Mapoly0019s0144



Description

TRANSCRIPTION FACTOR NF-Y ALPHA-RELATED

Reference DB

Database ID Description
GO GO:0003700 Sequence-specific DNA binding transcription factor activity
GO GO:0006355 Regulation of transcription, DNA-dependent
OrthoMCL OG5_129105
PFAM PF02045 CCAAT-binding transcription factor (CBF-B/NF-YA) subunit B
PANTHER PTHR12632 TRANSCRIPTION FACTOR NF-Y ALPHA-RELATED
PANTHER PTHR12632:SF7

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpCCAAT-NFYA transcription factor, CCAAT-NFYA Mapoly0019s0144.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0019s0144.1 scaffold_19:1271114..1274172  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0019s0144.1  

Gene structure:

mRNA scaffold_19:1271114..1274172  ( + strand )
five_prime_UTR scaffold_19:1271114..1271643  ( + strand )
five_prime_UTR scaffold_19:1271883..1272044  ( + strand )
CDS scaffold_19:1272045..1272060  ( + strand )
CDS scaffold_19:1272154..1272263  ( + strand )
CDS scaffold_19:1272394..1272474  ( + strand )
CDS scaffold_19:1272559..1272729  ( + strand )
CDS scaffold_19:1272826..1272961  ( + strand )
CDS scaffold_19:1273073..1273209  ( + strand )
three_prime_UTR scaffold_19:1273210..1274172  ( + strand )

Sequences:

Gene

>Mapoly0019s0144.1
CAAACCACTGCTCGGGCACTGGGCTCTTCGATACTTGTCTTGGGCCGGGCTGACTGGGGCTGGCCTGCAGTGTTTCCCTCCTCGCTCGCTCTTGTCTGCTCGTCTCGCTCTCAGGGCCTGCTTTCCTTTCCCTCTCCCCCCCAACCCTTCCCTCCCTCCCTCTCCCCTCTTCCCCTCGCCCTCCCTCCTCCCCTTTTCCCTCCCAGCCCCGCCTGCCTGCCTGCCTTCCAGCCGCGACCCCCACCACCTTTGCCCGCAGTGAGAGATTGCGTTGTGTTATGTTGCTCTTCTTCTTGTTCGACCCTCCGGCCCTCTCAAGGATTTGCCTCGACACCGCGGAGCGAGCACGCGCACAGTGGAGTGGTGTGAATAAGGAAAGGCGCGACGCAGTGGAGTGAAGGGATGGAAGGCGAATAGGAGTAGGAGCAGAAGTAGCAGACGAAACCCCGGGCGTCCGAGGCGACGACGACGTTGCCGACGTCGGCGAAGAGCAGCTTAGTGTAGTGAGGAACAGGTGGTCGGGCGTTTTGGTGAGTAAGATCGCTGGGTGGTGCTCGCCTCGCGATCGGAGAGTGGTCGCAGGAAGTGCCTCCCCTGCTGTTTGTGTCGATTCTTGCTTTATAGCGGGTAGGAGATAAGGTTCCTCTGTCGCCGCAGGCATCGGGTGCAGTGGCTGTTTGCATGCAGCTCTCTAAGCAATTGAACCGTTGCGTCGGGTGGTGCATTTTTAACATCGTTGTGACATCGTTCGTGTTCTGCGGTGCGTCAGGTGTACCGGGTACCTCCGTTGGAGCTTTATCTTCCTCGACTTGCCTCGAGTTTAAACGAGGTCAATTACAATCCAGGGAACTTCGTAGTAGGTTTCGGCAGGCGACCTCGCTCCTCTGCCCTCTTGCCCTCTGGCCTGTCTCTCGGACGGCCACCTTCCAGAATGCTCCCACAGCCAGGTCAGTCTCCCGCAGCATGTTCTTAGTCGCACTCGGTTCTCTTTGCTCAAGCTGGCAAGTCTAGTGGACTAAACCCGGATTACTTTTGTGTAGGGTTTGATAGCAGTGAAGCAGAAACTCAGCAACAAGCCCAATCTGCAGGCATTCCAGTCCAGGGTGAATACATGTTGCCACACACCCAATTAGAGCTCGGCCACTCCATGGTACGTGGTTCCTCACCCTCGTGTTCCGTTTTGTCTTTCCCTCCTTCCCTTTCGATATCCTCATCCCGATCGGATCCCCACCCCCGTTCTCCCACTGAGTTTATCGAATGTTTCTTTCTGGTGTGTGCAGGCTCAGCAGGGTGGACGACAGTTTCCTTTCGCAGATCCTTATTTCGGGGGGATAGTTGCGGCATATGGTCCTCAGGCGATGGTCAGTACATTCCCTTTTACGCTTACATGTCTTCCTTTCCCATGTTTCTCGGTAATGTGTTGAAATCAATTTTCTTGTGAACAGATCCATCCGCATATGTTGGGGGTGCAACAAGCTCGTATGCCTTTACCGTCGTCAGAGTTGATGGAGGAAGAACCAGTCTATGTTAACGCAAAACAATATCATGGTATCTTAAGGCGCAGGCAATCGCGTGCCAAGGCGGAGTCCGAGAACAAGTTAATAAAGTCCAGGAAGGTAATTCAAACGTTCTTTCATTTTTGTACTTTCGTTACTGGAGTCTACGGTGGAGGCGTCTTCCGTATGGTCTTACCGTCCTATTTATTGATGCAGCCTTATCTGCACGAGTCTCGTCATCTGCACGCTCTGAGAAGAGCCCGCGGTTGCGGAGGAAGGTTTCTCAACACAAAATTGAAGGAAGATTCGAAAGGCGAGAACCACAGATCGACTGAAGGACAATCGTCCGAAGGTACCGATTCTCAGGCCTCTCACTCAGGCCAGGGGCTGATATCTGATGGAGGAATGGCACAGTATCACGCGGGAATTTTGACCCACACTGGGCATGTGGGTATGATTTCAGGGAATTCGTCCGGAGGTTACCACAGTCACCATCAGCCTCAGGGATTTCACTCGTCAGCTTTTCATCCTCTGCCTGGAGGAGGAGATGGGAACGACAGCGCGCAAAGTTCCCAACAGACAGCCGTGGCGACTCAATGAAGCCGCGGCCCAATGAAGTGTGGGCGAGGTGTTGGGGTGAGGTTTGGACGAGCACCCACAAGGCACCTTGAGATGTAAAATGTGTTGACGTCTAGTATTGATGTCTTCTCTCAACCTGAATTATCATCCACTCGATCGACAGTCAAATGTTGGGGTCTGGGCGATGTCCTTTCGATCATCGCCCATCAGTTCAATGTTTGATTCGAGTTGCAGATAGTGTTACAGCCTTGAAAGCAGTATATGGGAGGTGTGGTCTCTCTTGGTTTAGGATTATAGGTTCTTGCATTTTTGTTAACAGCAAGAGCCTATAATAGACCAAATTCCCGATTTCAATGAGGGCAGAGAGTCTGCAACATGCAGCGCAAGCACATTTCGGAGCTGAGCTGAGACGGTGTTGTAGTCTGCACCTTACTGTTCCAGATCCAGGAATGGTGTCAAATATGTGATGGAGGTTGACCCTCAGTTGGAGATGGTGGTTGTCAGGAGAGAAAAATGTCCGAGGTCAGTTTTGAGTTAAGCCAAAGTTTTTTTTACCTGTTTTTTTTTCCCAAAACTTTCTTAATTTCGAAGGTTCTTTTTTCCTTTCTCCGAAATAGTGTAGAGCTGGTAGAGTGAGGTATCCACCTCTTGGTCGTACACCACCTGGTTCTAGATTCAGGGACATGACCTGTGTAGAGGTCTCTTGTACATTGGTAGAAGTAGTGTTATGTCCCTTGATGGTTTATACACAGAATTCAGGGAGGAGTGTCAAATTCGACTTTGGAGTAGATGTAGACTTGTGTTGCGTTTTCTCTTCTGTACGTTTATGGAGAGGGTGAAGTGCACCCCATGTGAGAGGCACAGGTGTTTTGAGAGGCAACGCCGTCTTTCTTTCCCTGCAAATGAGTTGTACAAAAAATGGCGACAAGCGCCTCCTTTTTTAATACAGTTTCTGTAAATTTTTCTGATATACATTGCAATCAA

mRNA

>Mapoly0019s0144.1
CAAACCACTGCTCGGGCACTGGGCTCTTCGATACTTGTCTTGGGCCGGGCTGACTGGGGCTGGCCTGCAGTGTTTCCCTCCTCGCTCGCTCTTGTCTGCTCGTCTCGCTCTCAGGGCCTGCTTTCCTTTCCCTCTCCCCCCCAACCCTTCCCTCCCTCCCTCTCCCCTCTTCCCCTCGCCCTCCCTCCTCCCCTTTTCCCTCCCAGCCCCGCCTGCCTGCCTGCCTTCCAGCCGCGACCCCCACCACCTTTGCCCGCAGTGAGAGATTGCGTTGTGTTATGTTGCTCTTCTTCTTGTTCGACCCTCCGGCCCTCTCAAGGATTTGCCTCGACACCGCGGAGCGAGCACGCGCACAGTGGAGTGGTGTGAATAAGGAAAGGCGCGACGCAGTGGAGTGAAGGGATGGAAGGCGAATAGGAGTAGGAGCAGAAGTAGCAGACGAAACCCCGGGCGTCCGAGGCGACGACGACGTTGCCGACGTCGGCGAAGAGCAGCTTAGTGTAGTGAGGAACAGGTGGTCGGGCGTTTTGGTGTACCGGGTACCTCCGTTGGAGCTTTATCTTCCTCGACTTGCCTCGAGTTTAAACGAGGTCAATTACAATCCAGGGAACTTCGTAGTAGGTTTCGGCAGGCGACCTCGCTCCTCTGCCCTCTTGCCCTCTGGCCTGTCTCTCGGACGGCCACCTTCCAGAATGCTCCCACAGCCAGGGTTTGATAGCAGTGAAGCAGAAACTCAGCAACAAGCCCAATCTGCAGGCATTCCAGTCCAGGGTGAATACATGTTGCCACACACCCAATTAGAGCTCGGCCACTCCATGGCTCAGCAGGGTGGACGACAGTTTCCTTTCGCAGATCCTTATTTCGGGGGGATAGTTGCGGCATATGGTCCTCAGGCGATGATCCATCCGCATATGTTGGGGGTGCAACAAGCTCGTATGCCTTTACCGTCGTCAGAGTTGATGGAGGAAGAACCAGTCTATGTTAACGCAAAACAATATCATGGTATCTTAAGGCGCAGGCAATCGCGTGCCAAGGCGGAGTCCGAGAACAAGTTAATAAAGTCCAGGAAGCCTTATCTGCACGAGTCTCGTCATCTGCACGCTCTGAGAAGAGCCCGCGGTTGCGGAGGAAGGTTTCTCAACACAAAATTGAAGGAAGATTCGAAAGGCGAGAACCACAGATCGACTGAAGGACAATCGTCCGAAGGGAATTCGTCCGGAGGTTACCACAGTCACCATCAGCCTCAGGGATTTCACTCGTCAGCTTTTCATCCTCTGCCTGGAGGAGGAGATGGGAACGACAGCGCGCAAAGTTCCCAACAGACAGCCGTGGCGACTCAATGAAGCCGCGGCCCAATGAAGTGTGGGCGAGGTGTTGGGGTGAGGTTTGGACGAGCACCCACAAGGCACCTTGAGATGTAAAATGTGTTGACGTCTAGTATTGATGTCTTCTCTCAACCTGAATTATCATCCACTCGATCGACAGTCAAATGTTGGGGTCTGGGCGATGTCCTTTCGATCATCGCCCATCAGTTCAATGTTTGATTCGAGTTGCAGATAGTGTTACAGCCTTGAAAGCAGTATATGGGAGGTGTGGTCTCTCTTGGTTTAGGATTATAGGTTCTTGCATTTTTGTTAACAGCAAGAGCCTATAATAGACCAAATTCCCGATTTCAATGAGGGCAGAGAGTCTGCAACATGCAGCGCAAGCACATTTCGGAGCTGAGCTGAGACGGTGTTGTAGTCTGCACCTTACTGTTCCAGATCCAGGAATGGTGTCAAATATGTGATGGAGGTTGACCCTCAGTTGGAGATGGTGGTTGTCAGGAGAGAAAAATGTCCGAGGTCAGTTTTGAGTTAAGCCAAAGTTTTTTTTACCTGTTTTTTTTTCCCAAAACTTTCTTAATTTCGAAGGTTCTTTTTTCCTTTCTCCGAAATAGTGTAGAGCTGGTAGAGTGAGGTATCCACCTCTTGGTCGTACACCACCTGGTTCTAGATTCAGGGACATGACCTGTGTAGAGGTCTCTTGTACATTGGTAGAAGTAGTGTTATGTCCCTTGATGGTTTATACACAGAATTCAGGGAGGAGTGTCAAATTCGACTTTGGAGTAGATGTAGACTTGTGTTGCGTTTTCTCTTCTGTACGTTTATGGAGAGGGTGAAGTGCACCCCATGTGAGAGGCACAGGTGTTTTGAGAGGCAACGCCGTCTTTCTTTCCCTGCAAATGAGTTGTACAAAAAATGGCGACAAGCGCCTCCTTTTTTAATACAGTTTCTGTAAATTTTTCTGATATACATTGCAATCAA

CDS

>Mapoly0019s0144.1
ATGCTCCCACAGCCAGGGTTTGATAGCAGTGAAGCAGAAACTCAGCAACAAGCCCAATCTGCAGGCATTCCAGTCCAGGGTGAATACATGTTGCCACACACCCAATTAGAGCTCGGCCACTCCATGGCTCAGCAGGGTGGACGACAGTTTCCTTTCGCAGATCCTTATTTCGGGGGGATAGTTGCGGCATATGGTCCTCAGGCGATGATCCATCCGCATATGTTGGGGGTGCAACAAGCTCGTATGCCTTTACCGTCGTCAGAGTTGATGGAGGAAGAACCAGTCTATGTTAACGCAAAACAATATCATGGTATCTTAAGGCGCAGGCAATCGCGTGCCAAGGCGGAGTCCGAGAACAAGTTAATAAAGTCCAGGAAGCCTTATCTGCACGAGTCTCGTCATCTGCACGCTCTGAGAAGAGCCCGCGGTTGCGGAGGAAGGTTTCTCAACACAAAATTGAAGGAAGATTCGAAAGGCGAGAACCACAGATCGACTGAAGGACAATCGTCCGAAGGGAATTCGTCCGGAGGTTACCACAGTCACCATCAGCCTCAGGGATTTCACTCGTCAGCTTTTCATCCTCTGCCTGGAGGAGGAGATGGGAACGACAGCGCGCAAAGTTCCCAACAGACAGCCGTGGCGACTCAATGA

Protein

>Mapoly0019s0144.1
MLPQPGFDSSEAETQQQAQSAGIPVQGEYMLPHTQLELGHSMAQQGGRQFPFADPYFGGIVAAYGPQAMIHPHMLGVQQARMPLPSSELMEEEPVYVNAKQYHGILRRRQSRAKAESENKLIKSRKPYLHESRHLHALRRARGCGGRFLNTKLKEDSKGENHRSTEGQSSEGNSSGGYHSHHQPQGFHSSAFHPLPGGGDGNDSAQSSQQTAVATQ

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>