Mapoly0019s0096



Description

Plant protein of unknown function (DUF822)

Reference DB

Database ID Description
OrthoMCL OG5_164694
PFAM PF05687 Plant protein of unknown function (DUF822)
PANTHER PTHR31506 FAMILY NOT NAMED
PANTHER PTHR31506:SF2

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpBZR2 transcription factor, BZR/BES Mapoly0019s0096.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0019s0096.1 scaffold_19:862705..865415  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0019s0096.1  

Gene structure:

mRNA scaffold_19:862705..865415  ( - strand )
three_prime_UTR scaffold_19:862705..863039  ( - strand )
three_prime_UTR scaffold_19:863225..863384  ( - strand )
CDS scaffold_19:863385..864383  ( - strand )
CDS scaffold_19:864631..864846  ( - strand )
five_prime_UTR scaffold_19:864847..865415  ( - strand )

Sequences:

Gene

>Mapoly0019s0096.1
CTCCCTCCCTCCTCTCTCTCTCTCTCTCTCTCCCCGTCTCTCCCTCGGACATCAATAAACTAAACGCATCGTCTTCCGCCCACGACAGAGTCTTTCAGTCGGTCGTTCGTTCGAGGAAGTGTCGATCAGTTGCGCACCAGTAATTTCGTATTGCAGATCAGTCTCCTGCCTTCTCGCGGTTGGAGTTGCGCGCGAGAGCTCCGGACACGTCAGCTGCTGCTGCTGCAGCTCGCCCGAGCTCGTGCCTGCGGGAGCCGAGTAGGTGACAGCAAAAGAACAATTTGCGCCCACGGCTTTCGGAGAAGAAGTCGCGCGTCGCTCGCCGACTGCTGCTGCCCATTGGGGTCGATCTCGGTCTGCGAGGGTGTCGAGGGTCGTCTCTCTTGCTCTCGCTCTCTCTCGAGCGAGGTGTCGGTCGATCTTGCGCGGCGGCGTCCGAGCGGGGCACAGGCTGGGCTCCGGCGAAGCTATGGAGTCGTAGGAAGCGCTGGACGCTGCGGTGTAGATGGTGCTGGTGATCCCCGGGGGAATCCACGATAGCCTAGAGGTTTTTTAGAGTTTTTGTCGAAATGACGTCGGGCACTCGCCTGCCGACATGGAAGGAGAGAGAGAATAATAAACGACGCGAAAGACGCAGGCGCGCCATCGCTGCGAAGATCTTTCTTGGGCTCAGGTTGTATGGCAACTACAAGCTGCCGAAACACTGCGACAACAACGAGGTTCTCAAGGCCCTCTGCGCGGAGGCTGGCTGGACAGTGGAAGAAGACGGAACCACGTATCGAAAGGTACGCCCCTCCCTTCCCACTCCTCCCTCGTCGCCCAACCAGGCGTGTGTCAATGTCGCAAGGAGTGAGCAGGAAGTAGGAGAGCTTGGCTACGAAGGCCGTGTATATACTCGCGCTGTGGAGAAGATTCTGCTCTTTGCCTTGACTGTGGGAGGTGTTGTGACTGTCGTGAATGCTGATCGATCTTTCTGTGTGATTTCGGGAGCTTAATTGCGATGTGTCGTGTGGGTGTGTGTGCATCTGGCAGGGCACGAAACCGGCCGCGGAGCGAATGGATGTGTGCACGTCGCCATCGACGAGCCCCACCTCGTCGTACCCCGGCGCCAACGAGGGCACGTCGCTGATACCATGGCTCAAAGGGCTCTCGTCGGTGAACGGACAGATTGTCGGGGGCAGCGGGGGAGGCAGCGGCACTGCCAGCACCAGCAGCAGCACGGGGCTGCCGCCGCTGCACGCCATGCACGGGGGGCCTTCGAGCGCGCCCATGACGCCTCCGCTGAGCTCGCCCACGGCGCGGATGCCGCACGTGAAGCCCGAGTGGGACAAGTCGAACGACGACATCCCCTCGGCCTTTTGCGCCGCCGTGAGCGCCTGGACGCAGCCGCACTTCCTCGCGGGCGCCAGCGGCGGCGCCAGCGCGGGGCCGCCCCCGTTGCGCCCCGTGTGCGAATCGTCGGACGTGTGCCGGGGCTCGCCCTCGGACGGCGGGGACTCCGATCCGAGCCCCAGCGCCGTGCTCGAATTCGTCAGCGGGTGCAACAACAGCGGCAAGTGGACCAACGGCGTGCGCGTGCGCAGTGTGTCGCAGGCCGGCTCGGCGCTGGGGCTGTCGGGCTCGGCCTCGCGCTTCCCCGGGGGCATGGGGCTGGGGCCTTTCCCGAGCTCGCGCGCCGACTCGGGCAACGAGCCCTTCAGCACCTTCCCCTGCTCGCGCGCCGACTCCGGCAACGAGCCCCTCTCGGGGGCCTGGCGCCCGGGGCACGTGCAGTCGCCGCTGGTGCAGAGCCCGTCGACCAGCATCAGCGCCGTGCTCGATTCGGGCAAGCGCGGCGGCAGCAGCCAAGAAGGCCTCGGGAAAGGATTGGATCTGGAAATGTCAAGCTCGGCCCAGGTTGTGTCCAGTCGGCCCTCGGGCTGGGAGGTCGACCGCCTGTGCGACGACATGGAGAAGAAAGACGATCTGGAGTTGACGCTAGGAAGCTCAACTTTGCGAGTGAAAGTCAAGTCGGAACCGCGATGTCGATAGGTATATCTGGGGATGCGCCGGACCCCTAGTTTTGTAACAAAGATAGCGGGTTAGAGTAGACGAGATCTGGGGCGCTGTCACTTCCATCAGGCAGACTGGCACCCGATGCCTCCAAATTTTGTAACGACGAATGCATTGTCCCGTGCAATGTGTTTGCTAGGTACGCCTCGCTCTCGCTCTCCCTCTCTTTCGTTCTCGCTCATCTTCGTCATTTTCTCCTTCTCCCTCTCGCTCGTTTGCGCTCGCTTTCGTCGATGTCGACGTCTAGCGCCACCGATCTGTGCTCGGACGCCAATTCACGCCCATCTCGTGCGGTTGTGCTGATTGTGGCGTGTCTGTCCGCAGGTATAGGAAGTGGCGTTGTGCTTCCGTCCAGCCCATAATGCAGAGAACCTTGCTTCCCCCAACATGGATAGTTCCAATGGCAGAGGCTACACGATGGATCGATGGACGCTCACCGGAGTTCTTCCTGTAGTGCTTGGAAACACCGTGAGCATGTTCACTTTCATGTACCATAGTAGATCGTTAAGCCAACTTGGTCTTCCCTAAAACAAAAGCTTGACTACGCTTGGCCGCGTGCAGGACTACTCACTTCAGCGCTTGTTTCCAAAGGCTCTGACATAAACTTGTCTTTATATTTTGGTGGAAGAGTTTTCACTAGTTATGGTCAATCAATCTCT

mRNA

>Mapoly0019s0096.1
CTCCCTCCCTCCTCTCTCTCTCTCTCTCTCTCCCCGTCTCTCCCTCGGACATCAATAAACTAAACGCATCGTCTTCCGCCCACGACAGAGTCTTTCAGTCGGTCGTTCGTTCGAGGAAGTGTCGATCAGTTGCGCACCAGTAATTTCGTATTGCAGATCAGTCTCCTGCCTTCTCGCGGTTGGAGTTGCGCGCGAGAGCTCCGGACACGTCAGCTGCTGCTGCTGCAGCTCGCCCGAGCTCGTGCCTGCGGGAGCCGAGTAGGTGACAGCAAAAGAACAATTTGCGCCCACGGCTTTCGGAGAAGAAGTCGCGCGTCGCTCGCCGACTGCTGCTGCCCATTGGGGTCGATCTCGGTCTGCGAGGGTGTCGAGGGTCGTCTCTCTTGCTCTCGCTCTCTCTCGAGCGAGGTGTCGGTCGATCTTGCGCGGCGGCGTCCGAGCGGGGCACAGGCTGGGCTCCGGCGAAGCTATGGAGTCGTAGGAAGCGCTGGACGCTGCGGTGTAGATGGTGCTGGTGATCCCCGGGGGAATCCACGATAGCCTAGAGGTTTTTTAGAGTTTTTGTCGAAATGACGTCGGGCACTCGCCTGCCGACATGGAAGGAGAGAGAGAATAATAAACGACGCGAAAGACGCAGGCGCGCCATCGCTGCGAAGATCTTTCTTGGGCTCAGGTTGTATGGCAACTACAAGCTGCCGAAACACTGCGACAACAACGAGGTTCTCAAGGCCCTCTGCGCGGAGGCTGGCTGGACAGTGGAAGAAGACGGAACCACGTATCGAAAGGGCACGAAACCGGCCGCGGAGCGAATGGATGTGTGCACGTCGCCATCGACGAGCCCCACCTCGTCGTACCCCGGCGCCAACGAGGGCACGTCGCTGATACCATGGCTCAAAGGGCTCTCGTCGGTGAACGGACAGATTGTCGGGGGCAGCGGGGGAGGCAGCGGCACTGCCAGCACCAGCAGCAGCACGGGGCTGCCGCCGCTGCACGCCATGCACGGGGGGCCTTCGAGCGCGCCCATGACGCCTCCGCTGAGCTCGCCCACGGCGCGGATGCCGCACGTGAAGCCCGAGTGGGACAAGTCGAACGACGACATCCCCTCGGCCTTTTGCGCCGCCGTGAGCGCCTGGACGCAGCCGCACTTCCTCGCGGGCGCCAGCGGCGGCGCCAGCGCGGGGCCGCCCCCGTTGCGCCCCGTGTGCGAATCGTCGGACGTGTGCCGGGGCTCGCCCTCGGACGGCGGGGACTCCGATCCGAGCCCCAGCGCCGTGCTCGAATTCGTCAGCGGGTGCAACAACAGCGGCAAGTGGACCAACGGCGTGCGCGTGCGCAGTGTGTCGCAGGCCGGCTCGGCGCTGGGGCTGTCGGGCTCGGCCTCGCGCTTCCCCGGGGGCATGGGGCTGGGGCCTTTCCCGAGCTCGCGCGCCGACTCGGGCAACGAGCCCTTCAGCACCTTCCCCTGCTCGCGCGCCGACTCCGGCAACGAGCCCCTCTCGGGGGCCTGGCGCCCGGGGCACGTGCAGTCGCCGCTGGTGCAGAGCCCGTCGACCAGCATCAGCGCCGTGCTCGATTCGGGCAAGCGCGGCGGCAGCAGCCAAGAAGGCCTCGGGAAAGGATTGGATCTGGAAATGTCAAGCTCGGCCCAGGTTGTGTCCAGTCGGCCCTCGGGCTGGGAGGTCGACCGCCTGTGCGACGACATGGAGAAGAAAGACGATCTGGAGTTGACGCTAGGAAGCTCAACTTTGCGAGTGAAAGTCAAGTCGGAACCGCGATGTCGATAGGTATATCTGGGGATGCGCCGGACCCCTAGTTTTGTAACAAAGATAGCGGGTTAGAGTAGACGAGATCTGGGGCGCTGTCACTTCCATCAGGCAGACTGGCACCCGATGCCTCCAAATTTTGTAACGACGAATGCATTGTCCCGTGCAATGTGTTTGCTAGGTATAGGAAGTGGCGTTGTGCTTCCGTCCAGCCCATAATGCAGAGAACCTTGCTTCCCCCAACATGGATAGTTCCAATGGCAGAGGCTACACGATGGATCGATGGACGCTCACCGGAGTTCTTCCTGTAGTGCTTGGAAACACCGTGAGCATGTTCACTTTCATGTACCATAGTAGATCGTTAAGCCAACTTGGTCTTCCCTAAAACAAAAGCTTGACTACGCTTGGCCGCGTGCAGGACTACTCACTTCAGCGCTTGTTTCCAAAGGCTCTGACATAAACTTGTCTTTATATTTTGGTGGAAGAGTTTTCACTAGTTATGGTCAATCAATCTCT

CDS

>Mapoly0019s0096.1
ATGACGTCGGGCACTCGCCTGCCGACATGGAAGGAGAGAGAGAATAATAAACGACGCGAAAGACGCAGGCGCGCCATCGCTGCGAAGATCTTTCTTGGGCTCAGGTTGTATGGCAACTACAAGCTGCCGAAACACTGCGACAACAACGAGGTTCTCAAGGCCCTCTGCGCGGAGGCTGGCTGGACAGTGGAAGAAGACGGAACCACGTATCGAAAGGGCACGAAACCGGCCGCGGAGCGAATGGATGTGTGCACGTCGCCATCGACGAGCCCCACCTCGTCGTACCCCGGCGCCAACGAGGGCACGTCGCTGATACCATGGCTCAAAGGGCTCTCGTCGGTGAACGGACAGATTGTCGGGGGCAGCGGGGGAGGCAGCGGCACTGCCAGCACCAGCAGCAGCACGGGGCTGCCGCCGCTGCACGCCATGCACGGGGGGCCTTCGAGCGCGCCCATGACGCCTCCGCTGAGCTCGCCCACGGCGCGGATGCCGCACGTGAAGCCCGAGTGGGACAAGTCGAACGACGACATCCCCTCGGCCTTTTGCGCCGCCGTGAGCGCCTGGACGCAGCCGCACTTCCTCGCGGGCGCCAGCGGCGGCGCCAGCGCGGGGCCGCCCCCGTTGCGCCCCGTGTGCGAATCGTCGGACGTGTGCCGGGGCTCGCCCTCGGACGGCGGGGACTCCGATCCGAGCCCCAGCGCCGTGCTCGAATTCGTCAGCGGGTGCAACAACAGCGGCAAGTGGACCAACGGCGTGCGCGTGCGCAGTGTGTCGCAGGCCGGCTCGGCGCTGGGGCTGTCGGGCTCGGCCTCGCGCTTCCCCGGGGGCATGGGGCTGGGGCCTTTCCCGAGCTCGCGCGCCGACTCGGGCAACGAGCCCTTCAGCACCTTCCCCTGCTCGCGCGCCGACTCCGGCAACGAGCCCCTCTCGGGGGCCTGGCGCCCGGGGCACGTGCAGTCGCCGCTGGTGCAGAGCCCGTCGACCAGCATCAGCGCCGTGCTCGATTCGGGCAAGCGCGGCGGCAGCAGCCAAGAAGGCCTCGGGAAAGGATTGGATCTGGAAATGTCAAGCTCGGCCCAGGTTGTGTCCAGTCGGCCCTCGGGCTGGGAGGTCGACCGCCTGTGCGACGACATGGAGAAGAAAGACGATCTGGAGTTGACGCTAGGAAGCTCAACTTTGCGAGTGAAAGTCAAGTCGGAACCGCGATGTCGATAG

Protein

>Mapoly0019s0096.1
MTSGTRLPTWKERENNKRRERRRRAIAAKIFLGLRLYGNYKLPKHCDNNEVLKALCAEAGWTVEEDGTTYRKGTKPAAERMDVCTSPSTSPTSSYPGANEGTSLIPWLKGLSSVNGQIVGGSGGGSGTASTSSSTGLPPLHAMHGGPSSAPMTPPLSSPTARMPHVKPEWDKSNDDIPSAFCAAVSAWTQPHFLAGASGGASAGPPPLRPVCESSDVCRGSPSDGGDSDPSPSAVLEFVSGCNNSGKWTNGVRVRSVSQAGSALGLSGSASRFPGGMGLGPFPSSRADSGNEPFSTFPCSRADSGNEPLSGAWRPGHVQSPLVQSPSTSISAVLDSGKRGGSSQEGLGKGLDLEMSSSAQVVSSRPSGWEVDRLCDDMEKKDDLELTLGSSTLRVKVKSEPRCR

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>