGATCTTGAACAATTTTTGCTACTACTCATCGACTAGCTCACAAGTTTGATTAAGCGCCTGAATGAACATTGAAGTTCACTCTTTTCAACCATCCCAATTAGATCTCGGCGTGGACCAGCTGCAGCTCTCCTAGGTTGTGAGTAACCACAACGTTGTACTTCCCAAGATCGAAACTATCATCTGAAGTCAAGTTTTTTCCAATAGCTTGTACGTCGATAAGCGCGATCTCGTTAAGCTTATACTCTGGAAGTAGCCATCTATGATTTATC

mRNA

>Mapoly0015s0003.4
GGAAAGTAAGCATTGTCAACTAGCCGGCGCTCCGCGGGCAAAGCCGAGTGAAGGGCCGTAATGCGGTGGACACACGGCGTCGCGGACGGCAAAGATTGGAGAGGCGGTGAGGTGCGGTGAGGGGAGGTGAGGTGAAAGGAACGGTACGATCGATAGGCTGGAAGGCATGGCATGGCGCTCGAGCTCGAGCGCTCGCTGGCGCTGAGGCTGAGGCTGAGGCCGCGCGGGTCGGCCTCGCGCTCTTGGTCTAGTTCGCCGCGGACCGGTCGTCTCGTCGCCTACTTTCCCTTCGGTGGTGCACTGCTGCGGCGTTGTGTACTGTAGTGTTCTCCGCCTCGTTCTCGAGGGTGAGCACGCTGATCTTTGTCCTCATCGAGATCATCGGGGCGAGAGTCCACGCTCGTCCATATCTGGAATCCAGACCGAAAGTAAGCATTGAAATTGGTTTGTCGGTGGGTGCGTGCGTGCGAGGCAGCGAACGAATCAGATTTTCGCCAATTATTCACTACACCTCAAGACCTCCATTCTTGAGAATCACTGGTTCCGAGGCCGGACGAGATAACTCGAACAGGCAGCCGGCCAGCCGGCGTCTCTGGAGCAGAAATCAGGCCAAGGAATGCGAGAACTGCTGTCTTTCTTGTACTTACGACTGCTCCTCCGAGTCTACACGAGGGCCCAACATGTGAAGGTCCTATGAAGAGTCTTATTTGAAGCAGGCTCGTGACATGCATTCCATTGTGGGTCGAGGACGGAGGCCTGCGTTTCGGGAGGAGCAGGGATGGAAAGAACACAGTTCGCCCCACACACCTCTGTCACCTAATTTCCATGCCGATCCGTTGTTCGGCACACCTAGTGGGTCATTGCAGGATATTCTTCGCTCCGTCCACATGGTCGAAGGCTCCGCTTTTGTGAGTGTCCCGAAAAGTTCCGGGTCTCAAGCACCACCAGATATTATCGCCCCTCAGCAGCAGCAACAGGTCAGTTCAACCGCTCGGAACGTAAGCGTCGACGCTCCCGTGATAGATGATGGATTGGGCAAGCTGCAAAGGAAGCAACTGCAATGTCACACAAGCTCTTCGTGGGATCACAATATGAGGAATGAGCACGTCTTCGAAGGTTATCCGCATGTTGGACTTGCGGATATCTCCAACACTCAACTGCAGCTCGACAGCTTCAAGCCCGTTGGCACATGGACTGATACGCCAGGCGCTGATCACGAACAGCAATGGACCGATCTGCGCAGGAGCTCTAAGACGACCATGCTCTCACCTGGTCCCAATCTCGATAGTGGCACTTGTCAGCCGTCCGTATGGCGAGAACGCTGGTCCGATAGTTCCAGGGTGCACGCGTCTTCGCATCAGGAGAGACACAGAGCTGCAGCGCCAGCAGCGGGAGCAGCAGCAGCAGCAGCGCACCTGGAAGAATCCACAGATGGAGGTAGTGATCCCATGGACGAAAAAAATTCACGGCGCTTCTCCAACACCGCGGGTTATTGTTCCTCCCGAAATCTTTTCTCCGAACGCAAACGACGTAAGAAGATGAACGACGGCTTGTATTCCTTGCGCTCTATAGTTCCAAACATCAGCAAGATGGATAAAGCATCGATCATCGGAGACGCAATTAAGTACGTAATGGAGTTAGAGAGACAAGTGAAGGAGCTGGAGGGGGAGATGGAACTTGACGAGCAAAGGAAAAACAAGATAAACTCAAGCTCCGATACTCTGGGCTCCTTGGCCGCTACGGGTGTCCAGCATGGCGGAGATGCAGCAGCACAGAATGACAAAGATGTGGACTGGAATAAAAATTCGGGAGGAAATGTTTCCAAGTTAGACACGAAAGATCAGCCTAACGTTACGGTGAGTCTGGATGTAAGGATTCCAGCAAATCGTTGGGAATGAGCCCAATCAATCAAGAATGAAGAAATCCATTTGAAATATATTGAAATATGTACAGATCCGACTGCATAGCTGGAGCTCTCCAAGATGAAGACCGGAATGTACAATTTGCGGATGTTCTATCAACAGCAGCCCGGCATTTTCATGCACATGACGCAAGCTATTGAGAGTTTGGATCTGAACATCCTTAACTCTCATGTATCGACCTGTGATGGCTATGTTGTGCACTCCATGATTGCCAAGAAGAGCAGAATAGCGTAAATTCGAAAACTGTAAATTCAAGGGGGCCCATTGTTATTTCGGGATCTTGAACAATTTTTGCTACTACTCATCGACTAGCTCACAAGTTTGATTAAGCGCCTGAATGAACATTGAAGTTCACTCTTTTCAACCATCCCAATTAGATCTCGGCGTGGACCAGCTGCAGCTCTCCTAGGTTGTGAGTAACCACAACGTTGTACTTCCCAAGATCGAAACTATCATCTGAAGTCAAGTTTTTTCCAATAGCTTGTACGTCGATAAGCGCGATCTCGTTAAGCTTATACTCTGGAAGTAGCCATCTATGATTTATC

CDS

>Mapoly0015s0003.4
ATGCATTCCATTGTGGGTCGAGGACGGAGGCCTGCGTTTCGGGAGGAGCAGGGATGGAAAGAACACAGTTCGCCCCACACACCTCTGTCACCTAATTTCCATGCCGATCCGTTGTTCGGCACACCTAGTGGGTCATTGCAGGATATTCTTCGCTCCGTCCACATGGTCGAAGGCTCCGCTTTTGTGAGTGTCCCGAAAAGTTCCGGGTCTCAAGCACCACCAGATATTATCGCCCCTCAGCAGCAGCAACAGGTCAGTTCAACCGCTCGGAACGTAAGCGTCGACGCTCCCGTGATAGATGATGGATTGGGCAAGCTGCAAAGGAAGCAACTGCAATGTCACACAAGCTCTTCGTGGGATCACAATATGAGGAATGAGCACGTCTTCGAAGGTTATCCGCATGTTGGACTTGCGGATATCTCCAACACTCAACTGCAGCTCGACAGCTTCAAGCCCGTTGGCACATGGACTGATACGCCAGGCGCTGATCACGAACAGCAATGGACCGATCTGCGCAGGAGCTCTAAGACGACCATGCTCTCACCTGGTCCCAATCTCGATAGTGGCACTTGTCAGCCGTCCGTATGGCGAGAACGCTGGTCCGATAGTTCCAGGGTGCACGCGTCTTCGCATCAGGAGAGACACAGAGCTGCAGCGCCAGCAGCGGGAGCAGCAGCAGCAGCAGCGCACCTGGAAGAATCCACAGATGGAGGTAGTGATCCCATGGACGAAAAAAATTCACGGCGCTTCTCCAACACCGCGGGTTATTGTTCCTCCCGAAATCTTTTCTCCGAACGCAAACGACGTAAGAAGATGAACGACGGCTTGTATTCCTTGCGCTCTATAGTTCCAAACATCAGCAAGATGGATAAAGCATCGATCATCGGAGACGCAATTAAGTACGTAATGGAGTTAGAGAGACAAGTGAAGGAGCTGGAGGGGGAGATGGAACTTGACGAGCAAAGGAAAAACAAGATAAACTCAAGCTCCGATACTCTGGGCTCCTTGGCCGCTACGGGTGTCCAGCATGGCGGAGATGCAGCAGCACAGAATGACAAAGATGTGGACTGGAATAAAAATTCGGGAGGAAATGTTTCCAAGTTAGACACGAAAGATCAGCCTAACGTTACGGTGAGTCTGGATGTAAGGATTCCAGCAAATCGTTGGGAATGA

Protein

>Mapoly0015s0003.4
MHSIVGRGRRPAFREEQGWKEHSSPHTPLSPNFHADPLFGTPSGSLQDILRSVHMVEGSAFVSVPKSSGSQAPPDIIAPQQQQQVSSTARNVSVDAPVIDDGLGKLQRKQLQCHTSSSWDHNMRNEHVFEGYPHVGLADISNTQLQLDSFKPVGTWTDTPGADHEQQWTDLRRSSKTTMLSPGPNLDSGTCQPSVWRERWSDSSRVHASSHQERHRAAAPAAGAAAAAAHLEESTDGGSDPMDEKNSRRFSNTAGYCSSRNLFSERKRRKKMNDGLYSLRSIVPNISKMDKASIIGDAIKYVMELERQVKELEGEMELDEQRKNKINSSSDTLGSLAATGVQHGGDAAAQNDKDVDWNKNSGGNVSKLDTKDQPNVTVSLDVRIPANRWE

Mapoly0015s0003.5  

Gene structure:

mRNA scaffold_15:44061..55672  ( + strand )
five_prime_UTR scaffold_15:44061..44785  ( + strand )
CDS scaffold_15:44786..45649  ( + strand )
CDS scaffold_15:47559..47825  ( + strand )
CDS scaffold_15:48186..48356  ( + strand )
CDS scaffold_15:55344..55361  ( + strand )
three_prime_UTR scaffold_15:55362..55672  ( + strand )

Sequences:

Gene

>Mapoly0015s0003.5
GGAAAGTAAGCATTGTCAACTAGCCGGCGCTCCGCGGGCAAAGCCGAGTGAAGGGCCGTAATGCGGTGGACACACGGCGTCGCGGACGGCAAAGATTGGAGAGGCGGTGAGGTGCGGTGAGGGGAGGTGAGGTGAAAGGAACGGTACGATCGATAGGCTGGAAGGCATGGCATGGCGCTCGAGCTCGAGCGCTCGCTGGCGCTGAGGCTGAGGCTGAGGCCGCGCGGGTCGGCCTCGCGCTCTTGGTCTAGTTCGCCGCGGACCGGTCGTCTCGTCGCCTACTTTCCCTTCGGTGGTGCACTGCTGCGGCGTTGTGTACTGTAGTGTTCTCCGCCTCGTTCTCGAGGGTGAGCACGCTGATCTTTGTCCTCATCGAGATCATCGGGGCGAGAGTCCACGCTCGTCCATATCTGGAATCCAGACCGAAAGTAAGCATTGAAATTGGTTTGTCGGTGGGTGCGTGCGTGCGAGGCAGCGAACGAATCAGATTTTCGCCAATTATTCACTACACCTCAAGACCTCCATTCTTGAGAATCACTGGTTCCGAGGCCGGACGAGATAACTCGAACAGGCAGCCGGCCAGCCGGCGTCTCTGGAGCAGAAATCAGGCCAAGGAATGCGAGAACTGCTGTCTTTCTTGTACTTACGACTGCTCCTCCGAGTCTACACGAGGGCCCAACATGTGAAGGTCCTATGAAGAGTCTTATTTGAAGCAGGCTCGTGACATGCATTCCATTGTGGGTCGAGGACGGAGGCCTGCGTTTCGGGAGGAGCAGGGATGGAAAGAACACAGTTCGCCCCACACACCTCTGTCACCTAATTTCCATGCCGATCCGTTGTTCGGCACACCTAGTGGGTCATTGCAGGATATTCTTCGCTCCGTCCACATGGTCGAAGGCTCCGCTTTTGTGAGTGTCCCGAAAAGTTCCGGGTCTCAAGCACCACCAGATATTATCGCCCCTCAGCAGCAGCAACAGGTCAGTTCAACCGCTCGGAACGTAAGCGTCGACGCTCCCGTGATAGATGATGGATTGGGCAAGCTGCAAAGGAAGCAACTGCAATGTCACACAAGCTCTTCGTGGGATCACAATATGAGGAATGAGCACGTCTTCGAAGGTTATCCGCATGTTGGACTTGCGGATATCTCCAACACTCAACTGCAGCTCGACAGCTTCAAGCCCGTTGGCACATGGACTGATACGCCAGGCGCTGATCACGAACAGCAATGGACCGATCTGCGCAGGAGCTCTAAGACGACCATGCTCTCACCTGGTCCCAATCTCGATAGTGGCACTTGTCAGCCGTCCGTATGGCGAGAACGCTGGTCCGATAGTTCCAGGGTGCACGCGTCTTCGCATCAGGAGAGACACAGAGCTGCAGCGCCAGCAGCGGGAGCAGCAGCAGCAGCAGCGCACCTGGAAGAATCCACAGATGGAGGTAGTGATCCCATGGACGAAAAAAATTCACGGCGCTTCTCCAACACCGCGGGTTATTGTTCCTCCCGAAATCTTTTCTCCGAACGCAAACGACGTAAGAAGATGAACGACGGCTTGTATTCCTTGCGCTCTATAGTTCCAAACATCAGCAAGGTAAGACATCTTTTATCTTCCAGGAAGATGACCCCGCAAGCTTTCAGCTAGAGGTGACACGTTCGTTCGTTGACTATGAGCACTTGTACACTTATGGCTTACTTCGTCGTCGTTTCTATCGCATCGATGGAATTTACAGCAGGCTCGAACTTAGTGGCGAATTCATCACGAGAAGCCTTTGAAAGGATCCTGTCACTCATGTTCTCCAGCTCGCTACACATAGAAGAGGCTAGGTACCTATCCTCACCGGAATTAGCACAATCTTCTCTTCAAAATGCCCACAGCTTAGATTCATAACTCGCCAGTGCCAAAATCCTTCACCTAGAGCTCTCAAACCAATATAGATAGCGGAATTCAAGACATGCATATACATCATGAAGCTTTGTCATCCCCGCCTTTCGAATCCCTCCTCCTTGAGAATCTCGCTGACACAAGGCCCTTCCTAAAGACATCTTCTGTTGATATTGTCAACTTGAACAATCGTTTACAGCTAGTACTGACGGACTTGAGACTAACCCATATGAAAGTGTTAAAATTAGTCCAGTTACTCAGCTTGCATTCAGTTACAACCTCAATTCAACATCAATGATGTTCTCCCGAGACCAGTCGGGAGAACATTGACATGTATCAAGATGGATCCAGATCCTTGACAAAGATAATTGGTGCAACCTTGCGTTGTTCTCCCGAGGCTAGTCGGGAGAACATTGGCATGTATCAAGATGGATCCAGATCCTTGGCAAAGATAATTGGTGCAACCCTTGCGTTGTTCTCCCGAGGCCAGTCGGGAGAACATTGACATGCATCAAGATGGATCCAGATCCTTGACAAAGACAATTGGTGCAACCTTGCGTTACTCTCTGAGATGTCAAGCTGGTAATGCTTAGCATCTCCTTTGCTGTCAGATGGCATCTGATCCAGACGCCATTCGTCCTCGCCTTAGACAACGAAATCGCTGACATAATTGCTTGCCGGCCAGTCTGACCTCCTACATTTCCGTCTTTATTCATCCTCATCTTATTTCTATTACTCCTAGTTGATATAGTTGTAGAACATTTCATAACCCCAACTGTTGGGACCAGATTCAGCAATTCGCGGCTTAAAAATCGCAAGCCGGCGAGCTTTTCGCTGCTGTCTAAACCGGAATATTTTGTTTTGTTTTGATAGAAACAGTTCACCATGGGGAGTGGACTTTAGGCGGCGGTGATGGTTCATTCCTTCTTGCAGTAAACGTCCAAGAGATTGTGGATGGAGCCGCAGTAACTGGATTGTTCATCCATTGAAAGCTCCACAAAAGCCGGATGTCATATGCGCTTGACCATAACCACGTACAATAATGGCTTCCGCACTTGGTGAAACATCCCTCGGCTTCCAGTTTCATGGGAATGAAAGACCTTTCTATCCAAGAATTGCATCGGAGTACGCTGTTGTCTCATAATGCTGTCCACTAAGATTCGTGAAGAGACGTTTATTTTTAGGCCACAACATGCACGTATTGCCTGTACTACTCACAGATCGTGAGGGTATCCATTTATAGTATTGCACTGTCACACCTGATTCTTGCGGATGCGATCCTCGAAAATATTGGAGCATTGTACGTGGAGATTGCATCTAGAACTCATTATGGGTACCATCAAGATGACATCCCGAAGTAGACCTCCTACATATTCGGACTTGAGACGATGACAAAGATCAATAGTATACCTATTGACCCGATGGGTTCAAAGTCCGTATGGAACTGACAAATTCTCAGACTTTAGATCAGTAGTGAAGACCTCGGCCTTGACAGACGAGTGCTGCAGTCGATTGTGTACTATTTTTTGCGATTGTCAGTTATTTGGACTTCTACAAAGTTTGCGGGTTACTTGGGCTGATTGATCTCATCTATTCATTTCTGTTGTTAAAATTATAGATGGATAAAGCATCGATCATCGGAGACGCAATTAAGTACGTAATGGAGTTAGAGAGACAAGTGAAGGAGCTGGAGGGGGAGATGGAACTTGACGAGCAAAGGAAAAACAAGATAAACTCAAGCTCCGATACTCTGGGCTCCTTGGCCGCTACGGGTGTCCAGCATGGCGGAGATGCAGCAGCACAGAATGACAAAGATGTGGACTGGAATAAAAATTCGGGAGGAAATGTTTCCAAGTTAGACACGAAAGATCAGCCTAACGTTACGGTGAGTCTGGATGTAAGGATTCCAGCAAATCGTTGGGAATGAGCCCAATCAATCAAGAATGAAGAAATCCATTTGAAATATATTGAAATATGTACAGATCCGACTGCATAGGTACCTGGACCCCTTCACCCCAAAGAATCGCTAGCCCTTGAATTCACTGCGCGTATCAGAAATTCAAATCCAACTTCATGAAATCCATCTCACGAAAATTTCCTAACTGCGTTGGCGGTCATGTAAGTCGTAGATGATATTCGCCTAGAGGCAATTAATTCAACGTTAAAAGACTCTTCGAATTCTATGACCTCGTCTATCACAGGATGGCGAATTTCACTGTTCATCGTATTCCTTGTTCTTTGGCAGCTGGAGCTCTCCAAGATGAAGACCGGAATGTACAATTTGCGGATGTTCTATCAACAGCAGCCCGGCATTTTCATGCACATGACGCAAGCTATTGAGAGTTTGGATCTGAACATCCTTAACTCTCATGTATCGACCTGTGATGGCTATGTTGTGCACTCCATGATTGCCAAGGTATGTACAGGTGCTTAGCCTTATGAATGTTCCTAGTTTTCAACTTCTTCAGATACAAAAATCGAAATGGTTTAAGATGCACTGGCATCAGAAATTGGCACTTGTGTATGCTTCAAACGTCTAGAACGTCTTTCTCACCCACTCAATGGCGAAAATGTTGCCCTCGACAGCCAGATTTAGGGGTAGTAATTTGCGGCAGCCCCTACCTGTTAGCAATCTGATAATATTGTATCGACAGCAAATCAAAGAAATCCAGACTAGAATATGATATATTCTGCCAATTACGGATTTCGTGTGTTCTGGACCGGCTCTTGAATATATGTCGGACGCAGAACCTAGACCTTGGGTCATGTAGATTCCGAATCGAAGCTCGAAGTTTTCAATTTTTCTTTGTGTTGTGAGCCTCTACATTATTGTCATAAGGGCTGCGCCTCAATAATTATATCTTCCTATGCACAGCTCAATAGGGGACTCACAGATTAAATAATAATACCGTAGATCTGTATAATAGAGAAGTATGAGATTCTGTATCAACTTAAACATGGTTGGACCTAAAAATTTGCATCATTGACTGCTGCCATTAAAGTCAGCCATGTAGTCCTAAAGCAGCTTGAAACAAATTCTCTCTGATATATGAACCACTAATTATATAAACAATACTAATGTATAGCAGTACTATATTCTTGTTTGTTAGTCTAGCATGCACCTTAATGGGCACATGAACGCACGAATTCTTGAATGGTATGTCGGCTCTAGCAGTAAGTTGTATCTGACAATCTCTTTTACGCTTTTAAGTAGGTTTTCTGAATTTGAGTTCAACCTCGGTAGCGAGTTCACCCTGAAACCAAGTTCAAGATCACCTGTTGCCTTCTGGCTTGATTGCATGAGAAGTTTTACTTGGATACATCCAACATTCTGGGTCTTGGATCCTGGGAGTTCGTCCTGATATCGAAGGCAAATTCATGGTAGAGATAAACACATTTTCTTTTGTAAGGGAATGAATCCTATGTAATATTATTTCCTTGCCTAGAGCATGAATAGATTTTTCAGTTTGTCACTCTCATAATTCACTTCGATTTCAGGATGCACTCCAGGTTCCAGGACCAAGAACTTTAACACATCTAAAGCAGAGAAATATCAGGCAAACAAATGGTGAAAACTATTTCTAGCTGACGATACATGGCTAGGCTGGAACTCTGAAATAACGGAGATAAAAAAGTTCGTAGATCGAAAGTCAATACTTGTTTTGCAGAGAGCATCTTTACACCTTCAAGTACTTTTGTTCACTTTCCATCTACCATCAAAAGACAGCATCCTTTACCTCTTCTTGAAGTGTTCACAGTCTTGTCCAGAAATAAGCTTCAGCAAACTACTTGTGTATGGTAAAGAGAACTGCGGCCTAGTAGGAATATATTGTGTATTGTTGAGTGTCTAGCAATCAGCAATATGCTTTGAGTATATAAGATAGACCCTTGATCAGACTCCTTCCTCGAATTACTAATTATACAGACCATCCAAATCAATCAAGCGCACGCTCTTTGACGGATTATGCTTGTCAGTGAGTTGCAGCTTTGTCCAATATAGCTGGTTCCAAATTTAACGAGTAATTCTCAGGACGTCAGGTGCATGCTTTCATGTTTCTGCAATGAGAATCCTTGGATGTACGATTACGTGCATTCGATTTCGTCATGATTCCCCAAGTAATATTATGATAACAAGTGCATTATACTGAGAATCTAACCACGCGCCATATATACTTAGATCCTCCACTTCCTTCATGCTTCATTGGGTATGCTCGGTGTTGAAGGCTCCTGCGTGTTTCACACAGTAGGAGCCTTCTGTAACTTACTGGAATCAGTAAAGGGCTTGATCAATACGAAGGGCATGATACGTCTTCCGAAGGGCTCGAAAATTTAGAGCCTTTTTGTACACAGGAGTTTAAGTGCTTCGAGTACATGGGGTTTTCGTCTCCAAAATTCTAAGTAATGTTTGAACTTTAGCATATCGAAGTCTTTTTGGTAAGGTTTATGAGGATTTCAAACCTTCAAAGCCTTAACAATGCTTTATGGTTGTCTTAACTTCTTCGTTTCCTTCTTCGTTTCCTTCTTCGTGGTTTTAGTTCCAAGGCCTCTCTGGTGTCTGCGTTATAAACCTTCAAACCGGCTCCCCCCTGCAGCGCTTTTCAGTGTTAAAAACCCGACTTGCGTGAAGTTCTATTGTTTGCTGTTTGAGTAAATCCTTCCACCACCGTTACACGATAGAAGGATAAATTACAACTTATGCTTCCACGTTAAGCAGATTGTCCAGTCCTATAGATTAAAACAAGGATTCTTTCCATCACACTTGGGTCGAAACAATCCATGGTTGGGTTTGATGGTGACTCGATCTCTTGTCACCTTGCCACTATTCAAATGAAAACCTTCTGAAAAGGACGTAAAAGTCACTTTATGTGCAGAGATATGGCTCGTCTTTACGAAAGCCATAATTACAGCATGACCCCTGTTATTTCCTGTAATTTCGATTCTCTATGCCCCTTGAGCTTTCAAGAGCTTTTATCTTCTCGACGAGCAAAATCTTAGGTTCCTAGGATCTCAGGTTGCAACTGCAGCTTTACAAAACACATTCTCTCGATACGGTACTCAAGAACCTATAATGGAAAGACTCCTTGTTTTGGATGCTACTGAGTCGGCTAAGTATCACAATCAGCTAATATGCTGATTGTGATAAAGGTTTAGTACTGCATATAGAGAACAAGTTCAGAGTTTCAGTCCAAACTTGTTTATGTGAATACATGCTCAGAGTCATTATCTTGTTTTAGGCATGCATAAATCTGATCCTCCCAAAAAAGAGAGGCGTTACCTTCATCAAACGAAGTTTGCACTTCTCGACAAATATATCACATAATAAATACCTTTAGGTTTGATTTATATGGACATACAGATACGTAGATATTAGCCTTTCATGCTTCTTTCATTCTCAGTGCGTAAGCTTCTGTTATCGAGGTTCTCTCCAGTGTATACAGACCCAATGGTGCTCGAGCATAGTGCTCAGAGGCATCAGTTTACGGAGTTGCTTAAATACTTTGGGGAGTCTAAATTTAGTGACTTATTATCCCTTCTGAGCTTAACGTTTCCGGACAGTTGGCAGATTCGATATTGTACAGATATTAATTAAAGCCAAACACCCTTCGGAGTGCTTAGTCATAAGCGCTCAGCGTAGTTTGAGCATCCAGACCCCAGCATGATCAGGTGCCTACTTTCCGTGACTGGATTCTTCGTGCTTAAAACTTTCTCGGCACTCTCACAATCAGCATTTACGGCACAGCACAATCAGCACAAGATCGTGCTTTTCAAGCACGCTCTTTCATCGCTAAGATCTTAAATGTCCTGATTCTTGTGGTGGGCATACAGAGCTAGCAGATGCAGAAACATATATTCTTTAAGCATATTTGGGATTATTTGTTATTGAGCGCCTCAATAACATCATAACCAGATCTTGACATTCAGAGTTGCCAGCATTCTGGGTACCGGAGACTTGGTTGTTTTAGCAGCTTTCGTCAGCTTATATCTGGTTTTAGGCCCTCCGACGGACATTCTAAAATTTCAGCACCCTCGAGATTCTGTTTCTTTAACTCCTCGGATTCGAGTTTCACGTCCAACGAATTAGTTTAATAGCTGCTGTAAGTTCCAAGTGAGGTTGGGATGAATGGACAGAAACATGAGTTGATCTTTCAGGAACTAAGGCCACGAATAAACTCACGCAAGCCGTTCAAGACTTTCTGATGGATCTTAGGCAGAACTGAAGTGGACTGTGCAAAAAAACACCTCCGGAGAATAGACCCTGAGAATGTACATCTTTATAACATTATTATAAGCAACCGGATATAGCAATCGGATACACTCATGTGATCTTTATCAATATTACTTAACCACTGTAAGTTTTTAAGAAATTTCAGAAATCATATAGATATCTCTTTCTGATAAAGACAGGAATCGAGATTTTTCAACAATCTCAATCTGCTCGAAGAACTCTCAGATCATTTAGGCTTTTTAACAGCTGTTCAGTTCCTTCTTTCAAATCTTGAAGCAGTAAGAGTACTCGTTCGGGCCGTGAGGAGAAGTGACTTCAAATCTTGCTGGTCTTCAAAATTCTTGTGGCCAACACTAATAGATTCTAGCCAGTTTGATTTTACTTGAATAAACTTAACTTCAACCCTTGTAGTTCCTTTTATGTTTGAGAATCAATATTTTCACTATCATAGTCAGTTCACTGCTAACTTTCAAGCAATTTGTTTCTGGTCCTTATGGCATCCTGCCGAACATTTCACTGCTTCTACTCCATCAGTTCCCCCGACTTAAGGCAAAACAGATTGCTGATATGTGATGCTTTAATACTACTCATACTCAGTCTATTATTCCTCACTGCTTCTACCCACGTCGGCGTCACGTTCTTTTATCGTTTCGAGCAACTCGAATGCTATTGGAGCCCTCACTGCCCCGGTCTTCGAGCTCTTTAGAGTAGATATGAACGTTACCACACTACTCATCTCTCCAGCCACACACAGAAACGTCAAAAACCCAGGCATGGTTTAGAAAACACTCTCACCGGACACGATGGGCACCTTCGAGTTGGACCTTAGGTAATATTGTTATGCCTGTTATTGGCAGAATGTCATGTTTCTATTGGGGCCATATTGTTCTTGCTGTATTTTAAGCGTTTTGTCAAAACTGATGTTTACTTTTTTTCATTGGTGGATCGATGCTTTCATCGTTTCCTACCTTGATTTGATGTCTTTCATAGGTCATATTGCCCTTCGCCACATTTTAATCCTGACCTTGTATGGTGGAGCTCCTGAATAAGTATTGGCCTGGTGTTATTACTAGCACGGTTCCTGACAGGAGTTGTCTTGGTAGCTTGAGATTAAGTCTACATCGATCAACTGATGGTAGATCCTCTAGGCTAACGTCGTTCGATCCTCTTAAGCTTATACAAAGAATATCGTCTTTTTAATTGCAGAAGACAGTAGTGAGTGCTTTCATTCGGTCTGTATCTTCGATTATACTTATCCAGGCATGGCATGGGCATGGCATACCCTACATGAGTAGAAAGCAGTGTCCTAGGAGACTGAATTGCCCACAAACCTTAGCTTAGTGAGTTACCAATCGGTGTATGTCCTTTCTAAAGATACCCACACTTGGTCTTGACGAGCAGTCGTGATAATGTTGATATCAACTTCAGTTTAGCTATTTGAGCGGCTGAGCTACTCGAGTAATAAAACTAAATGTATTATTTCCCTCACACAGACATACTTTTTAGCTCCTTCAGAACTTTCAGTTACCTACCGAGATGCTTGAACTCTGTTCTATTCAATATTACTAACGGCGCCATATCGCAGTTCGTTTTCAACTGCTAATAACGATATCCTTTTCCGTCGAGGCTTTTAAACGTCTCAAAATATTGTCTTCTGTATCCTTAGCTTAAGTTCGTAGCGATTTGAGTGCTTTGATGTCGGTACTTGAAGTCCTCCAGGTGGCTAGCATGTAGGGACTAAGCCAGGTAATATAGTTCAGATGCATTCACTTCCAGCAAACCATGTGACAAGATTTCATATGACTGCATTTTCCACCATTTTTTGAGAGATCAGATTGCTATGTATGGGGACTCTAGCCCAAATACTTGGAGCACACGCCGGTGCTTGAATCCAAGATGTTCAACAAAGTCTACCTCTCCGAGAAACTGATCATGAGAAGACTTAGTTGAATCCCCTATATTGTCTTCAATTCACTCAGACAGTGGCCTCAGATAAACTGAGCAATGGAGGGTACAACACTAGAGTGATCTGCGAGGGCGAATGATCAGTCGATCAGAGCCCACTTAACGGCACCCCTCAGAAGCGCCATATATTTGAGGCATATATTAGCTCAGAGAAGAGCTAGATACTGTGGAGGGTATAGTTCCACCCTCAAATGCCAACATGGACATGATAAGAGTTTTATGGTGATTAGAAATAATACTTATTGACGATGGAAGTGTTCAAGCAAGAAGAATTGTCCGAATCCTTCTCCATTGCATGCCAAAGTTCGTAGCAGCTAACAAACCCACTTAGAGTATCCTCTGAAGTGGTCTGTAGACAAGCGATTCAAGTTTCAAGGCGTAGCAATTGTAGAGATGCTACGCCTATCGTGGCATCTGTAGAGAAGGAATCAAATGTGTATTTCGATGCCTTCATATATCCTAATTCGGGACCTTTTTTTTCCAACGCGAGCAATGTAGGGAATGGAATACCTGTAAGAGCTCTAGTGTCTCCAGGCTATACACACTCTAAACCGTAGAAAGATAAACATTCTAACCGCCGAAGCACAGATCACTGAAGTTCATGTTCTTTCTTTGAAAGCTGGTGGACTCAGCCTCTCCATTCTACTCACGGCAGTCGTATTACCTGTGCGAAAATACGATGGAGATGTTACGGTTATCTAGCGTGACCGATATTGTTAGCGATTTTGCTCTGTTCGGGTGTTTACTGACCTGACCAAATTCAATCATTACTGAATCGTTGAAAGTTGGAGGGTCCGGATGCATGATTGACCCATGTGCTTTACCTATGGGCTGTATACCTACCATATTTATATTTGAATCCAACCAGTTGTAGTTGGCTCAGATAGATTGCTGACTATAATGGTCGAGCTCAATGTGTCTTATCCACAGAATTGTGCCTCGTGACTAACAGGCACCCATAATTTGCCAGCAGAGAATGTCTTGAACCGATGAGGAACGAGGGTTAAATATCGTCTGATGATACTTAGCCGCCTTCCGAATGTTCCCCCACCTTTTAAGGAACAAGATAGTTCATGGTGGAACCGGTTCATGTGTTCGGTAATTTCTGCGGAAAGAGCAGCTTTTAAATATATATCTTTCTCTGAATATTATCGCTCTGATCAAACTCTAAAAACTACCCTTTGTTGATCTGAGGTTTTTTTTTGGTGGCAGAAGAGCAGAATAGCGTAAATTCGAAAACTGTAAATTCAAGGGGGCCCATTGTTATTTCGGGATCTTGAACAATTTTTGCTACTACTCATCGACTAGCTCACAAGTTTGATTAAGCGCCTGAATGAACATTGAAGTTCACTCTTTTCAACCATCCCAATTAGATCTCGGCGTGGACCAGCTGCAGCTCTCCTAGGTTGTGAGTAACCACAACGTTGTACTTCCCAAGATCGAAACTATCATCTGAAGTCAAGTTTTTTCCAATAGCTTGTACGTCGATAAGCGCGATCTCGTTAAGCTTATACTCTGGAAGTAGCCATCTATGATTTATC

mRNA

>Mapoly0015s0003.5
GGAAAGTAAGCATTGTCAACTAGCCGGCGCTCCGCGGGCAAAGCCGAGTGAAGGGCCGTAATGCGGTGGACACACGGCGTCGCGGACGGCAAAGATTGGAGAGGCGGTGAGGTGCGGTGAGGGGAGGTGAGGTGAAAGGAACGGTACGATCGATAGGCTGGAAGGCATGGCATGGCGCTCGAGCTCGAGCGCTCGCTGGCGCTGAGGCTGAGGCTGAGGCCGCGCGGGTCGGCCTCGCGCTCTTGGTCTAGTTCGCCGCGGACCGGTCGTCTCGTCGCCTACTTTCCCTTCGGTGGTGCACTGCTGCGGCGTTGTGTACTGTAGTGTTCTCCGCCTCGTTCTCGAGGGTGAGCACGCTGATCTTTGTCCTCATCGAGATCATCGGGGCGAGAGTCCACGCTCGTCCATATCTGGAATCCAGACCGAAAGTAAGCATTGAAATTGGTTTGTCGGTGGGTGCGTGCGTGCGAGGCAGCGAACGAATCAGATTTTCGCCAATTATTCACTACACCTCAAGACCTCCATTCTTGAGAATCACTGGTTCCGAGGCCGGACGAGATAACTCGAACAGGCAGCCGGCCAGCCGGCGTCTCTGGAGCAGAAATCAGGCCAAGGAATGCGAGAACTGCTGTCTTTCTTGTACTTACGACTGCTCCTCCGAGTCTACACGAGGGCCCAACATGTGAAGGTCCTATGAAGAGTCTTATTTGAAGCAGGCTCGTGACATGCATTCCATTGTGGGTCGAGGACGGAGGCCTGCGTTTCGGGAGGAGCAGGGATGGAAAGAACACAGTTCGCCCCACACACCTCTGTCACCTAATTTCCATGCCGATCCGTTGTTCGGCACACCTAGTGGGTCATTGCAGGATATTCTTCGCTCCGTCCACATGGTCGAAGGCTCCGCTTTTGTGAGTGTCCCGAAAAGTTCCGGGTCTCAAGCACCACCAGATATTATCGCCCCTCAGCAGCAGCAACAGGTCAGTTCAACCGCTCGGAACGTAAGCGTCGACGCTCCCGTGATAGATGATGGATTGGGCAAGCTGCAAAGGAAGCAACTGCAATGTCACACAAGCTCTTCGTGGGATCACAATATGAGGAATGAGCACGTCTTCGAAGGTTATCCGCATGTTGGACTTGCGGATATCTCCAACACTCAACTGCAGCTCGACAGCTTCAAGCCCGTTGGCACATGGACTGATACGCCAGGCGCTGATCACGAACAGCAATGGACCGATCTGCGCAGGAGCTCTAAGACGACCATGCTCTCACCTGGTCCCAATCTCGATAGTGGCACTTGTCAGCCGTCCGTATGGCGAGAACGCTGGTCCGATAGTTCCAGGGTGCACGCGTCTTCGCATCAGGAGAGACACAGAGCTGCAGCGCCAGCAGCGGGAGCAGCAGCAGCAGCAGCGCACCTGGAAGAATCCACAGATGGAGGTAGTGATCCCATGGACGAAAAAAATTCACGGCGCTTCTCCAACACCGCGGGTTATTGTTCCTCCCGAAATCTTTTCTCCGAACGCAAACGACGTAAGAAGATGAACGACGGCTTGTATTCCTTGCGCTCTATAGTTCCAAACATCAGCAAGATGGATAAAGCATCGATCATCGGAGACGCAATTAAGTACGTAATGGAGTTAGAGAGACAAGTGAAGGAGCTGGAGGGGGAGATGGAACTTGACGAGCAAAGGAAAAACAAGATAAACTCAAGCTCCGATACTCTGGGCTCCTTGGCCGCTACGGGTGTCCAGCATGGCGGAGATGCAGCAGCACAGAATGACAAAGATGTGGACTGGAATAAAAATTCGGGAGGAAATGTTTCCAAGTTAGACACGAAAGATCAGCCTAACGTTACGCTGGAGCTCTCCAAGATGAAGACCGGAATGTACAATTTGCGGATGTTCTATCAACAGCAGCCCGGCATTTTCATGCACATGACGCAAGCTATTGAGAGTTTGGATCTGAACATCCTTAACTCTCATGTATCGACCTGTGATGGCTATGTTGTGCACTCCATGATTGCCAAGAAGAGCAGAATAGCGTAAATTCGAAAACTGTAAATTCAAGGGGGCCCATTGTTATTTCGGGATCTTGAACAATTTTTGCTACTACTCATCGACTAGCTCACAAGTTTGATTAAGCGCCTGAATGAACATTGAAGTTCACTCTTTTCAACCATCCCAATTAGATCTCGGCGTGGACCAGCTGCAGCTCTCCTAGGTTGTGAGTAACCACAACGTTGTACTTCCCAAGATCGAAACTATCATCTGAAGTCAAGTTTTTTCCAATAGCTTGTACGTCGATAAGCGCGATCTCGTTAAGCTTATACTCTGGAAGTAGCCATCTATGATTTATC

CDS

>Mapoly0015s0003.5
ATGCATTCCATTGTGGGTCGAGGACGGAGGCCTGCGTTTCGGGAGGAGCAGGGATGGAAAGAACACAGTTCGCCCCACACACCTCTGTCACCTAATTTCCATGCCGATCCGTTGTTCGGCACACCTAGTGGGTCATTGCAGGATATTCTTCGCTCCGTCCACATGGTCGAAGGCTCCGCTTTTGTGAGTGTCCCGAAAAGTTCCGGGTCTCAAGCACCACCAGATATTATCGCCCCTCAGCAGCAGCAACAGGTCAGTTCAACCGCTCGGAACGTAAGCGTCGACGCTCCCGTGATAGATGATGGATTGGGCAAGCTGCAAAGGAAGCAACTGCAATGTCACACAAGCTCTTCGTGGGATCACAATATGAGGAATGAGCACGTCTTCGAAGGTTATCCGCATGTTGGACTTGCGGATATCTCCAACACTCAACTGCAGCTCGACAGCTTCAAGCCCGTTGGCACATGGACTGATACGCCAGGCGCTGATCACGAACAGCAATGGACCGATCTGCGCAGGAGCTCTAAGACGACCATGCTCTCACCTGGTCCCAATCTCGATAGTGGCACTTGTCAGCCGTCCGTATGGCGAGAACGCTGGTCCGATAGTTCCAGGGTGCACGCGTCTTCGCATCAGGAGAGACACAGAGCTGCAGCGCCAGCAGCGGGAGCAGCAGCAGCAGCAGCGCACCTGGAAGAATCCACAGATGGAGGTAGTGATCCCATGGACGAAAAAAATTCACGGCGCTTCTCCAACACCGCGGGTTATTGTTCCTCCCGAAATCTTTTCTCCGAACGCAAACGACGTAAGAAGATGAACGACGGCTTGTATTCCTTGCGCTCTATAGTTCCAAACATCAGCAAGATGGATAAAGCATCGATCATCGGAGACGCAATTAAGTACGTAATGGAGTTAGAGAGACAAGTGAAGGAGCTGGAGGGGGAGATGGAACTTGACGAGCAAAGGAAAAACAAGATAAACTCAAGCTCCGATACTCTGGGCTCCTTGGCCGCTACGGGTGTCCAGCATGGCGGAGATGCAGCAGCACAGAATGACAAAGATGTGGACTGGAATAAAAATTCGGGAGGAAATGTTTCCAAGTTAGACACGAAAGATCAGCCTAACGTTACGCTGGAGCTCTCCAAGATGAAGACCGGAATGTACAATTTGCGGATGTTCTATCAACAGCAGCCCGGCATTTTCATGCACATGACGCAAGCTATTGAGAGTTTGGATCTGAACATCCTTAACTCTCATGTATCGACCTGTGATGGCTATGTTGTGCACTCCATGATTGCCAAGAAGAGCAGAATAGCGTAA

Protein

>Mapoly0015s0003.5
MHSIVGRGRRPAFREEQGWKEHSSPHTPLSPNFHADPLFGTPSGSLQDILRSVHMVEGSAFVSVPKSSGSQAPPDIIAPQQQQQVSSTARNVSVDAPVIDDGLGKLQRKQLQCHTSSSWDHNMRNEHVFEGYPHVGLADISNTQLQLDSFKPVGTWTDTPGADHEQQWTDLRRSSKTTMLSPGPNLDSGTCQPSVWRERWSDSSRVHASSHQERHRAAAPAAGAAAAAAHLEESTDGGSDPMDEKNSRRFSNTAGYCSSRNLFSERKRRKKMNDGLYSLRSIVPNISKMDKASIIGDAIKYVMELERQVKELEGEMELDEQRKNKINSSSDTLGSLAATGVQHGGDAAAQNDKDVDWNKNSGGNVSKLDTKDQPNVTLELSKMKTGMYNLRMFYQQQPGIFMHMTQAIESLDLNILNSHVSTCDGYVVHSMIAKKSRIA

Mapoly0015s0003.6  

Gene structure:

mRNA scaffold_15:44061..49871  ( + strand )
five_prime_UTR scaffold_15:44061..44785  ( + strand )
CDS scaffold_15:44786..45649  ( + strand )
CDS scaffold_15:47559..47867  ( + strand )
three_prime_UTR scaffold_15:47868..47936  ( + strand )
three_prime_UTR scaffold_15:48186..48356  ( + strand )
three_prime_UTR scaffold_15:49439..49871  ( + strand )

Sequences:

Gene

>Mapoly0015s0003.6
GGAAAGTAAGCATTGTCAACTAGCCGGCGCTCCGCGGGCAAAGCCGAGTGAAGGGCCGTAATGCGGTGGACACACGGCGTCGCGGACGGCAAAGATTGGAGAGGCGGTGAGGTGCGGTGAGGGGAGGTGAGGTGAAAGGAACGGTACGATCGATAGGCTGGAAGGCATGGCATGGCGCTCGAGCTCGAGCGCTCGCTGGCGCTGAGGCTGAGGCTGAGGCCGCGCGGGTCGGCCTCGCGCTCTTGGTCTAGTTCGCCGCGGACCGGTCGTCTCGTCGCCTACTTTCCCTTCGGTGGTGCACTGCTGCGGCGTTGTGTACTGTAGTGTTCTCCGCCTCGTTCTCGAGGGTGAGCACGCTGATCTTTGTCCTCATCGAGATCATCGGGGCGAGAGTCCACGCTCGTCCATATCTGGAATCCAGACCGAAAGTAAGCATTGAAATTGGTTTGTCGGTGGGTGCGTGCGTGCGAGGCAGCGAACGAATCAGATTTTCGCCAATTATTCACTACACCTCAAGACCTCCATTCTTGAGAATCACTGGTTCCGAGGCCGGACGAGATAACTCGAACAGGCAGCCGGCCAGCCGGCGTCTCTGGAGCAGAAATCAGGCCAAGGAATGCGAGAACTGCTGTCTTTCTTGTACTTACGACTGCTCCTCCGAGTCTACACGAGGGCCCAACATGTGAAGGTCCTATGAAGAGTCTTATTTGAAGCAGGCTCGTGACATGCATTCCATTGTGGGTCGAGGACGGAGGCCTGCGTTTCGGGAGGAGCAGGGATGGAAAGAACACAGTTCGCCCCACACACCTCTGTCACCTAATTTCCATGCCGATCCGTTGTTCGGCACACCTAGTGGGTCATTGCAGGATATTCTTCGCTCCGTCCACATGGTCGAAGGCTCCGCTTTTGTGAGTGTCCCGAAAAGTTCCGGGTCTCAAGCACCACCAGATATTATCGCCCCTCAGCAGCAGCAACAGGTCAGTTCAACCGCTCGGAACGTAAGCGTCGACGCTCCCGTGATAGATGATGGATTGGGCAAGCTGCAAAGGAAGCAACTGCAATGTCACACAAGCTCTTCGTGGGATCACAATATGAGGAATGAGCACGTCTTCGAAGGTTATCCGCATGTTGGACTTGCGGATATCTCCAACACTCAACTGCAGCTCGACAGCTTCAAGCCCGTTGGCACATGGACTGATACGCCAGGCGCTGATCACGAACAGCAATGGACCGATCTGCGCAGGAGCTCTAAGACGACCATGCTCTCACCTGGTCCCAATCTCGATAGTGGCACTTGTCAGCCGTCCGTATGGCGAGAACGCTGGTCCGATAGTTCCAGGGTGCACGCGTCTTCGCATCAGGAGAGACACAGAGCTGCAGCGCCAGCAGCGGGAGCAGCAGCAGCAGCAGCGCACCTGGAAGAATCCACAGATGGAGGTAGTGATCCCATGGACGAAAAAAATTCACGGCGCTTCTCCAACACCGCGGGTTATTGTTCCTCCCGAAATCTTTTCTCCGAACGCAAACGACGTAAGAAGATGAACGACGGCTTGTATTCCTTGCGCTCTATAGTTCCAAACATCAGCAAGGTAAGACATCTTTTATCTTCCAGGAAGATGACCCCGCAAGCTTTCAGCTAGAGGTGACACGTTCGTTCGTTGACTATGAGCACTTGTACACTTATGGCTTACTTCGTCGTCGTTTCTATCGCATCGATGGAATTTACAGCAGGCTCGAACTTAGTGGCGAATTCATCACGAGAAGCCTTTGAAAGGATCCTGTCACTCATGTTCTCCAGCTCGCTACACATAGAAGAGGCTAGGTACCTATCCTCACCGGAATTAGCACAATCTTCTCTTCAAAATGCCCACAGCTTAGATTCATAACTCGCCAGTGCCAAAATCCTTCACCTAGAGCTCTCAAACCAATATAGATAGCGGAATTCAAGACATGCATATACATCATGAAGCTTTGTCATCCCCGCCTTTCGAATCCCTCCTCCTTGAGAATCTCGCTGACACAAGGCCCTTCCTAAAGACATCTTCTGTTGATATTGTCAACTTGAACAATCGTTTACAGCTAGTACTGACGGACTTGAGACTAACCCATATGAAAGTGTTAAAATTAGTCCAGTTACTCAGCTTGCATTCAGTTACAACCTCAATTCAACATCAATGATGTTCTCCCGAGACCAGTCGGGAGAACATTGACATGTATCAAGATGGATCCAGATCCTTGACAAAGATAATTGGTGCAACCTTGCGTTGTTCTCCCGAGGCTAGTCGGGAGAACATTGGCATGTATCAAGATGGATCCAGATCCTTGGCAAAGATAATTGGTGCAACCCTTGCGTTGTTCTCCCGAGGCCAGTCGGGAGAACATTGACATGCATCAAGATGGATCCAGATCCTTGACAAAGACAATTGGTGCAACCTTGCGTTACTCTCTGAGATGTCAAGCTGGTAATGCTTAGCATCTCCTTTGCTGTCAGATGGCATCTGATCCAGACGCCATTCGTCCTCGCCTTAGACAACGAAATCGCTGACATAATTGCTTGCCGGCCAGTCTGACCTCCTACATTTCCGTCTTTATTCATCCTCATCTTATTTCTATTACTCCTAGTTGATATAGTTGTAGAACATTTCATAACCCCAACTGTTGGGACCAGATTCAGCAATTCGCGGCTTAAAAATCGCAAGCCGGCGAGCTTTTCGCTGCTGTCTAAACCGGAATATTTTGTTTTGTTTTGATAGAAACAGTTCACCATGGGGAGTGGACTTTAGGCGGCGGTGATGGTTCATTCCTTCTTGCAGTAAACGTCCAAGAGATTGTGGATGGAGCCGCAGTAACTGGATTGTTCATCCATTGAAAGCTCCACAAAAGCCGGATGTCATATGCGCTTGACCATAACCACGTACAATAATGGCTTCCGCACTTGGTGAAACATCCCTCGGCTTCCAGTTTCATGGGAATGAAAGACCTTTCTATCCAAGAATTGCATCGGAGTACGCTGTTGTCTCATAATGCTGTCCACTAAGATTCGTGAAGAGACGTTTATTTTTAGGCCACAACATGCACGTATTGCCTGTACTACTCACAGATCGTGAGGGTATCCATTTATAGTATTGCACTGTCACACCTGATTCTTGCGGATGCGATCCTCGAAAATATTGGAGCATTGTACGTGGAGATTGCATCTAGAACTCATTATGGGTACCATCAAGATGACATCCCGAAGTAGACCTCCTACATATTCGGACTTGAGACGATGACAAAGATCAATAGTATACCTATTGACCCGATGGGTTCAAAGTCCGTATGGAACTGACAAATTCTCAGACTTTAGATCAGTAGTGAAGACCTCGGCCTTGACAGACGAGTGCTGCAGTCGATTGTGTACTATTTTTTGCGATTGTCAGTTATTTGGACTTCTACAAAGTTTGCGGGTTACTTGGGCTGATTGATCTCATCTATTCATTTCTGTTGTTAAAATTATAGATGGATAAAGCATCGATCATCGGAGACGCAATTAAGTACGTAATGGAGTTAGAGAGACAAGTGAAGGAGCTGGAGGGGGAGATGGAACTTGACGAGCAAAGGAAAAACAAGATAAACTCAAGCTCCGATACTCTGGGCTCCTTGGCCGCTACGGGTGTCCAGCATGGCGGAGATGCAGCAGCACAGAATGACAAAGATGTGGACTGGAATAAAAATTCGGGAGGAAATGTTTCCAAGTTAGACACGAAAGATCAGCCTAACGTTACGGTGAGTCTGGATGTAAGGATTCCAGCAAATCGTTGGGAATGAGCCCAATCAATCAAGAATGAAGAAATCCATTTGAAATATATTGAAATATGTACAGATCCGACTGCATAGGTACCTGGACCCCTTCACCCCAAAGAATCGCTAGCCCTTGAATTCACTGCGCGTATCAGAAATTCAAATCCAACTTCATGAAATCCATCTCACGAAAATTTCCTAACTGCGTTGGCGGTCATGTAAGTCGTAGATGATATTCGCCTAGAGGCAATTAATTCAACGTTAAAAGACTCTTCGAATTCTATGACCTCGTCTATCACAGGATGGCGAATTTCACTGTTCATCGTATTCCTTGTTCTTTGGCAGCTGGAGCTCTCCAAGATGAAGACCGGAATGTACAATTTGCGGATGTTCTATCAACAGCAGCCCGGCATTTTCATGCACATGACGCAAGCTATTGAGAGTTTGGATCTGAACATCCTTAACTCTCATGTATCGACCTGTGATGGCTATGTTGTGCACTCCATGATTGCCAAGGTATGTACAGGTGCTTAGCCTTATGAATGTTCCTAGTTTTCAACTTCTTCAGATACAAAAATCGAAATGGTTTAAGATGCACTGGCATCAGAAATTGGCACTTGTGTATGCTTCAAACGTCTAGAACGTCTTTCTCACCCACTCAATGGCGAAAATGTTGCCCTCGACAGCCAGATTTAGGGGTAGTAATTTGCGGCAGCCCCTACCTGTTAGCAATCTGATAATATTGTATCGACAGCAAATCAAAGAAATCCAGACTAGAATATGATATATTCTGCCAATTACGGATTTCGTGTGTTCTGGACCGGCTCTTGAATATATGTCGGACGCAGAACCTAGACCTTGGGTCATGTAGATTCCGAATCGAAGCTCGAAGTTTTCAATTTTTCTTTGTGTTGTGAGCCTCTACATTATTGTCATAAGGGCTGCGCCTCAATAATTATATCTTCCTATGCACAGCTCAATAGGGGACTCACAGATTAAATAATAATACCGTAGATCTGTATAATAGAGAAGTATGAGATTCTGTATCAACTTAAACATGGTTGGACCTAAAAATTTGCATCATTGACTGCTGCCATTAAAGTCAGCCATGTAGTCCTAAAGCAGCTTGAAACAAATTCTCTCTGATATATGAACCACTAATTATATAAACAATACTAATGTATAGCAGTACTATATTCTTGTTTGTTAGTCTAGCATGCACCTTAATGGGCACATGAACGCACGAATTCTTGAATGGTATGTCGGCTCTAGCAGTAAGTTGTATCTGACAATCTCTTTTACGCTTTTAAGTAGGTTTTCTGAATTTGAGTTCAACCTCGGTAGCGAGTTCACCCTGAAACCAAGTTCAAGATCACCTGTTGCCTTCTGGCTTGATTGCATGAGAAGTTTTACTTGGATACATCCAACATTCTGGGTCTTGGATCCTGGGAGTTCGTCCTGATATCGAAGGCAAATTCATGGTAGAGATAAACACATTTTCTTTTGTAAGGGAATGAATCCTATGTAATATTATTTCCTTGCCTAGAGCATGAATAGATTTTTCAGTTTGTCACTCTCATAATTCACTTCGATTTCAGGATGCACTCCAGGTTCCAGGACCAAGAACTTTAACACATCTAAAGCAGAGAAATATCAGGCAAACAAATGGTGAAAACTATTTCTAGCTGACGATACATGGCTAGGCTGGAACTCTGAAATAACGGAGATAAAAAAGTTCGTAGATCGAAAGTCAATACTTGTTTTGCAGAGAGCATCTTTACACCTTCAAGTACTTTTGTTCACTTTCCATCTACCATCAAAAGACAGCATCCTTTACCTCTTCTTGAAGTGTTCACAGTCTTGTCCAGAAATAAGCTTCAGCAAACTACTTGTGTATGGTAAAGAGAACTGCGGCCTAGTAGGAATATATTGTGTATTGTTGAGTGTCTAGCAATCAGCAATATGCTTTGAGTATATAAGATAGACCCTTGATCAGACTCCTTCCTCGAATTACTAATTATACAGACCATC

mRNA

>Mapoly0015s0003.6
GGAAAGTAAGCATTGTCAACTAGCCGGCGCTCCGCGGGCAAAGCCGAGTGAAGGGCCGTAATGCGGTGGACACACGGCGTCGCGGACGGCAAAGATTGGAGAGGCGGTGAGGTGCGGTGAGGGGAGGTGAGGTGAAAGGAACGGTACGATCGATAGGCTGGAAGGCATGGCATGGCGCTCGAGCTCGAGCGCTCGCTGGCGCTGAGGCTGAGGCTGAGGCCGCGCGGGTCGGCCTCGCGCTCTTGGTCTAGTTCGCCGCGGACCGGTCGTCTCGTCGCCTACTTTCCCTTCGGTGGTGCACTGCTGCGGCGTTGTGTACTGTAGTGTTCTCCGCCTCGTTCTCGAGGGTGAGCACGCTGATCTTTGTCCTCATCGAGATCATCGGGGCGAGAGTCCACGCTCGTCCATATCTGGAATCCAGACCGAAAGTAAGCATTGAAATTGGTTTGTCGGTGGGTGCGTGCGTGCGAGGCAGCGAACGAATCAGATTTTCGCCAATTATTCACTACACCTCAAGACCTCCATTCTTGAGAATCACTGGTTCCGAGGCCGGACGAGATAACTCGAACAGGCAGCCGGCCAGCCGGCGTCTCTGGAGCAGAAATCAGGCCAAGGAATGCGAGAACTGCTGTCTTTCTTGTACTTACGACTGCTCCTCCGAGTCTACACGAGGGCCCAACATGTGAAGGTCCTATGAAGAGTCTTATTTGAAGCAGGCTCGTGACATGCATTCCATTGTGGGTCGAGGACGGAGGCCTGCGTTTCGGGAGGAGCAGGGATGGAAAGAACACAGTTCGCCCCACACACCTCTGTCACCTAATTTCCATGCCGATCCGTTGTTCGGCACACCTAGTGGGTCATTGCAGGATATTCTTCGCTCCGTCCACATGGTCGAAGGCTCCGCTTTTGTGAGTGTCCCGAAAAGTTCCGGGTCTCAAGCACCACCAGATATTATCGCCCCTCAGCAGCAGCAACAGGTCAGTTCAACCGCTCGGAACGTAAGCGTCGACGCTCCCGTGATAGATGATGGATTGGGCAAGCTGCAAAGGAAGCAACTGCAATGTCACACAAGCTCTTCGTGGGATCACAATATGAGGAATGAGCACGTCTTCGAAGGTTATCCGCATGTTGGACTTGCGGATATCTCCAACACTCAACTGCAGCTCGACAGCTTCAAGCCCGTTGGCACATGGACTGATACGCCAGGCGCTGATCACGAACAGCAATGGACCGATCTGCGCAGGAGCTCTAAGACGACCATGCTCTCACCTGGTCCCAATCTCGATAGTGGCACTTGTCAGCCGTCCGTATGGCGAGAACGCTGGTCCGATAGTTCCAGGGTGCACGCGTCTTCGCATCAGGAGAGACACAGAGCTGCAGCGCCAGCAGCGGGAGCAGCAGCAGCAGCAGCGCACCTGGAAGAATCCACAGATGGAGGTAGTGATCCCATGGACGAAAAAAATTCACGGCGCTTCTCCAACACCGCGGGTTATTGTTCCTCCCGAAATCTTTTCTCCGAACGCAAACGACGTAAGAAGATGAACGACGGCTTGTATTCCTTGCGCTCTATAGTTCCAAACATCAGCAAGATGGATAAAGCATCGATCATCGGAGACGCAATTAAGTACGTAATGGAGTTAGAGAGACAAGTGAAGGAGCTGGAGGGGGAGATGGAACTTGACGAGCAAAGGAAAAACAAGATAAACTCAAGCTCCGATACTCTGGGCTCCTTGGCCGCTACGGGTGTCCAGCATGGCGGAGATGCAGCAGCACAGAATGACAAAGATGTGGACTGGAATAAAAATTCGGGAGGAAATGTTTCCAAGTTAGACACGAAAGATCAGCCTAACGTTACGGTGAGTCTGGATGTAAGGATTCCAGCAAATCGTTGGGAATGAGCCCAATCAATCAAGAATGAAGAAATCCATTTGAAATATATTGAAATATGTACAGATCCGACTGCATAGCTGGAGCTCTCCAAGATGAAGACCGGAATGTACAATTTGCGGATGTTCTATCAACAGCAGCCCGGCATTTTCATGCACATGACGCAAGCTATTGAGAGTTTGGATCTGAACATCCTTAACTCTCATGTATCGACCTGTGATGGCTATGTTGTGCACTCCATGATTGCCAAGGATGCACTCCAGGTTCCAGGACCAAGAACTTTAACACATCTAAAGCAGAGAAATATCAGGCAAACAAATGGTGAAAACTATTTCTAGCTGACGATACATGGCTAGGCTGGAACTCTGAAATAACGGAGATAAAAAAGTTCGTAGATCGAAAGTCAATACTTGTTTTGCAGAGAGCATCTTTACACCTTCAAGTACTTTTGTTCACTTTCCATCTACCATCAAAAGACAGCATCCTTTACCTCTTCTTGAAGTGTTCACAGTCTTGTCCAGAAATAAGCTTCAGCAAACTACTTGTGTATGGTAAAGAGAACTGCGGCCTAGTAGGAATATATTGTGTATTGTTGAGTGTCTAGCAATCAGCAATATGCTTTGAGTATATAAGATAGACCCTTGATCAGACTCCTTCCTCGAATTACTAATTATACAGACCATC

CDS

>Mapoly0015s0003.6
ATGCATTCCATTGTGGGTCGAGGACGGAGGCCTGCGTTTCGGGAGGAGCAGGGATGGAAAGAACACAGTTCGCCCCACACACCTCTGTCACCTAATTTCCATGCCGATCCGTTGTTCGGCACACCTAGTGGGTCATTGCAGGATATTCTTCGCTCCGTCCACATGGTCGAAGGCTCCGCTTTTGTGAGTGTCCCGAAAAGTTCCGGGTCTCAAGCACCACCAGATATTATCGCCCCTCAGCAGCAGCAACAGGTCAGTTCAACCGCTCGGAACGTAAGCGTCGACGCTCCCGTGATAGATGATGGATTGGGCAAGCTGCAAAGGAAGCAACTGCAATGTCACACAAGCTCTTCGTGGGATCACAATATGAGGAATGAGCACGTCTTCGAAGGTTATCCGCATGTTGGACTTGCGGATATCTCCAACACTCAACTGCAGCTCGACAGCTTCAAGCCCGTTGGCACATGGACTGATACGCCAGGCGCTGATCACGAACAGCAATGGACCGATCTGCGCAGGAGCTCTAAGACGACCATGCTCTCACCTGGTCCCAATCTCGATAGTGGCACTTGTCAGCCGTCCGTATGGCGAGAACGCTGGTCCGATAGTTCCAGGGTGCACGCGTCTTCGCATCAGGAGAGACACAGAGCTGCAGCGCCAGCAGCGGGAGCAGCAGCAGCAGCAGCGCACCTGGAAGAATCCACAGATGGAGGTAGTGATCCCATGGACGAAAAAAATTCACGGCGCTTCTCCAACACCGCGGGTTATTGTTCCTCCCGAAATCTTTTCTCCGAACGCAAACGACGTAAGAAGATGAACGACGGCTTGTATTCCTTGCGCTCTATAGTTCCAAACATCAGCAAGATGGATAAAGCATCGATCATCGGAGACGCAATTAAGTACGTAATGGAGTTAGAGAGACAAGTGAAGGAGCTGGAGGGGGAGATGGAACTTGACGAGCAAAGGAAAAACAAGATAAACTCAAGCTCCGATACTCTGGGCTCCTTGGCCGCTACGGGTGTCCAGCATGGCGGAGATGCAGCAGCACAGAATGACAAAGATGTGGACTGGAATAAAAATTCGGGAGGAAATGTTTCCAAGTTAGACACGAAAGATCAGCCTAACGTTACGGTGAGTCTGGATGTAAGGATTCCAGCAAATCGTTGGGAATGA

Protein

>Mapoly0015s0003.6
MHSIVGRGRRPAFREEQGWKEHSSPHTPLSPNFHADPLFGTPSGSLQDILRSVHMVEGSAFVSVPKSSGSQAPPDIIAPQQQQQVSSTARNVSVDAPVIDDGLGKLQRKQLQCHTSSSWDHNMRNEHVFEGYPHVGLADISNTQLQLDSFKPVGTWTDTPGADHEQQWTDLRRSSKTTMLSPGPNLDSGTCQPSVWRERWSDSSRVHASSHQERHRAAAPAAGAAAAAAHLEESTDGGSDPMDEKNSRRFSNTAGYCSSRNLFSERKRRKKMNDGLYSLRSIVPNISKMDKASIIGDAIKYVMELERQVKELEGEMELDEQRKNKINSSSDTLGSLAATGVQHGGDAAAQNDKDVDWNKNSGGNVSKLDTKDQPNVTVSLDVRIPANRWE

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>