Mapoly0016s0064



Description

ZINC FINGER PROTEIN-RELATED

Reference DB

Database ID Description
OrthoMCL OG5_136453
PANTHER PTHR21385 ZINC FINGER PROTEIN-RELATED
PANTHER PTHR21385:SF0 SUBFAMILY NOT NAMED

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpC2H2-4 transcription factor, C2H2-ZnF Mapoly0016s0064.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0016s0064.1 scaffold_16:590217..594460  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
Mapoly0016s0064.2 scaffold_16:590217..594460  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0016s0064.1  

Gene structure:

mRNA scaffold_16:590217..594460  ( + strand )
five_prime_UTR scaffold_16:590217..590499  ( + strand )
five_prime_UTR scaffold_16:590751..590836  ( + strand )
five_prime_UTR scaffold_16:591080..591125  ( + strand )
CDS scaffold_16:591126..591224  ( + strand )
CDS scaffold_16:591489..591514  ( + strand )
CDS scaffold_16:591851..591935  ( + strand )
CDS scaffold_16:592195..592404  ( + strand )
CDS scaffold_16:592784..592912  ( + strand )
CDS scaffold_16:593175..593232  ( + strand )
CDS scaffold_16:593505..593578  ( + strand )
CDS scaffold_16:593850..593941  ( + strand )
CDS scaffold_16:594130..594211  ( + strand )
three_prime_UTR scaffold_16:594212..594460  ( + strand )

Sequences:

Gene

>Mapoly0016s0064.1
CTTGAGTCGAGAGTGAAGACCGCGAGTCATCGATCGATGCAGGCTTCAAGGTTTGGGCCGCCTGGCCTGCCTCGGGTCTCCCTTTTTCAGGCGGATTTCTGCACCCTCAGCGCGGTGTAATCAAGGTTTTCGATTTCTTTCGGTTGCAGCTCGGAGAATCAGGATTGTCCATCCAAGTTTTGTCGATACGGATGGTGTTTATTGTGGAAACTGAGTGTTGTAAGGGCCTCTGGAGGACCGTGATCTTGATTGCTGGATACGAGCATCCGCGTGGATCTTGAGGGTGATTTTTGTACTTTTGTAATTGAAGCTCGACTTTGTTTTGGGGCCAAATTTTTTTATTTCGTGATTCTTTTACTCCCTTGTGTCGGTGAATGACGTTCACAGCTGAGTAGAGCTGAAGAATTGAGCAATCGTAGTGTTTTGCGTTAAGTTCATCCCGGGGAGTTACACGTCCGATGGATTTGCGGATTCGAATTTCTTGAGTGGCTCAATTTGGAATTAATGATTCTGGGTTTGTTTGTCAACAATCAGAAAACTTTGGTGAGCTGTATTTCTGAGCAAGTAGTAGAAGACACAGAGGGCCAGATTTTCTCTCCCTCCCGCGTGACTGTAACAGGGTTCGTGAAGCATGCGTGGTTGGATTTTTTTTCTTTTTTCTGTAGTTCTGAACTGGAAATTTTGCGATATCCTTGGATATATCTAACAGATGGGGAGGGAATTCAAATAAATAATAATTTATAAATAAATAGATTCAAATGGAGTATTGTCTCATGCGCATGTTCGAGTTGGCGATCAGTGATTCAGTTGTGTGCTCTAATCGTCTCTAATTGAATCTAATGGATTTTTGGAAATTTTTGCAGAACTTTTATTTAGGGTCAAGAGAGTCAGCTGGATACCTGTTCCAACATGGCCATTCTTGGAAATGATAGAAAGAGGGTCTTGCCTCTATTATTATGTCTCGTCGTCCTCGCTTTGCACGTGATTGACTGCAGCTCGGCGATATTGGTAAACAAAGGCCTTCTGCTTTTGTCCCAATTCTCTTTCATCTGACTGAACCCCTAGTTTTTACTAGTTGCAGGTTGGTTTGTATAGAGATGGTCGATCAGTGCAGCTTTGAAGGAAACGACCGTTTAATTGCACAATGTAGTATGTTGCAATCGTTTTTGGAGAGTGAAGTCTCGGTTAACGGATGTTGCTGCACTCTTAGAAAATGACAGTGACTTCTATATATGTGCGTTAAGCTGACATAGCTTGTGATTCTATGTGCAGGATCGTCGACCAGTGTATGATTCAAGGTGCGATCATGTCACCAACTACAGTCCTCGTAATTGCAAAGATGTCCATGTGTTATGTTTTGTGATATTGTCGTCACCACCTCTTGTCCAAGGTTCAAACTAGAAAGTGCCCACTTCCCGATTGTGTATCTTTACTCTCATATACATGTCCGTGGGTACGCAGAATCATCTGCGCTCTGGTCAGATACCACACAATTGTAGACGATAATGCTATGCTGTCTGGGTTCCAAGCCGCATGAATGTAGCCTTTTGTATAATCAACGTATAATCATCAAACCTTGCCCAAATTATACTTCTCATCTATCCATAAAAGTACATCTGGCTGCCATTTCTCAGGCACGAGGACGAGAATGAGACTCAAGATGGTAAAGTGCATTGTTCAAGAGCAAGGAGCAGAACAGCTAGCCAAATACTTGACGAGGTAAATATCATGCACTTTTAACCTATGCGTTGTATGTTGTAACTTGAGTATTCAAAACCTCATGCACAATAACATCAACACTATTCATCATCAGGAGTTTCAACTGTAACGTAGTAGCCTCATACATCATAGCCATGTGAAACTATCACTTTTCATAAGTAGGTCATGATGAAGGACACACTGGTCAAGTTATGTACGATAATTGGACAAACTGACCAAATTTCGGCTCATGATGTTCGTGGTGTGGAGGATTCTGCAGTATTTGTTACCTTTCTTGGAGAAGGAGCAGTACAATCTGTCCAGCGCTTGCCGATTGAATCCTGAGAACAACATGTTCAAGGATCAAGAATTGCAAAAGGACAATGTACGCCCATCACAATGGCAATGTTTGTACTGCAAGAAAACTTTCCGATCGGAGGACTACCTGGACAAGCACATGGACAATCGTCACTACGCTATGCTTGATCTTGTAAGTACATCAATGGCCTTTCCACAAAACAGGTGAAACTGTTAAATCTTTGCTCAACAAGTTGGCGATATCAGATATTGTGCCATTTACTGTCCTTGCGTAGATTAGGATAGGAGTACTCTCATGATGTCCGCAACGTCTTGACAGCGGGCCTCGGCTGTCAATTCAAGGGGCTCGGTGGAATGTGTCAAGTCTGGATAATGATTCCTCCGAGAGTCAAAAGTTAGCACTTGTTTTTGACAACCTAATGGAGTCGGATTCCCTTGCTTGGTTTTTATTTGCAAAGAAAAGTTTAGGAAATAACATCAGTAGTTGATGAAAGAACGAGATCATCTGTATTCCCCTCTCTGACTTTTTTATTACTCTTGACGTTTTTCAGAATTCAAAGCGTTGCTTAGCAGACATTTGTGGTGCTGTACACTGTGATCATGCGGATAGTGTTGCGAAGGCAACGACGAAAAAGAGGTGCAATCGCGCAGCAGTGATCAAGAACAAGCATCTGTGTGAGGTCTTGTGTCCACAACCTACTTATGTTTTCGGTTTAGGACCTTTTTTTGAAGGTCGTATTTCTCCTGAACTTTTTTACCAAATTTCAAGCAACTCATGCGCACGTGAGAAAGATGGTGTGACGATAGCTACTGAAAGGTCAAAGCTGATCTTCAATCGTGATCGCCTTGGAATTTGGAAGATTCTTCCGCTTATCTAGAGAACTAAAAAACCGATATGTCAGAACTGCGACTTACCTTCAGAAGTGTGTTGTTTGATATCAGGCTCTGGCGAATGAATGTTTTCCATCGAAAGAAGGTGCTACTGCTCTGCGCTTAAACGGTATTTCATCTTGCTTGGTGTATACACGTAGAGCGAGATAAGCAGTGCAGTTTGATGATTCAAAATTCAGGCCCAATATCCATCTCACGTATATACAAGTAAACAATCTTATTATTGATAGCATAATGTAGGAAACATATGACTTCGGATGTATGTGATAAGTTGTCGTGTTTTGCTATGGTTGCTACTTGTCTATTGGTATGATGCTCTTCCATTACATTTAGGTGCTCTTAAAGTCATACCAACAGTAATTTTGTACATCTGGATTGCAGAATTCTTTCTACGTCAGTTCTGCGATTCACACACTTGCGACGGAAGCGCAAAGCACTTCCCGAGGGGTTCTGGGGTAACGACAGGACGTTAATACCTATAGCGAACTGAATCTTCCTATTTGAAGATTCAGTCTGTATTACACCGACAGAATTAGTCTTTTCTTGCTTTCCCCTAAACATCGGAAGTTGTAATATTTGTACTGAAAGCCCTTGCATGGATTTCTTTTCCTTTTCTCTCTACTAGTATCAATGTTTTCCTGAAGTTGCTTTACCGCATGATGAGAGGAAACTTGTACCTTCGAAACACTTGTATACCTTACCTTCCAAAAATCGTTGTGCTTGCAGAGAAGGAAGAACAAATCTTTATACATGGCTCTGTGTCTCTTCGTGATCATATTACTTGGAATATTTTACCTTGCAGTGTACTTATATCAAAGGTATGTGGGGCATCACCTGAATTTCATTCACCCTAGTCATGGGATTTGGAAAGGTATCAAAACAGTTATGTAGAATCAAGACAACCAAATCTCAACACGACAATCATGTAGGTCACTTTTGAGTGTATTTCGTATACGGCAGGTTGTTTTCACTCGATTAATGCCGTCTGCCATTTGTTGAACTGCAGAGATATGAACGGCGATGCGTCAAGTCTAAAGCGGCTTAGACAGCATCCGATACTGAAAGCACAGAAGTCGAAGAAATTTTGAAAGCTAACCGCAACTGTACATTAGACGATTGATTGTTTCGTTCTTAGAGATATCATGTGATTGTTGCTGTGTGCCACACGGATTTTAGCAAGTACAATTCCGAGTCATCATATTACGTCTGTGCAATGGTGTCACGCTTTGGCAATATTTGTCACTATAATTTAGCATCCAAATTCAAATGAGAGCCGTGAATCAACATTGCTACCATGTTCTTCGTGCATGAGAAATCTTCTCCACTGAGCCAGTTCC

mRNA

>Mapoly0016s0064.1
CTTGAGTCGAGAGTGAAGACCGCGAGTCATCGATCGATGCAGGCTTCAAGGTTTGGGCCGCCTGGCCTGCCTCGGGTCTCCCTTTTTCAGGCGGATTTCTGCACCCTCAGCGCGGTGTAATCAAGGTTTTCGATTTCTTTCGGTTGCAGCTCGGAGAATCAGGATTGTCCATCCAAGTTTTGTCGATACGGATGGTGTTTATTGTGGAAACTGAGTGTTGTAAGGGCCTCTGGAGGACCGTGATCTTGATTGCTGGATACGAGCATCCGCGTGGATCTTGAGGAAAACTTTGGTGAGCTGTATTTCTGAGCAAGTAGTAGAAGACACAGAGGGCCAGATTTTCTCTCCCTCCCGCGTGACTGTAACAGGAACTTTTATTTAGGGTCAAGAGAGTCAGCTGGATACCTGTTCCAACATGGCCATTCTTGGAAATGATAGAAAGAGGGTCTTGCCTCTATTATTATGTCTCGTCGTCCTCGCTTTGCACGTGATTGACTGCAGCTCGGCGATATTGGATCGTCGACCAGTGTATGATTCAAGGCACGAGGACGAGAATGAGACTCAAGATGGTAAAGTGCATTGTTCAAGAGCAAGGAGCAGAACAGCTAGCCAAATACTTGACGAGTATTTGTTACCTTTCTTGGAGAAGGAGCAGTACAATCTGTCCAGCGCTTGCCGATTGAATCCTGAGAACAACATGTTCAAGGATCAAGAATTGCAAAAGGACAATGTACGCCCATCACAATGGCAATGTTTGTACTGCAAGAAAACTTTCCGATCGGAGGACTACCTGGACAAGCACATGGACAATCGTCACTACGCTATGCTTGATCTTAATTCAAAGCGTTGCTTAGCAGACATTTGTGGTGCTGTACACTGTGATCATGCGGATAGTGTTGCGAAGGCAACGACGAAAAAGAGGTGCAATCGCGCAGCAGTGATCAAGAACAAGCATCTGTGTGAGGCTCTGGCGAATGAATGTTTTCCATCGAAAGAAGGTGCTACTGCTCTGCGCTTAAACGAATTCTTTCTACGTCAGTTCTGCGATTCACACACTTGCGACGGAAGCGCAAAGCACTTCCCGAGGGGTTCTGGGAGAAGGAAGAACAAATCTTTATACATGGCTCTGTGTCTCTTCGTGATCATATTACTTGGAATATTTTACCTTGCAGTGTACTTATATCAAAGAGATATGAACGGCGATGCGTCAAGTCTAAAGCGGCTTAGACAGCATCCGATACTGAAAGCACAGAAGTCGAAGAAATTTTGAAAGCTAACCGCAACTGTACATTAGACGATTGATTGTTTCGTTCTTAGAGATATCATGTGATTGTTGCTGTGTGCCACACGGATTTTAGCAAGTACAATTCCGAGTCATCATATTACGTCTGTGCAATGGTGTCACGCTTTGGCAATATTTGTCACTATAATTTAGCATCCAAATTCAAATGAGAGCCGTGAATCAACATTGCTACCATGTTCTTCGTGCATGAGAAATCTTCTCCACTGAGCCAGTTCC

CDS

>Mapoly0016s0064.1
ATGGCCATTCTTGGAAATGATAGAAAGAGGGTCTTGCCTCTATTATTATGTCTCGTCGTCCTCGCTTTGCACGTGATTGACTGCAGCTCGGCGATATTGGATCGTCGACCAGTGTATGATTCAAGGCACGAGGACGAGAATGAGACTCAAGATGGTAAAGTGCATTGTTCAAGAGCAAGGAGCAGAACAGCTAGCCAAATACTTGACGAGTATTTGTTACCTTTCTTGGAGAAGGAGCAGTACAATCTGTCCAGCGCTTGCCGATTGAATCCTGAGAACAACATGTTCAAGGATCAAGAATTGCAAAAGGACAATGTACGCCCATCACAATGGCAATGTTTGTACTGCAAGAAAACTTTCCGATCGGAGGACTACCTGGACAAGCACATGGACAATCGTCACTACGCTATGCTTGATCTTAATTCAAAGCGTTGCTTAGCAGACATTTGTGGTGCTGTACACTGTGATCATGCGGATAGTGTTGCGAAGGCAACGACGAAAAAGAGGTGCAATCGCGCAGCAGTGATCAAGAACAAGCATCTGTGTGAGGCTCTGGCGAATGAATGTTTTCCATCGAAAGAAGGTGCTACTGCTCTGCGCTTAAACGAATTCTTTCTACGTCAGTTCTGCGATTCACACACTTGCGACGGAAGCGCAAAGCACTTCCCGAGGGGTTCTGGGAGAAGGAAGAACAAATCTTTATACATGGCTCTGTGTCTCTTCGTGATCATATTACTTGGAATATTTTACCTTGCAGTGTACTTATATCAAAGAGATATGAACGGCGATGCGTCAAGTCTAAAGCGGCTTAGACAGCATCCGATACTGAAAGCACAGAAGTCGAAGAAATTTTGA

Protein

>Mapoly0016s0064.1
MAILGNDRKRVLPLLLCLVVLALHVIDCSSAILDRRPVYDSRHEDENETQDGKVHCSRARSRTASQILDEYLLPFLEKEQYNLSSACRLNPENNMFKDQELQKDNVRPSQWQCLYCKKTFRSEDYLDKHMDNRHYAMLDLNSKRCLADICGAVHCDHADSVAKATTKKRCNRAAVIKNKHLCEALANECFPSKEGATALRLNEFFLRQFCDSHTCDGSAKHFPRGSGRRKNKSLYMALCLFVIILLGIFYLAVYLYQRDMNGDASSLKRLRQHPILKAQKSKKF

Mapoly0016s0064.2  

Gene structure:

mRNA scaffold_16:590217..594460  ( + strand )
five_prime_UTR scaffold_16:590217..590499  ( + strand )
five_prime_UTR scaffold_16:591080..591125  ( + strand )
CDS scaffold_16:591126..591224  ( + strand )
CDS scaffold_16:591489..591514  ( + strand )
CDS scaffold_16:591851..591935  ( + strand )
CDS scaffold_16:592195..592404  ( + strand )
CDS scaffold_16:592784..592912  ( + strand )
CDS scaffold_16:593175..593232  ( + strand )
CDS scaffold_16:593505..593578  ( + strand )
CDS scaffold_16:593850..593941  ( + strand )
CDS scaffold_16:594130..594211  ( + strand )
three_prime_UTR scaffold_16:594212..594460  ( + strand )

Sequences:

Gene

>Mapoly0016s0064.2
CTTGAGTCGAGAGTGAAGACCGCGAGTCATCGATCGATGCAGGCTTCAAGGTTTGGGCCGCCTGGCCTGCCTCGGGTCTCCCTTTTTCAGGCGGATTTCTGCACCCTCAGCGCGGTGTAATCAAGGTTTTCGATTTCTTTCGGTTGCAGCTCGGAGAATCAGGATTGTCCATCCAAGTTTTGTCGATACGGATGGTGTTTATTGTGGAAACTGAGTGTTGTAAGGGCCTCTGGAGGACCGTGATCTTGATTGCTGGATACGAGCATCCGCGTGGATCTTGAGGGTGATTTTTGTACTTTTGTAATTGAAGCTCGACTTTGTTTTGGGGCCAAATTTTTTTATTTCGTGATTCTTTTACTCCCTTGTGTCGGTGAATGACGTTCACAGCTGAGTAGAGCTGAAGAATTGAGCAATCGTAGTGTTTTGCGTTAAGTTCATCCCGGGGAGTTACACGTCCGATGGATTTGCGGATTCGAATTTCTTGAGTGGCTCAATTTGGAATTAATGATTCTGGGTTTGTTTGTCAACAATCAGAAAACTTTGGTGAGCTGTATTTCTGAGCAAGTAGTAGAAGACACAGAGGGCCAGATTTTCTCTCCCTCCCGCGTGACTGTAACAGGGTTCGTGAAGCATGCGTGGTTGGATTTTTTTTCTTTTTTCTGTAGTTCTGAACTGGAAATTTTGCGATATCCTTGGATATATCTAACAGATGGGGAGGGAATTCAAATAAATAATAATTTATAAATAAATAGATTCAAATGGAGTATTGTCTCATGCGCATGTTCGAGTTGGCGATCAGTGATTCAGTTGTGTGCTCTAATCGTCTCTAATTGAATCTAATGGATTTTTGGAAATTTTTGCAGAACTTTTATTTAGGGTCAAGAGAGTCAGCTGGATACCTGTTCCAACATGGCCATTCTTGGAAATGATAGAAAGAGGGTCTTGCCTCTATTATTATGTCTCGTCGTCCTCGCTTTGCACGTGATTGACTGCAGCTCGGCGATATTGGTAAACAAAGGCCTTCTGCTTTTGTCCCAATTCTCTTTCATCTGACTGAACCCCTAGTTTTTACTAGTTGCAGGTTGGTTTGTATAGAGATGGTCGATCAGTGCAGCTTTGAAGGAAACGACCGTTTAATTGCACAATGTAGTATGTTGCAATCGTTTTTGGAGAGTGAAGTCTCGGTTAACGGATGTTGCTGCACTCTTAGAAAATGACAGTGACTTCTATATATGTGCGTTAAGCTGACATAGCTTGTGATTCTATGTGCAGGATCGTCGACCAGTGTATGATTCAAGGTGCGATCATGTCACCAACTACAGTCCTCGTAATTGCAAAGATGTCCATGTGTTATGTTTTGTGATATTGTCGTCACCACCTCTTGTCCAAGGTTCAAACTAGAAAGTGCCCACTTCCCGATTGTGTATCTTTACTCTCATATACATGTCCGTGGGTACGCAGAATCATCTGCGCTCTGGTCAGATACCACACAATTGTAGACGATAATGCTATGCTGTCTGGGTTCCAAGCCGCATGAATGTAGCCTTTTGTATAATCAACGTATAATCATCAAACCTTGCCCAAATTATACTTCTCATCTATCCATAAAAGTACATCTGGCTGCCATTTCTCAGGCACGAGGACGAGAATGAGACTCAAGATGGTAAAGTGCATTGTTCAAGAGCAAGGAGCAGAACAGCTAGCCAAATACTTGACGAGGTAAATATCATGCACTTTTAACCTATGCGTTGTATGTTGTAACTTGAGTATTCAAAACCTCATGCACAATAACATCAACACTATTCATCATCAGGAGTTTCAACTGTAACGTAGTAGCCTCATACATCATAGCCATGTGAAACTATCACTTTTCATAAGTAGGTCATGATGAAGGACACACTGGTCAAGTTATGTACGATAATTGGACAAACTGACCAAATTTCGGCTCATGATGTTCGTGGTGTGGAGGATTCTGCAGTATTTGTTACCTTTCTTGGAGAAGGAGCAGTACAATCTGTCCAGCGCTTGCCGATTGAATCCTGAGAACAACATGTTCAAGGATCAAGAATTGCAAAAGGACAATGTACGCCCATCACAATGGCAATGTTTGTACTGCAAGAAAACTTTCCGATCGGAGGACTACCTGGACAAGCACATGGACAATCGTCACTACGCTATGCTTGATCTTGTAAGTACATCAATGGCCTTTCCACAAAACAGGTGAAACTGTTAAATCTTTGCTCAACAAGTTGGCGATATCAGATATTGTGCCATTTACTGTCCTTGCGTAGATTAGGATAGGAGTACTCTCATGATGTCCGCAACGTCTTGACAGCGGGCCTCGGCTGTCAATTCAAGGGGCTCGGTGGAATGTGTCAAGTCTGGATAATGATTCCTCCGAGAGTCAAAAGTTAGCACTTGTTTTTGACAACCTAATGGAGTCGGATTCCCTTGCTTGGTTTTTATTTGCAAAGAAAAGTTTAGGAAATAACATCAGTAGTTGATGAAAGAACGAGATCATCTGTATTCCCCTCTCTGACTTTTTTATTACTCTTGACGTTTTTCAGAATTCAAAGCGTTGCTTAGCAGACATTTGTGGTGCTGTACACTGTGATCATGCGGATAGTGTTGCGAAGGCAACGACGAAAAAGAGGTGCAATCGCGCAGCAGTGATCAAGAACAAGCATCTGTGTGAGGTCTTGTGTCCACAACCTACTTATGTTTTCGGTTTAGGACCTTTTTTTGAAGGTCGTATTTCTCCTGAACTTTTTTACCAAATTTCAAGCAACTCATGCGCACGTGAGAAAGATGGTGTGACGATAGCTACTGAAAGGTCAAAGCTGATCTTCAATCGTGATCGCCTTGGAATTTGGAAGATTCTTCCGCTTATCTAGAGAACTAAAAAACCGATATGTCAGAACTGCGACTTACCTTCAGAAGTGTGTTGTTTGATATCAGGCTCTGGCGAATGAATGTTTTCCATCGAAAGAAGGTGCTACTGCTCTGCGCTTAAACGGTATTTCATCTTGCTTGGTGTATACACGTAGAGCGAGATAAGCAGTGCAGTTTGATGATTCAAAATTCAGGCCCAATATCCATCTCACGTATATACAAGTAAACAATCTTATTATTGATAGCATAATGTAGGAAACATATGACTTCGGATGTATGTGATAAGTTGTCGTGTTTTGCTATGGTTGCTACTTGTCTATTGGTATGATGCTCTTCCATTACATTTAGGTGCTCTTAAAGTCATACCAACAGTAATTTTGTACATCTGGATTGCAGAATTCTTTCTACGTCAGTTCTGCGATTCACACACTTGCGACGGAAGCGCAAAGCACTTCCCGAGGGGTTCTGGGGTAACGACAGGACGTTAATACCTATAGCGAACTGAATCTTCCTATTTGAAGATTCAGTCTGTATTACACCGACAGAATTAGTCTTTTCTTGCTTTCCCCTAAACATCGGAAGTTGTAATATTTGTACTGAAAGCCCTTGCATGGATTTCTTTTCCTTTTCTCTCTACTAGTATCAATGTTTTCCTGAAGTTGCTTTACCGCATGATGAGAGGAAACTTGTACCTTCGAAACACTTGTATACCTTACCTTCCAAAAATCGTTGTGCTTGCAGAGAAGGAAGAACAAATCTTTATACATGGCTCTGTGTCTCTTCGTGATCATATTACTTGGAATATTTTACCTTGCAGTGTACTTATATCAAAGGTATGTGGGGCATCACCTGAATTTCATTCACCCTAGTCATGGGATTTGGAAAGGTATCAAAACAGTTATGTAGAATCAAGACAACCAAATCTCAACACGACAATCATGTAGGTCACTTTTGAGTGTATTTCGTATACGGCAGGTTGTTTTCACTCGATTAATGCCGTCTGCCATTTGTTGAACTGCAGAGATATGAACGGCGATGCGTCAAGTCTAAAGCGGCTTAGACAGCATCCGATACTGAAAGCACAGAAGTCGAAGAAATTTTGAAAGCTAACCGCAACTGTACATTAGACGATTGATTGTTTCGTTCTTAGAGATATCATGTGATTGTTGCTGTGTGCCACACGGATTTTAGCAAGTACAATTCCGAGTCATCATATTACGTCTGTGCAATGGTGTCACGCTTTGGCAATATTTGTCACTATAATTTAGCATCCAAATTCAAATGAGAGCCGTGAATCAACATTGCTACCATGTTCTTCGTGCATGAGAAATCTTCTCCACTGAGCCAGTTCC

mRNA

>Mapoly0016s0064.2
CTTGAGTCGAGAGTGAAGACCGCGAGTCATCGATCGATGCAGGCTTCAAGGTTTGGGCCGCCTGGCCTGCCTCGGGTCTCCCTTTTTCAGGCGGATTTCTGCACCCTCAGCGCGGTGTAATCAAGGTTTTCGATTTCTTTCGGTTGCAGCTCGGAGAATCAGGATTGTCCATCCAAGTTTTGTCGATACGGATGGTGTTTATTGTGGAAACTGAGTGTTGTAAGGGCCTCTGGAGGACCGTGATCTTGATTGCTGGATACGAGCATCCGCGTGGATCTTGAGGAACTTTTATTTAGGGTCAAGAGAGTCAGCTGGATACCTGTTCCAACATGGCCATTCTTGGAAATGATAGAAAGAGGGTCTTGCCTCTATTATTATGTCTCGTCGTCCTCGCTTTGCACGTGATTGACTGCAGCTCGGCGATATTGGATCGTCGACCAGTGTATGATTCAAGGCACGAGGACGAGAATGAGACTCAAGATGGTAAAGTGCATTGTTCAAGAGCAAGGAGCAGAACAGCTAGCCAAATACTTGACGAGTATTTGTTACCTTTCTTGGAGAAGGAGCAGTACAATCTGTCCAGCGCTTGCCGATTGAATCCTGAGAACAACATGTTCAAGGATCAAGAATTGCAAAAGGACAATGTACGCCCATCACAATGGCAATGTTTGTACTGCAAGAAAACTTTCCGATCGGAGGACTACCTGGACAAGCACATGGACAATCGTCACTACGCTATGCTTGATCTTAATTCAAAGCGTTGCTTAGCAGACATTTGTGGTGCTGTACACTGTGATCATGCGGATAGTGTTGCGAAGGCAACGACGAAAAAGAGGTGCAATCGCGCAGCAGTGATCAAGAACAAGCATCTGTGTGAGGCTCTGGCGAATGAATGTTTTCCATCGAAAGAAGGTGCTACTGCTCTGCGCTTAAACGAATTCTTTCTACGTCAGTTCTGCGATTCACACACTTGCGACGGAAGCGCAAAGCACTTCCCGAGGGGTTCTGGGAGAAGGAAGAACAAATCTTTATACATGGCTCTGTGTCTCTTCGTGATCATATTACTTGGAATATTTTACCTTGCAGTGTACTTATATCAAAGAGATATGAACGGCGATGCGTCAAGTCTAAAGCGGCTTAGACAGCATCCGATACTGAAAGCACAGAAGTCGAAGAAATTTTGAAAGCTAACCGCAACTGTACATTAGACGATTGATTGTTTCGTTCTTAGAGATATCATGTGATTGTTGCTGTGTGCCACACGGATTTTAGCAAGTACAATTCCGAGTCATCATATTACGTCTGTGCAATGGTGTCACGCTTTGGCAATATTTGTCACTATAATTTAGCATCCAAATTCAAATGAGAGCCGTGAATCAACATTGCTACCATGTTCTTCGTGCATGAGAAATCTTCTCCACTGAGCCAGTTCC

CDS

>Mapoly0016s0064.2
ATGGCCATTCTTGGAAATGATAGAAAGAGGGTCTTGCCTCTATTATTATGTCTCGTCGTCCTCGCTTTGCACGTGATTGACTGCAGCTCGGCGATATTGGATCGTCGACCAGTGTATGATTCAAGGCACGAGGACGAGAATGAGACTCAAGATGGTAAAGTGCATTGTTCAAGAGCAAGGAGCAGAACAGCTAGCCAAATACTTGACGAGTATTTGTTACCTTTCTTGGAGAAGGAGCAGTACAATCTGTCCAGCGCTTGCCGATTGAATCCTGAGAACAACATGTTCAAGGATCAAGAATTGCAAAAGGACAATGTACGCCCATCACAATGGCAATGTTTGTACTGCAAGAAAACTTTCCGATCGGAGGACTACCTGGACAAGCACATGGACAATCGTCACTACGCTATGCTTGATCTTAATTCAAAGCGTTGCTTAGCAGACATTTGTGGTGCTGTACACTGTGATCATGCGGATAGTGTTGCGAAGGCAACGACGAAAAAGAGGTGCAATCGCGCAGCAGTGATCAAGAACAAGCATCTGTGTGAGGCTCTGGCGAATGAATGTTTTCCATCGAAAGAAGGTGCTACTGCTCTGCGCTTAAACGAATTCTTTCTACGTCAGTTCTGCGATTCACACACTTGCGACGGAAGCGCAAAGCACTTCCCGAGGGGTTCTGGGAGAAGGAAGAACAAATCTTTATACATGGCTCTGTGTCTCTTCGTGATCATATTACTTGGAATATTTTACCTTGCAGTGTACTTATATCAAAGAGATATGAACGGCGATGCGTCAAGTCTAAAGCGGCTTAGACAGCATCCGATACTGAAAGCACAGAAGTCGAAGAAATTTTGA

Protein

>Mapoly0016s0064.2
MAILGNDRKRVLPLLLCLVVLALHVIDCSSAILDRRPVYDSRHEDENETQDGKVHCSRARSRTASQILDEYLLPFLEKEQYNLSSACRLNPENNMFKDQELQKDNVRPSQWQCLYCKKTFRSEDYLDKHMDNRHYAMLDLNSKRCLADICGAVHCDHADSVAKATTKKRCNRAAVIKNKHLCEALANECFPSKEGATALRLNEFFLRQFCDSHTCDGSAKHFPRGSGRRKNKSLYMALCLFVIILLGIFYLAVYLYQRDMNGDASSLKRLRQHPILKAQKSKKF

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>