Mapoly0020s0013



Description

Myb-like DNA-binding domain

Reference DB

Database ID Description
GO GO:0003682 Chromatin binding
OrthoMCL OG5_147226
PFAM PF00249 Myb-like DNA-binding domain
PANTHER PTHR25040 FAMILY NOT NAMED
PANTHER PTHR25040:SF137

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
Mp1R-MYB7 transcription factor, MYB Mapoly0020s0013.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0020s0013.1 scaffold_20:182019..186236  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0020s0013.1  

Gene structure:

mRNA scaffold_20:182019..186236  ( + strand )
five_prime_UTR scaffold_20:182019..183484  ( + strand )
CDS scaffold_20:183485..183767  ( + strand )
CDS scaffold_20:184164..184372  ( + strand )
CDS scaffold_20:184544..185215  ( + strand )
three_prime_UTR scaffold_20:185216..186236  ( + strand )

Sequences:

Gene

>Mapoly0020s0013.1
CATCATCGTCCGCTCTCCCCTTCTTCCTCTCGCCCTCGACCGATCCAGTTTCATTCGTTCGCTCTCTCGCCCTCCTCCCTTCGTACCCTCGCCCTCCTCCTCCTCCCCTCCTCCTCCTTCATAAGGCCCTCCCTCCCGTCGTGTGTGCGCGGAACGCTCACTCTGCTTGTGCACTGCTGTCGTAGTCGCTGCTGTGCAGGGCCCAGTTTGCGCGTCGAGTCGAGTAGTAGTTGTTCTCTGTTCAACCATTCCTTCTCTATCTCTCTCTTTCTTTCTCCTCCTCGATCTCTCTCTCTCTCTCTCTCGCGCGCGCTCTCTCTCTTTCTCGGTCTCTTTGCTTGCGCGATAGCATCTTGCTTCGATCTGTAATTTCTCTTGACATCTTTCTCGTTCGATACCATCATTATTATCAACCCACAACACCATCACCACCAACCATCCAGTCGTGGGCTTGGGCCGTCGTGTCGTGACGAGCTCGGTCGGTCGGGTTCGTTCGAGGTCTGTGATAAAAGATTCTTCCGGCTCTCGAGATCGTTCGAAGGTCGCGCGAGTGAGTCTTGCTACGACTCCTGGTGGTCAGATCCGTGGGGTTTGAGTCGAGGCTTGGACAAAGAGAAGCGTAGTTGAGGCGTCGGTAGTGGAGGTTGGAGGTTATCAGAGCGTGGACGGGAGGAAGAGGACTCACTCAATAGGTTGCAAGGATATCGGGAAAGGAATAAAGGAGGAAGAGAAGACGAGATAGGAAGAGAACGAACGAAGCCCGGTCCTGTCGTGGTCTGCTGTCGGTGGGGCTTCGAGTCTTGTTCGTTCGGTCGGTCGGTTGCTCGAAAGGCGGTAAGGAAGTGCAACAAAAGGGAGAAAGGAAAGGAAAAGTAGCGACGAGTAGACGAGGGAGATAGCGCGAGAAGGAAGTCCCGCTCCGCATCGTTTTCTTGTGCTGTCTTGAGAGAGGGAGCATCGGTTGTGATCGGTTTCTGGCTTCGGGCTTTATACCACGTGGTTGCTTCTTCGAGTTCTCTCTCAGATCCTACGTCTTTCTTGTCCTGCGACTTGGAAGCCACGGATTTCGGTTTCATCGGCGGGCACGTGTTTGCTCTCTTTCTCTCCCTCTCTCACTGCTCCAAGGGGCATATGCTCTCGCCTGCTGTCCTCCGTCCTCGTGGTGACATCTAATTCGAATCGGGTTCCTCTCGGTGTCCCACTCTTCGCGGATCTGCTCTCTCGTTGCCAGTGTGAACAGGCGCCGGTGCCCTCATCCATCTGCGTTCACAACAGACGACTCGTGAACCGGAAGAGAACGGAGCCGCACCGACCTTGTGCAGTTCGCTCCTCGTGCTCTACATCACACGATTTCTCCATCGTCTTCCCAGTCAGTAAAAATAGACCCATTCAAGTTACCACCGGTCGCTGTGGCTAACTTACGTATTCCTTCGGGGCGATCAGGGCCAGAAGAACTGGAGACCGAAATGACTCGCCGTTGCTCCCACTGTGGTCATAATGGGCACAATTCTCGTACGTGTCCCGATCGTTGTCCTGATCGGGGGGTACGGTTATTTGGTGTTCGACTCACAACGAACGATGGTGCAGCGAACATGCGTAAGAGTGTCAGCATGGGCAATTTGACGCATTATGCCAACGCCAGCAACCCTCCATCCACCCCCGAGCATTCGGAGTCCGGAGCTGGTGCTGAGGGATACGTTTCAGACGGCCTCGTGCAGACTTCCAGCAACGCTCGCGAAAGAAAGAAAGGTGGGTTTCCATGGCCCTTTTGATGTTTCAATTTCCAGCCAAGGACATTTCTCGAGAGTAGACGAAGAGCCTTCAACCTAAGACCGCCAGCATGTTTTCCCCTTCTTCTTGCATGAGAGAGTGATTCTTTGGAATCAGTTAATAGCCAGCGTGAGGTCGCCCTCATGCACGGCCCTCGTAAAGGAAGCGGGGTGGTCATGGTTGGTTGGTGCTGCTGCTTTTGAGCACTCACCTGCATCGGAAACCGAGCCCTTGCCCTAGATGAAGCGGTCCACTTCCAGTGAAAGCCACATTCACGTCTTTGCCGTGCATGATCGTTTTGAAATTCTGACATGCCGTCCATGGCGGTTGAAGTCTGTTGTCCCTCTACTAACTCGTGTTCATTCCGCTCGACAGGTGTACCGTGGACTGAAGAAGAACACCGCCTCTTTCTTCTTGGGCTCCAGAAACTTGGTAAAGGTGATTGGAGGGGCATATCCAGGAATTTTGTGCAGACTAGGACTCCTACTCAGGTGGCCAGTCACGCTCAAAAATATTTCATCAGACAGAGTAACCTGAACAAAAGGAAGCGTCGTTCAAGCCTCTTCGACATTGTTACGGAGTCGGTGAGTCTTGGTGCACTTTCTCTACGTAGATCTTGAGTTTGGGTGCTGTCCATGGATAGCTAGCCTTTCTTGGGTCAGTTGTTTTCGCTCGTGAGAAATATATTATCTAGAGGTGAGCACTCGTCGATGCTGGCTTTCTTACATGGCGTGCGCTTCTCTTTATGTCCGCAGGGTCCGAGGCCAATGGTTGAAGAGCCCCTCTCAAAGAGCCCTGACATGTCTGCTCCCCTCCACCAACTCAGCTTGAGCTCCGGAGGATTGTTCAACCACGGTGCGTTCTTCGAACAACAGGGAATGCCGCAACTGAACAGAGGGCCAGACATGTTTCCTCCGATGGCTCCCATGTCTGGAGTGTCGATGAGAAGTTATCCGATTGGAGCCCATCTCCAACAAGCTATTCCTCTGCCAGTGATGTCTCTGGGAACGGCCGAGCAGACAGGTGAGTCGACTGTCAGCTACGCCGGCGAATCCGTAACGGTACTACCGAGACCTGTGGCAATTTCTGCGGCCAGTGCTTCAGGTCCCGGCAGTGCAGCGTTGGCGGGTCAGTTAGGAATCGGAGGACCAAGTATGTACCCATACCACATATGGCCAGGTATTGCACCTGGGAGCTACAGCAAGCCCATGTCCTCGTCGCCGTCATCGAGTTCGAAGGTGGTGAAGCCAACTGCGTGTCCGGCCAAGATCGATGAAGGATCCGAGATGGCGAAACTCACTCTCGGACCTTCACCGTCAGCGGAGCCGTCGAACCTCACTTTGAAGTTCTCGGGCCACAGCGCGTTCGTCTCCAAGACCTCATTCAACAGCAACAATCTCGGTCCGAGCACTATTAGTGTGGTGTAGAACAGTGGAGCCCATTTGGCACCGCAGTGTGGTAGTTGACAGGGATTCGTTGACACAAGGTTTCGGTTTGCTGTAGACTAATTTTTTATGTACATAGTTACGACGATTCATTCTGCCAGAGGCCTGCCTGGTACGTTCCCCAGGTTGTAAACTACACAGAAAGAGAGAATTCGACGTCCCTGGAATTGGAATCTAGTGGGGCCTGCAGGGACAACGCATATCAGGAGTTTCATGCAGTTCATTTTGACTCTTTGTTAAGCAATGGTTGTGTGATGAAGGTGGCCATGAAATGAAGCCTTTTTCATATATGGCGAGAAGTGGCGAGTCTTATTCGTGCAAGGCTCTGCTGAACTCGTCTATTCATGACATTGCGGGCTCACAATCTCTCAAGAAGGTGAGAGTGGTGAGCTCCATGTGTGCAAGGTTGAGAAGGTTAGTAAAGTGCTTTGTTTCACCGACACTGGCAGTTGCATCCGAAGCTCTTAATTTGCAAAAAGCTTTAGCGCTGTGTCCACGTGCAAGCAAAGTAGGACATGATTCGGACTCTCGGTGTCGAGTTCATGGAAGTAAAATACTCTCCATATGGTTGAATCTCCGTCCGTCGCTCACTAGGCCAGCTTTCTGTCGGCAGGAGCTTGCGGGGTGTTTCAGAAATGAGGCGTTACAGGACCCGGTTGAGACATTCGAGTAGTATAGAGATAGATGGCCTTAGTCAGGTCGAGGTCAGGGCCCGTGATTTTTTATCTCGGATGTGCTGCGGGAGATCAAGTTTTTCAACTCTCGTTTGTGGATTGGAGTCACTATGTAGCCCTTTTGGATATTGTAAGCTGTGTCCGCACGTCCGACCTGACTGAGTTCCTATTTTCAAGCTTTCGAAAGAAAGAGTAGGGTCGTCATATGGAGGCATGGGTGATTGGTGAAATACCAAGAATGTACAGATTTTGGGGTCACGGCCCCTTTTTCTAGAGCAAGCAATTGTAGAAGATAAACCTGGAATATGAGAATCATCACCCTTATCATC

mRNA

>Mapoly0020s0013.1
CATCATCGTCCGCTCTCCCCTTCTTCCTCTCGCCCTCGACCGATCCAGTTTCATTCGTTCGCTCTCTCGCCCTCCTCCCTTCGTACCCTCGCCCTCCTCCTCCTCCCCTCCTCCTCCTTCATAAGGCCCTCCCTCCCGTCGTGTGTGCGCGGAACGCTCACTCTGCTTGTGCACTGCTGTCGTAGTCGCTGCTGTGCAGGGCCCAGTTTGCGCGTCGAGTCGAGTAGTAGTTGTTCTCTGTTCAACCATTCCTTCTCTATCTCTCTCTTTCTTTCTCCTCCTCGATCTCTCTCTCTCTCTCTCTCGCGCGCGCTCTCTCTCTTTCTCGGTCTCTTTGCTTGCGCGATAGCATCTTGCTTCGATCTGTAATTTCTCTTGACATCTTTCTCGTTCGATACCATCATTATTATCAACCCACAACACCATCACCACCAACCATCCAGTCGTGGGCTTGGGCCGTCGTGTCGTGACGAGCTCGGTCGGTCGGGTTCGTTCGAGGTCTGTGATAAAAGATTCTTCCGGCTCTCGAGATCGTTCGAAGGTCGCGCGAGTGAGTCTTGCTACGACTCCTGGTGGTCAGATCCGTGGGGTTTGAGTCGAGGCTTGGACAAAGAGAAGCGTAGTTGAGGCGTCGGTAGTGGAGGTTGGAGGTTATCAGAGCGTGGACGGGAGGAAGAGGACTCACTCAATAGGTTGCAAGGATATCGGGAAAGGAATAAAGGAGGAAGAGAAGACGAGATAGGAAGAGAACGAACGAAGCCCGGTCCTGTCGTGGTCTGCTGTCGGTGGGGCTTCGAGTCTTGTTCGTTCGGTCGGTCGGTTGCTCGAAAGGCGGTAAGGAAGTGCAACAAAAGGGAGAAAGGAAAGGAAAAGTAGCGACGAGTAGACGAGGGAGATAGCGCGAGAAGGAAGTCCCGCTCCGCATCGTTTTCTTGTGCTGTCTTGAGAGAGGGAGCATCGGTTGTGATCGGTTTCTGGCTTCGGGCTTTATACCACGTGGTTGCTTCTTCGAGTTCTCTCTCAGATCCTACGTCTTTCTTGTCCTGCGACTTGGAAGCCACGGATTTCGGTTTCATCGGCGGGCACGTGTTTGCTCTCTTTCTCTCCCTCTCTCACTGCTCCAAGGGGCATATGCTCTCGCCTGCTGTCCTCCGTCCTCGTGGTGACATCTAATTCGAATCGGGTTCCTCTCGGTGTCCCACTCTTCGCGGATCTGCTCTCTCGTTGCCAGTGTGAACAGGCGCCGGTGCCCTCATCCATCTGCGTTCACAACAGACGACTCGTGAACCGGAAGAGAACGGAGCCGCACCGACCTTGTGCAGTTCGCTCCTCGTGCTCTACATCACACGATTTCTCCATCGTCTTCCCAGTCAGTAAAAATAGACCCATTCAAGTTACCACCGGTCGCTGTGGCTAACTTACGTATTCCTTCGGGGCGATCAGGGCCAGAAGAACTGGAGACCGAAATGACTCGCCGTTGCTCCCACTGTGGTCATAATGGGCACAATTCTCGTACGTGTCCCGATCGTTGTCCTGATCGGGGGGTACGGTTATTTGGTGTTCGACTCACAACGAACGATGGTGCAGCGAACATGCGTAAGAGTGTCAGCATGGGCAATTTGACGCATTATGCCAACGCCAGCAACCCTCCATCCACCCCCGAGCATTCGGAGTCCGGAGCTGGTGCTGAGGGATACGTTTCAGACGGCCTCGTGCAGACTTCCAGCAACGCTCGCGAAAGAAAGAAAGGTGTACCGTGGACTGAAGAAGAACACCGCCTCTTTCTTCTTGGGCTCCAGAAACTTGGTAAAGGTGATTGGAGGGGCATATCCAGGAATTTTGTGCAGACTAGGACTCCTACTCAGGTGGCCAGTCACGCTCAAAAATATTTCATCAGACAGAGTAACCTGAACAAAAGGAAGCGTCGTTCAAGCCTCTTCGACATTGTTACGGAGTCGGGTCCGAGGCCAATGGTTGAAGAGCCCCTCTCAAAGAGCCCTGACATGTCTGCTCCCCTCCACCAACTCAGCTTGAGCTCCGGAGGATTGTTCAACCACGGTGCGTTCTTCGAACAACAGGGAATGCCGCAACTGAACAGAGGGCCAGACATGTTTCCTCCGATGGCTCCCATGTCTGGAGTGTCGATGAGAAGTTATCCGATTGGAGCCCATCTCCAACAAGCTATTCCTCTGCCAGTGATGTCTCTGGGAACGGCCGAGCAGACAGGTGAGTCGACTGTCAGCTACGCCGGCGAATCCGTAACGGTACTACCGAGACCTGTGGCAATTTCTGCGGCCAGTGCTTCAGGTCCCGGCAGTGCAGCGTTGGCGGGTCAGTTAGGAATCGGAGGACCAAGTATGTACCCATACCACATATGGCCAGGTATTGCACCTGGGAGCTACAGCAAGCCCATGTCCTCGTCGCCGTCATCGAGTTCGAAGGTGGTGAAGCCAACTGCGTGTCCGGCCAAGATCGATGAAGGATCCGAGATGGCGAAACTCACTCTCGGACCTTCACCGTCAGCGGAGCCGTCGAACCTCACTTTGAAGTTCTCGGGCCACAGCGCGTTCGTCTCCAAGACCTCATTCAACAGCAACAATCTCGGTCCGAGCACTATTAGTGTGGTGTAGAACAGTGGAGCCCATTTGGCACCGCAGTGTGGTAGTTGACAGGGATTCGTTGACACAAGGTTTCGGTTTGCTGTAGACTAATTTTTTATGTACATAGTTACGACGATTCATTCTGCCAGAGGCCTGCCTGGTACGTTCCCCAGGTTGTAAACTACACAGAAAGAGAGAATTCGACGTCCCTGGAATTGGAATCTAGTGGGGCCTGCAGGGACAACGCATATCAGGAGTTTCATGCAGTTCATTTTGACTCTTTGTTAAGCAATGGTTGTGTGATGAAGGTGGCCATGAAATGAAGCCTTTTTCATATATGGCGAGAAGTGGCGAGTCTTATTCGTGCAAGGCTCTGCTGAACTCGTCTATTCATGACATTGCGGGCTCACAATCTCTCAAGAAGGTGAGAGTGGTGAGCTCCATGTGTGCAAGGTTGAGAAGGTTAGTAAAGTGCTTTGTTTCACCGACACTGGCAGTTGCATCCGAAGCTCTTAATTTGCAAAAAGCTTTAGCGCTGTGTCCACGTGCAAGCAAAGTAGGACATGATTCGGACTCTCGGTGTCGAGTTCATGGAAGTAAAATACTCTCCATATGGTTGAATCTCCGTCCGTCGCTCACTAGGCCAGCTTTCTGTCGGCAGGAGCTTGCGGGGTGTTTCAGAAATGAGGCGTTACAGGACCCGGTTGAGACATTCGAGTAGTATAGAGATAGATGGCCTTAGTCAGGTCGAGGTCAGGGCCCGTGATTTTTTATCTCGGATGTGCTGCGGGAGATCAAGTTTTTCAACTCTCGTTTGTGGATTGGAGTCACTATGTAGCCCTTTTGGATATTGTAAGCTGTGTCCGCACGTCCGACCTGACTGAGTTCCTATTTTCAAGCTTTCGAAAGAAAGAGTAGGGTCGTCATATGGAGGCATGGGTGATTGGTGAAATACCAAGAATGTACAGATTTTGGGGTCACGGCCCCTTTTTCTAGAGCAAGCAATTGTAGAAGATAAACCTGGAATATGAGAATCATCACCCTTATCATC

CDS

>Mapoly0020s0013.1
ATGACTCGCCGTTGCTCCCACTGTGGTCATAATGGGCACAATTCTCGTACGTGTCCCGATCGTTGTCCTGATCGGGGGGTACGGTTATTTGGTGTTCGACTCACAACGAACGATGGTGCAGCGAACATGCGTAAGAGTGTCAGCATGGGCAATTTGACGCATTATGCCAACGCCAGCAACCCTCCATCCACCCCCGAGCATTCGGAGTCCGGAGCTGGTGCTGAGGGATACGTTTCAGACGGCCTCGTGCAGACTTCCAGCAACGCTCGCGAAAGAAAGAAAGGTGTACCGTGGACTGAAGAAGAACACCGCCTCTTTCTTCTTGGGCTCCAGAAACTTGGTAAAGGTGATTGGAGGGGCATATCCAGGAATTTTGTGCAGACTAGGACTCCTACTCAGGTGGCCAGTCACGCTCAAAAATATTTCATCAGACAGAGTAACCTGAACAAAAGGAAGCGTCGTTCAAGCCTCTTCGACATTGTTACGGAGTCGGGTCCGAGGCCAATGGTTGAAGAGCCCCTCTCAAAGAGCCCTGACATGTCTGCTCCCCTCCACCAACTCAGCTTGAGCTCCGGAGGATTGTTCAACCACGGTGCGTTCTTCGAACAACAGGGAATGCCGCAACTGAACAGAGGGCCAGACATGTTTCCTCCGATGGCTCCCATGTCTGGAGTGTCGATGAGAAGTTATCCGATTGGAGCCCATCTCCAACAAGCTATTCCTCTGCCAGTGATGTCTCTGGGAACGGCCGAGCAGACAGGTGAGTCGACTGTCAGCTACGCCGGCGAATCCGTAACGGTACTACCGAGACCTGTGGCAATTTCTGCGGCCAGTGCTTCAGGTCCCGGCAGTGCAGCGTTGGCGGGTCAGTTAGGAATCGGAGGACCAAGTATGTACCCATACCACATATGGCCAGGTATTGCACCTGGGAGCTACAGCAAGCCCATGTCCTCGTCGCCGTCATCGAGTTCGAAGGTGGTGAAGCCAACTGCGTGTCCGGCCAAGATCGATGAAGGATCCGAGATGGCGAAACTCACTCTCGGACCTTCACCGTCAGCGGAGCCGTCGAACCTCACTTTGAAGTTCTCGGGCCACAGCGCGTTCGTCTCCAAGACCTCATTCAACAGCAACAATCTCGGTCCGAGCACTATTAGTGTGGTGTAG

Protein

>Mapoly0020s0013.1
MTRRCSHCGHNGHNSRTCPDRCPDRGVRLFGVRLTTNDGAANMRKSVSMGNLTHYANASNPPSTPEHSESGAGAEGYVSDGLVQTSSNARERKKGVPWTEEEHRLFLLGLQKLGKGDWRGISRNFVQTRTPTQVASHAQKYFIRQSNLNKRKRRSSLFDIVTESGPRPMVEEPLSKSPDMSAPLHQLSLSSGGLFNHGAFFEQQGMPQLNRGPDMFPPMAPMSGVSMRSYPIGAHLQQAIPLPVMSLGTAEQTGESTVSYAGESVTVLPRPVAISAASASGPGSAALAGQLGIGGPSMYPYHIWPGIAPGSYSKPMSSSPSSSSKVVKPTACPAKIDEGSEMAKLTLGPSPSAEPSNLTLKFSGHSAFVSKTSFNSNNLGPSTISVV

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>