Mapoly0024s0084



Description

ARF-RELATED PROTEIN 1, ARFRP1

Reference DB

Database ID Description
GO GO:0005525 GTP binding
KOG KOG0076 GTP-binding ADP-ribosylation factor-like protein yARL3
OrthoMCL OG5_129820
PFAM PF00025 ADP-ribosylation factor family
PANTHER PTHR11711 ADP RIBOSYLATION FACTOR-RELATED
PANTHER PTHR11711:SF19 ARF-RELATED PROTEIN 1, ARFRP1

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpARFLB SAR/ARF GTPase Mapoly0024s0084.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0024s0084.1 scaffold_24:1054308..1059913  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
Mapoly0024s0084.2 scaffold_24:1054308..1059707  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0024s0084.1  

Gene structure:

mRNA scaffold_24:1054308..1059913  ( + strand )
five_prime_UTR scaffold_24:1054308..1055141  ( + strand )
CDS scaffold_24:1055142..1055234  ( + strand )
CDS scaffold_24:1055926..1056066  ( + strand )
CDS scaffold_24:1056329..1056437  ( + strand )
CDS scaffold_24:1058213..1058274  ( + strand )
CDS scaffold_24:1058641..1058744  ( + strand )
CDS scaffold_24:1058892..1058990  ( + strand )
CDS scaffold_24:1059172..1059241  ( + strand )
three_prime_UTR scaffold_24:1059242..1059913  ( + strand )

Sequences:

Gene

>Mapoly0024s0084.1
CTACGGAGGGAGGGAGTCCTGGGGGGAGTGGAGGGGACGTTGCGGCAGCTAGCCTCTCCACTGCTTTGTGCTCGGCTATGCCATCTCGGTCCGAAGGATGTGGAGCTCGACTTGTCTCCACCTTGTCCCTGGGACATCAGGGCGGCCCCTGATTCGATCCGATTGTGCGCTTCGCTGAGTTTGCGTTTGCGTGACCTCTTTCCGGGCCTGGGCTTGGCTCGGGTTCCTTTCACTTGCAATACAGAGCACTACGCTTTCCTCTTGCCTTCCGATCCCTCGCCTTCCGTCGGGGGGTTGCTGGCTGCCCCTGCTTTGCCCGCCGAGTGCTCGCTCGATCGATTCCTCGGGCGGTGCGCTGTCATGCGAAGAATAGTTCGATCGCTCGTTCTCATGCTCGATTAGCCCCACTCCGAAGCAGTCGCAATTCCGACTCTACGTCTGCTCCTCATCGAACCTTAGCGCGCCACAGCGCAGCTGCTTCAGATGCCGAAGCTGCTGCTGCTTGCACCTCCAGCACCGTAGGCTTTGTTTCTTGCAAGAGGAGAGGCGAGGCGAGGCACGCCAGTCACCAGCTTACAGGAGATGCTGGCCAGGTTGTGGACTTAGATCAGATGCAGCAGCGGATGGAAACTTTAGGCCGTGGGATTCTTGAGGGAGGGTGCTATTGGAATTAGAGTGAGTGCCTATGTGATGGAAGAGATCCTGTGATTGACCCCATGGTTGGAGGAAAGGTGTAGAGACTGAGTAGACGAAGAGGGAAGGAAGAAAGGGAGGAAGAAGAAAGGAAAGGGAACAAGGAAGGAAAGAAAATATCTACCAGGTGCAGGACGCATCATGTTTTCGTTGCTGTATGGGCTGTGGAAGTACCTGTTTAGCAAAGCGGAGTTTCATGTGCTCATACTTGGCATCGATAAGGCTGGCAAGACGGTATGAAATCTTGTCTGCCTTGGAATATACTCGTTTGGTTACGAATGAAAGCTTTCAATTTGATCTTTGATTCACTTTCGTGGTCTCCTGAAATGGCAATGTCTGATTGAAGGACAATTTGAGCAAGTGGCAGTCAGATCGCAGTGCTTTCGTGGTAGTTGGGGCCGGAGCCGAACGTCCGACTGGAAAATGTGTCTCCGTTTTTACTATGTTAATGCAGGTTTCAGGGGCAGTCACGGTCCTTTTAAATCAGTTGCCTGAACAGCCTCATTTCGCGTCTGAACGTTATCGCTAACTTTGTTGAGCCGTTTGATCGTGAGGGGGACTATTTCGTTCGTGAATTTCGAGTCCAAGTTTTCCTGTATGACACAAAACTGATCAAGTGCCTGCCTCCTTGGATAGTTGAGTGGTTGAATTATAACTATGAAGTGTACGGAACGACAAGCTAGTTCTGGAGGAAGCTCAGGGCCGGTTTTGGTGTAGAGCGATCATTTCAGAAAGCAGCGCCGAAGTGTATGGGGCTAGATTCTGGGTCCCGATTTGTTTCCCCAGGTTACAAACTCTGCAAGTTTCTCCCTCGACTTTGTTATCCCAAAAGTTAAAGGGGAAACATGCAATATTTTAGAGGAAACAATCCTGACTTTGAGCTGCATTGTCATTGAACCTTGATGCTGGTTCTGTACATACGCAGACATTGCTGGAGAAGTTGAAAACTTTGTACTCTGATTTCGAAGGTCTTCCACCAGATCGAATTGTCCCCACCGTCGGGCTCAACATTGGACGTATAGAGGCACACAAATCAAAACTTATTTTCTGGGATCTTGGCGGTCAGGTAATCTTCGTTCGATCATTTGACTTCGGTCAGAGCTTGCTTTCCATGTGGATTTATATGTTCTGTGGTACGTATACTGGGTTGTGCACGTCCGGATGTCCCGCTCTGGCTATCCCGAGTGCAGATGGAACGTTCATTCAATTTATGTCTGAGTTTAACCTCCACTAGGTTCGGCTGCGATTCAGCTGTGAGATCTTGTTTGAATTGGGGAAATTGACCGTACACTTACGTACTGTATATACTTTACTCGCTGCTTGTACAGCTAGGGTTGCGAACAATCTGGGAGAAGTATTACGAAGAGGCTCATGCGATATTGTATGTTGTAGATGCAGCGAGTGAATCTCGCTTGGAAGACACAAAGTCAGCATTTGGTACATCCTAATTTAAAGCTTCATCCCTTTATAAGCTTGAATAAGTATCTGAAAGTGTCATAACTGTTGGAGTCGGCTGTAAGGGCCCTTCACCAAGTTTCCTGGGCTTCCCGGACACCTTTCTATGACAGAATATGGTTTGGTGCTTCACACCTCTGAATATTTCCATCGTGAGCTCAAGGAAGAACATATCAAGAACAGCGCTGTGAGGTATTGTTTCAAAATTGTGCTGCCCCGACCTCAAAAGTTTTGGACTTAGACAAGCCAAAACAAAGGCGAATACAAGTCATTTGGTCTATTGACTGAAGATGACTGGAATTCACAGCCGCATGAAGCACAGAAAGGTTTTCTTGCATTGAGTATGATCAGGGGCCGATGAATATAATAAGTCAAGAATATAGTCTTGAAATACCTCGGGAGTGAGGCAGAGGCCAGATACAGTAAGGTCAGCCATTTGCTCCAAAATTGACATTGTGGATTTTTAACCCACTGATTTTGAATACCTTCACTAGAAGGTGCCACTACTAGTTTCTAATCACTTCCACGCTTCTTCTTTGTCTTGGCTCATACTCGGATCTCCCAATTTTCTGCAAATTAGTGGAAAATTATCTTGCGTTTGTGGACGAATACTTTGTTTGATCGATCGTCGGTCATCTCTCCTTTGCCAGGAACCTGATTGCAGTACACATACATCCATGGCTGCTTTGTGAATATTACAAAAACTGGTGAGGAGGGCTATTGGTGCTTAAAGATATTTAGTGGTGGAGTGGTGTTAGTAGTGTTCTCGCTAAGTATGTACGTACTGGTTTACTTACTAGGTGGAGCACTTAAGAGGGCAACAAAACTGCACGTACTATATCTATGGCAGATGGAAGCAGTTCCCTTTGGAATTTTAAGTAAAAAAGTCACTTAGAGTTTCTGGAAGGGTGGAAGCAAACTGCAAACCAGACTTTTCCATAGCTTCGCTGGACCACAGACCAGCCATTTTCAGGCACTCTCTCCCGGTGTTCCTTAGAAGGGTACGCGTTGAGAGGTCAATTTTAACTGATGGCTATCCCTGTGACTATGAGAACCATCTTGCAGCTTCTTATACCTGTAGCAAGGAGGACAAGAGTTATGGTCATATTTGATGAAATGCAGCTTGTTCTTTAACTTGAGATTGAAATTGTTTTTTAACATTAATATGGTGTGTGGACTTTAAGCTGTTTACGGAACCCACTGGCCTTGATTCGAAGCCCAGAGCCGTCACAATTCAATCTTTGTTACTAGGTCTGAAATAAACATCAAGTGAAGGAGTTAGAGAAGGGTTTCTGTGTTGACTAACTTCTTTGTGTATGGAAATTTCTTACCACAGGAAAGACCTTTGCTCTCATGTAATCCTCTCTCATTTTCCTCTTCTTCTATCCCGTTTTCTCCAAGTACTCAGTCTTCTAGTAACAGCACTGCACGATCAGGGTGCATAGTCTTAAGTCTTCACGCTACGACACACACATCCTGTGATATTTTATTCAGCTAACGCATGCCTGTGTCTGTTTCACCAACGAAAGTCCGGTTTTATCTGTCTCTCTTCAAGGACGCAATAAAATGAGTTCATGACTAACTTTCTTTCGTTTGTTTTTATGTCTAACTTTCTTCAGGAATACATGATTAAAGAGCAAGAGTTGGTGTTTGGGTTTATCTGTTTATGAGAACTCCGCTGTCGTACTTATTTCAGCGTTATCTTACGAGCTTTCAGAGCTGCTATTTCTGAAAGGTGGTATATCTGTCTCTTGCAGAGAAAGTCCTAAGACATCAGGACTTACAAGGTGCCCCAGTATTAATTTTCGCCAACAAACAGGTACACTGGCCTGGACGTCTCGAGTATTGAATTTAAATGTGAACTAGGGATCTTCTAGCCGACTCAATGAGTAAAGAGTACATTGTAATTTGGCACCGCTTAGCCACGTTTTATGTTATAAAGGGGAAAACCTGTCGAGTACCTAGCAGACTTAAGTACGTTATACTAAATATATCTCTTTCGTGGAATGCTCGCATTTTTTGTTCAATATGTAAGGAAATCGATTTGCAGTCTGGGAATCTAGGGTTGTGTATTTATAGTAGTCATTCCGGATTACCGTGACAACGAGGAACCCGGCTCTTGTGATCACACGGCTGTTGAATTTTTACATAACCTGTACATACTTGATTTATTTGGTGGATTTAGGATCTAGAAGGGGCTGTCTCTGCAAAAGAGATTGGAACTGCCTTGAACCTCAAAGAGCTAGAGGAGCGGGAGTCTATGGCCATGGCCATTTCTGCCTATGACGGGTAAGGTTTGTGTTAAACGTTATATTTAAGTTGTTATGTGTTATGATCTAGTGAGGTGGTCATATAATAATTTTTGTCTCTTCTTCGTTATGGATGACGCATTTAAGTTTTTAGTACTCATCAAAGCTGATGCTTCTCCGTACACAGATCTGGAATTAGGGAGGGAGTCACATGGCTTGTGGATGCTATGCGGACTTGCAAAAGAACGCAAGAGCTCAAACAACGTGCAGATGCAGCCGTAACGATGTAATTCCCAATTACAACTCAGCTGTCCATGTCCAATCTTCTGTATACAATTGTAAAATTCATATTATCAAAGGCAGTCCACAAGGGTACTTTCAGTCGTAAGTATCCATTCTTCAAGTGCAATTGCCAATTGGTTCCTGTGAGTTGTCCTAATAAAGTCATTCATTTTGGATCGCAATAGGAATATGCACGTCATAAAGGACGATACCAGTGTTTGGAGAAAGGAGAGGATTAAGAATCGTGTCTGGTGACTTTTGCATTTCGAGATGAGAACGAAGTGAGGCGCGTGGTCGGTGGACTAGGTGCACTTCCATGATTGCTGGAGCGCAGAAACTTCATACCAGTGGAGCTCTGTCGTATTTATTACTGTGCATTGTACGATTGCAAGTAGAGGCCGTGAAACTGTATGATGAGGCTGTAAGCTTTCTCCAATCGATTGTCTTGATATCGTACCCGGAGCAGATAGCAGAAGTTCTTTTTGTTACATGGGAGGATAGCTTCTGCATCAAAAAATCCTCATGATTTCTCGACACTCAGCCTAACACAGTGTAGGATTCCACAGATTGTGGAAATGATCATTTTTTACTTTCGTCCTCGAAAGTTACACTGCCCTTGAGATAAGGTTTTCTTGTTAATACACAGACAACACGTAGTTGATTTTAGGCCGGTCTCTGTGTTCCTTACTCGCCTGCAGACTGCCGTATAATCTGGAGGCATCCTCGTTGAAAGTGAATACTGTTAACTGGCTTCCAGAAACATGTGTTCGAACACTGTCCGAACGATGGGCCTGTAAACCTGCATTGCACGATTAGTGTTCACATATGCCGTGCCTCATCCTTGTGTCGCTACATTGTAGTTGTCGCAGTCATTGTGTATTTTTACTTTGTCTTGCATCCTCCACATGCGTAGTAAAAGTCACTGGT

mRNA

>Mapoly0024s0084.1
CTACGGAGGGAGGGAGTCCTGGGGGGAGTGGAGGGGACGTTGCGGCAGCTAGCCTCTCCACTGCTTTGTGCTCGGCTATGCCATCTCGGTCCGAAGGATGTGGAGCTCGACTTGTCTCCACCTTGTCCCTGGGACATCAGGGCGGCCCCTGATTCGATCCGATTGTGCGCTTCGCTGAGTTTGCGTTTGCGTGACCTCTTTCCGGGCCTGGGCTTGGCTCGGGTTCCTTTCACTTGCAATACAGAGCACTACGCTTTCCTCTTGCCTTCCGATCCCTCGCCTTCCGTCGGGGGGTTGCTGGCTGCCCCTGCTTTGCCCGCCGAGTGCTCGCTCGATCGATTCCTCGGGCGGTGCGCTGTCATGCGAAGAATAGTTCGATCGCTCGTTCTCATGCTCGATTAGCCCCACTCCGAAGCAGTCGCAATTCCGACTCTACGTCTGCTCCTCATCGAACCTTAGCGCGCCACAGCGCAGCTGCTTCAGATGCCGAAGCTGCTGCTGCTTGCACCTCCAGCACCGTAGGCTTTGTTTCTTGCAAGAGGAGAGGCGAGGCGAGGCACGCCAGTCACCAGCTTACAGGAGATGCTGGCCAGGTTGTGGACTTAGATCAGATGCAGCAGCGGATGGAAACTTTAGGCCGTGGGATTCTTGAGGGAGGGTGCTATTGGAATTAGAGTGAGTGCCTATGTGATGGAAGAGATCCTGTGATTGACCCCATGGTTGGAGGAAAGGTGTAGAGACTGAGTAGACGAAGAGGGAAGGAAGAAAGGGAGGAAGAAGAAAGGAAAGGGAACAAGGAAGGAAAGAAAATATCTACCAGGTGCAGGACGCATCATGTTTTCGTTGCTGTATGGGCTGTGGAAGTACCTGTTTAGCAAAGCGGAGTTTCATGTGCTCATACTTGGCATCGATAAGGCTGGCAAGACGACATTGCTGGAGAAGTTGAAAACTTTGTACTCTGATTTCGAAGGTCTTCCACCAGATCGAATTGTCCCCACCGTCGGGCTCAACATTGGACGTATAGAGGCACACAAATCAAAACTTATTTTCTGGGATCTTGGCGGTCAGCTAGGGTTGCGAACAATCTGGGAGAAGTATTACGAAGAGGCTCATGCGATATTGTATGTTGTAGATGCAGCGAGTGAATCTCGCTTGGAAGACACAAAGTCAGCATTTGAGAAAGTCCTAAGACATCAGGACTTACAAGGTGCCCCAGTATTAATTTTCGCCAACAAACAGGATCTAGAAGGGGCTGTCTCTGCAAAAGAGATTGGAACTGCCTTGAACCTCAAAGAGCTAGAGGAGCGGGAGTCTATGGCCATGGCCATTTCTGCCTATGACGGATCTGGAATTAGGGAGGGAGTCACATGGCTTGTGGATGCTATGCGGACTTGCAAAAGAACGCAAGAGCTCAAACAACGTGCAGATGCAGCCGTAACGATGAATATGCACGTCATAAAGGACGATACCAGTGTTTGGAGAAAGGAGAGGATTAAGAATCGTGTCTGGTGACTTTTGCATTTCGAGATGAGAACGAAGTGAGGCGCGTGGTCGGTGGACTAGGTGCACTTCCATGATTGCTGGAGCGCAGAAACTTCATACCAGTGGAGCTCTGTCGTATTTATTACTGTGCATTGTACGATTGCAAGTAGAGGCCGTGAAACTGTATGATGAGGCTGTAAGCTTTCTCCAATCGATTGTCTTGATATCGTACCCGGAGCAGATAGCAGAAGTTCTTTTTGTTACATGGGAGGATAGCTTCTGCATCAAAAAATCCTCATGATTTCTCGACACTCAGCCTAACACAGTGTAGGATTCCACAGATTGTGGAAATGATCATTTTTTACTTTCGTCCTCGAAAGTTACACTGCCCTTGAGATAAGGTTTTCTTGTTAATACACAGACAACACGTAGTTGATTTTAGGCCGGTCTCTGTGTTCCTTACTCGCCTGCAGACTGCCGTATAATCTGGAGGCATCCTCGTTGAAAGTGAATACTGTTAACTGGCTTCCAGAAACATGTGTTCGAACACTGTCCGAACGATGGGCCTGTAAACCTGCATTGCACGATTAGTGTTCACATATGCCGTGCCTCATCCTTGTGTCGCTACATTGTAGTTGTCGCAGTCATTGTGTATTTTTACTTTGTCTTGCATCCTCCACATGCGTAGTAAAAGTCACTGGT

CDS

>Mapoly0024s0084.1
ATGTTTTCGTTGCTGTATGGGCTGTGGAAGTACCTGTTTAGCAAAGCGGAGTTTCATGTGCTCATACTTGGCATCGATAAGGCTGGCAAGACGACATTGCTGGAGAAGTTGAAAACTTTGTACTCTGATTTCGAAGGTCTTCCACCAGATCGAATTGTCCCCACCGTCGGGCTCAACATTGGACGTATAGAGGCACACAAATCAAAACTTATTTTCTGGGATCTTGGCGGTCAGCTAGGGTTGCGAACAATCTGGGAGAAGTATTACGAAGAGGCTCATGCGATATTGTATGTTGTAGATGCAGCGAGTGAATCTCGCTTGGAAGACACAAAGTCAGCATTTGAGAAAGTCCTAAGACATCAGGACTTACAAGGTGCCCCAGTATTAATTTTCGCCAACAAACAGGATCTAGAAGGGGCTGTCTCTGCAAAAGAGATTGGAACTGCCTTGAACCTCAAAGAGCTAGAGGAGCGGGAGTCTATGGCCATGGCCATTTCTGCCTATGACGGATCTGGAATTAGGGAGGGAGTCACATGGCTTGTGGATGCTATGCGGACTTGCAAAAGAACGCAAGAGCTCAAACAACGTGCAGATGCAGCCGTAACGATGAATATGCACGTCATAAAGGACGATACCAGTGTTTGGAGAAAGGAGAGGATTAAGAATCGTGTCTGGTGA

Protein

>Mapoly0024s0084.1
MFSLLYGLWKYLFSKAEFHVLILGIDKAGKTTLLEKLKTLYSDFEGLPPDRIVPTVGLNIGRIEAHKSKLIFWDLGGQLGLRTIWEKYYEEAHAILYVVDAASESRLEDTKSAFEKVLRHQDLQGAPVLIFANKQDLEGAVSAKEIGTALNLKELEERESMAMAISAYDGSGIREGVTWLVDAMRTCKRTQELKQRADAAVTMNMHVIKDDTSVWRKERIKNRVW

Mapoly0024s0084.2  

Gene structure:

mRNA scaffold_24:1054308..1059707  ( + strand )
five_prime_UTR scaffold_24:1054308..1055141  ( + strand )
CDS scaffold_24:1055142..1055234  ( + strand )
CDS scaffold_24:1055926..1056066  ( + strand )
CDS scaffold_24:1056329..1056437  ( + strand )
CDS scaffold_24:1058213..1058274  ( + strand )
CDS scaffold_24:1058641..1058744  ( + strand )
CDS scaffold_24:1058892..1058994  ( + strand )
three_prime_UTR scaffold_24:1058995..1059707  ( + strand )

Sequences:

Gene

>Mapoly0024s0084.2
CTACGGAGGGAGGGAGTCCTGGGGGGAGTGGAGGGGACGTTGCGGCAGCTAGCCTCTCCACTGCTTTGTGCTCGGCTATGCCATCTCGGTCCGAAGGATGTGGAGCTCGACTTGTCTCCACCTTGTCCCTGGGACATCAGGGCGGCCCCTGATTCGATCCGATTGTGCGCTTCGCTGAGTTTGCGTTTGCGTGACCTCTTTCCGGGCCTGGGCTTGGCTCGGGTTCCTTTCACTTGCAATACAGAGCACTACGCTTTCCTCTTGCCTTCCGATCCCTCGCCTTCCGTCGGGGGGTTGCTGGCTGCCCCTGCTTTGCCCGCCGAGTGCTCGCTCGATCGATTCCTCGGGCGGTGCGCTGTCATGCGAAGAATAGTTCGATCGCTCGTTCTCATGCTCGATTAGCCCCACTCCGAAGCAGTCGCAATTCCGACTCTACGTCTGCTCCTCATCGAACCTTAGCGCGCCACAGCGCAGCTGCTTCAGATGCCGAAGCTGCTGCTGCTTGCACCTCCAGCACCGTAGGCTTTGTTTCTTGCAAGAGGAGAGGCGAGGCGAGGCACGCCAGTCACCAGCTTACAGGAGATGCTGGCCAGGTTGTGGACTTAGATCAGATGCAGCAGCGGATGGAAACTTTAGGCCGTGGGATTCTTGAGGGAGGGTGCTATTGGAATTAGAGTGAGTGCCTATGTGATGGAAGAGATCCTGTGATTGACCCCATGGTTGGAGGAAAGGTGTAGAGACTGAGTAGACGAAGAGGGAAGGAAGAAAGGGAGGAAGAAGAAAGGAAAGGGAACAAGGAAGGAAAGAAAATATCTACCAGGTGCAGGACGCATCATGTTTTCGTTGCTGTATGGGCTGTGGAAGTACCTGTTTAGCAAAGCGGAGTTTCATGTGCTCATACTTGGCATCGATAAGGCTGGCAAGACGGTATGAAATCTTGTCTGCCTTGGAATATACTCGTTTGGTTACGAATGAAAGCTTTCAATTTGATCTTTGATTCACTTTCGTGGTCTCCTGAAATGGCAATGTCTGATTGAAGGACAATTTGAGCAAGTGGCAGTCAGATCGCAGTGCTTTCGTGGTAGTTGGGGCCGGAGCCGAACGTCCGACTGGAAAATGTGTCTCCGTTTTTACTATGTTAATGCAGGTTTCAGGGGCAGTCACGGTCCTTTTAAATCAGTTGCCTGAACAGCCTCATTTCGCGTCTGAACGTTATCGCTAACTTTGTTGAGCCGTTTGATCGTGAGGGGGACTATTTCGTTCGTGAATTTCGAGTCCAAGTTTTCCTGTATGACACAAAACTGATCAAGTGCCTGCCTCCTTGGATAGTTGAGTGGTTGAATTATAACTATGAAGTGTACGGAACGACAAGCTAGTTCTGGAGGAAGCTCAGGGCCGGTTTTGGTGTAGAGCGATCATTTCAGAAAGCAGCGCCGAAGTGTATGGGGCTAGATTCTGGGTCCCGATTTGTTTCCCCAGGTTACAAACTCTGCAAGTTTCTCCCTCGACTTTGTTATCCCAAAAGTTAAAGGGGAAACATGCAATATTTTAGAGGAAACAATCCTGACTTTGAGCTGCATTGTCATTGAACCTTGATGCTGGTTCTGTACATACGCAGACATTGCTGGAGAAGTTGAAAACTTTGTACTCTGATTTCGAAGGTCTTCCACCAGATCGAATTGTCCCCACCGTCGGGCTCAACATTGGACGTATAGAGGCACACAAATCAAAACTTATTTTCTGGGATCTTGGCGGTCAGGTAATCTTCGTTCGATCATTTGACTTCGGTCAGAGCTTGCTTTCCATGTGGATTTATATGTTCTGTGGTACGTATACTGGGTTGTGCACGTCCGGATGTCCCGCTCTGGCTATCCCGAGTGCAGATGGAACGTTCATTCAATTTATGTCTGAGTTTAACCTCCACTAGGTTCGGCTGCGATTCAGCTGTGAGATCTTGTTTGAATTGGGGAAATTGACCGTACACTTACGTACTGTATATACTTTACTCGCTGCTTGTACAGCTAGGGTTGCGAACAATCTGGGAGAAGTATTACGAAGAGGCTCATGCGATATTGTATGTTGTAGATGCAGCGAGTGAATCTCGCTTGGAAGACACAAAGTCAGCATTTGGTACATCCTAATTTAAAGCTTCATCCCTTTATAAGCTTGAATAAGTATCTGAAAGTGTCATAACTGTTGGAGTCGGCTGTAAGGGCCCTTCACCAAGTTTCCTGGGCTTCCCGGACACCTTTCTATGACAGAATATGGTTTGGTGCTTCACACCTCTGAATATTTCCATCGTGAGCTCAAGGAAGAACATATCAAGAACAGCGCTGTGAGGTATTGTTTCAAAATTGTGCTGCCCCGACCTCAAAAGTTTTGGACTTAGACAAGCCAAAACAAAGGCGAATACAAGTCATTTGGTCTATTGACTGAAGATGACTGGAATTCACAGCCGCATGAAGCACAGAAAGGTTTTCTTGCATTGAGTATGATCAGGGGCCGATGAATATAATAAGTCAAGAATATAGTCTTGAAATACCTCGGGAGTGAGGCAGAGGCCAGATACAGTAAGGTCAGCCATTTGCTCCAAAATTGACATTGTGGATTTTTAACCCACTGATTTTGAATACCTTCACTAGAAGGTGCCACTACTAGTTTCTAATCACTTCCACGCTTCTTCTTTGTCTTGGCTCATACTCGGATCTCCCAATTTTCTGCAAATTAGTGGAAAATTATCTTGCGTTTGTGGACGAATACTTTGTTTGATCGATCGTCGGTCATCTCTCCTTTGCCAGGAACCTGATTGCAGTACACATACATCCATGGCTGCTTTGTGAATATTACAAAAACTGGTGAGGAGGGCTATTGGTGCTTAAAGATATTTAGTGGTGGAGTGGTGTTAGTAGTGTTCTCGCTAAGTATGTACGTACTGGTTTACTTACTAGGTGGAGCACTTAAGAGGGCAACAAAACTGCACGTACTATATCTATGGCAGATGGAAGCAGTTCCCTTTGGAATTTTAAGTAAAAAAGTCACTTAGAGTTTCTGGAAGGGTGGAAGCAAACTGCAAACCAGACTTTTCCATAGCTTCGCTGGACCACAGACCAGCCATTTTCAGGCACTCTCTCCCGGTGTTCCTTAGAAGGGTACGCGTTGAGAGGTCAATTTTAACTGATGGCTATCCCTGTGACTATGAGAACCATCTTGCAGCTTCTTATACCTGTAGCAAGGAGGACAAGAGTTATGGTCATATTTGATGAAATGCAGCTTGTTCTTTAACTTGAGATTGAAATTGTTTTTTAACATTAATATGGTGTGTGGACTTTAAGCTGTTTACGGAACCCACTGGCCTTGATTCGAAGCCCAGAGCCGTCACAATTCAATCTTTGTTACTAGGTCTGAAATAAACATCAAGTGAAGGAGTTAGAGAAGGGTTTCTGTGTTGACTAACTTCTTTGTGTATGGAAATTTCTTACCACAGGAAAGACCTTTGCTCTCATGTAATCCTCTCTCATTTTCCTCTTCTTCTATCCCGTTTTCTCCAAGTACTCAGTCTTCTAGTAACAGCACTGCACGATCAGGGTGCATAGTCTTAAGTCTTCACGCTACGACACACACATCCTGTGATATTTTATTCAGCTAACGCATGCCTGTGTCTGTTTCACCAACGAAAGTCCGGTTTTATCTGTCTCTCTTCAAGGACGCAATAAAATGAGTTCATGACTAACTTTCTTTCGTTTGTTTTTATGTCTAACTTTCTTCAGGAATACATGATTAAAGAGCAAGAGTTGGTGTTTGGGTTTATCTGTTTATGAGAACTCCGCTGTCGTACTTATTTCAGCGTTATCTTACGAGCTTTCAGAGCTGCTATTTCTGAAAGGTGGTATATCTGTCTCTTGCAGAGAAAGTCCTAAGACATCAGGACTTACAAGGTGCCCCAGTATTAATTTTCGCCAACAAACAGGTACACTGGCCTGGACGTCTCGAGTATTGAATTTAAATGTGAACTAGGGATCTTCTAGCCGACTCAATGAGTAAAGAGTACATTGTAATTTGGCACCGCTTAGCCACGTTTTATGTTATAAAGGGGAAAACCTGTCGAGTACCTAGCAGACTTAAGTACGTTATACTAAATATATCTCTTTCGTGGAATGCTCGCATTTTTTGTTCAATATGTAAGGAAATCGATTTGCAGTCTGGGAATCTAGGGTTGTGTATTTATAGTAGTCATTCCGGATTACCGTGACAACGAGGAACCCGGCTCTTGTGATCACACGGCTGTTGAATTTTTACATAACCTGTACATACTTGATTTATTTGGTGGATTTAGGATCTAGAAGGGGCTGTCTCTGCAAAAGAGATTGGAACTGCCTTGAACCTCAAAGAGCTAGAGGAGCGGGAGTCTATGGCCATGGCCATTTCTGCCTATGACGGGTAAGGTTTGTGTTAAACGTTATATTTAAGTTGTTATGTGTTATGATCTAGTGAGGTGGTCATATAATAATTTTTGTCTCTTCTTCGTTATGGATGACGCATTTAAGTTTTTAGTACTCATCAAAGCTGATGCTTCTCCGTACACAGATCTGGAATTAGGGAGGGAGTCACATGGCTTGTGGATGCTATGCGGACTTGCAAAAGAACGCAAGAGCTCAAACAACGTGCAGATGCAGCCGTAACGATGTAATTCCCAATTACAACTCAGCTGTCCATGTCCAATCTTCTGTATACAATTGTAAAATTCATATTATCAAAGGCAGTCCACAAGGGTACTTTCAGTCGTAAGTATCCATTCTTCAAGTGCAATTGCCAATTGGTTCCTGTGAGTTGTCCTAATAAAGTCATTCATTTTGGATCGCAATAGGAATATGCACGTCATAAAGGACGATACCAGTGTTTGGAGAAAGGAGAGGATTAAGAATCGTGTCTGGTGACTTTTGCATTTCGAGATGAGAACGAAGTGAGGCGCGTGGTCGGTGGACTAGGTGCACTTCCATGATTGCTGGAGCGCAGAAACTTCATACCAGTGGAGCTCTGTCGTATTTATTACTGTGCATTGTACGATTGCAAGTAGAGGCCGTGAAACTGTATGATGAGGCTGTAAGCTTTCTCCAATCGATTGTCTTGATATCGTACCCGGAGCAGATAGCAGAAGTTCTTTTTGTTACATGGGAGGATAGCTTCTGCATCAAAAAATCCTCATGATTTCTCGACACTCAGCCTAACACAGTGTAGGATTCCACAGATTGTGGAAATGATCATTTTTTACTTTCGTCCTCGAAAGTTACACTGCCCTTGAGATAAGGTTTTCTTGTTAATACACAGACAACACGTAGTTGATTTTAGGCCGGTCTCTGTGTTCCTTACTCGCCTGCAGACTGCCGTATAATCTGGAGGCAT

mRNA

>Mapoly0024s0084.2
CTACGGAGGGAGGGAGTCCTGGGGGGAGTGGAGGGGACGTTGCGGCAGCTAGCCTCTCCACTGCTTTGTGCTCGGCTATGCCATCTCGGTCCGAAGGATGTGGAGCTCGACTTGTCTCCACCTTGTCCCTGGGACATCAGGGCGGCCCCTGATTCGATCCGATTGTGCGCTTCGCTGAGTTTGCGTTTGCGTGACCTCTTTCCGGGCCTGGGCTTGGCTCGGGTTCCTTTCACTTGCAATACAGAGCACTACGCTTTCCTCTTGCCTTCCGATCCCTCGCCTTCCGTCGGGGGGTTGCTGGCTGCCCCTGCTTTGCCCGCCGAGTGCTCGCTCGATCGATTCCTCGGGCGGTGCGCTGTCATGCGAAGAATAGTTCGATCGCTCGTTCTCATGCTCGATTAGCCCCACTCCGAAGCAGTCGCAATTCCGACTCTACGTCTGCTCCTCATCGAACCTTAGCGCGCCACAGCGCAGCTGCTTCAGATGCCGAAGCTGCTGCTGCTTGCACCTCCAGCACCGTAGGCTTTGTTTCTTGCAAGAGGAGAGGCGAGGCGAGGCACGCCAGTCACCAGCTTACAGGAGATGCTGGCCAGGTTGTGGACTTAGATCAGATGCAGCAGCGGATGGAAACTTTAGGCCGTGGGATTCTTGAGGGAGGGTGCTATTGGAATTAGAGTGAGTGCCTATGTGATGGAAGAGATCCTGTGATTGACCCCATGGTTGGAGGAAAGGTGTAGAGACTGAGTAGACGAAGAGGGAAGGAAGAAAGGGAGGAAGAAGAAAGGAAAGGGAACAAGGAAGGAAAGAAAATATCTACCAGGTGCAGGACGCATCATGTTTTCGTTGCTGTATGGGCTGTGGAAGTACCTGTTTAGCAAAGCGGAGTTTCATGTGCTCATACTTGGCATCGATAAGGCTGGCAAGACGACATTGCTGGAGAAGTTGAAAACTTTGTACTCTGATTTCGAAGGTCTTCCACCAGATCGAATTGTCCCCACCGTCGGGCTCAACATTGGACGTATAGAGGCACACAAATCAAAACTTATTTTCTGGGATCTTGGCGGTCAGCTAGGGTTGCGAACAATCTGGGAGAAGTATTACGAAGAGGCTCATGCGATATTGTATGTTGTAGATGCAGCGAGTGAATCTCGCTTGGAAGACACAAAGTCAGCATTTGAGAAAGTCCTAAGACATCAGGACTTACAAGGTGCCCCAGTATTAATTTTCGCCAACAAACAGGATCTAGAAGGGGCTGTCTCTGCAAAAGAGATTGGAACTGCCTTGAACCTCAAAGAGCTAGAGGAGCGGGAGTCTATGGCCATGGCCATTTCTGCCTATGACGGATCTGGAATTAGGGAGGGAGTCACATGGCTTGTGGATGCTATGCGGACTTGCAAAAGAACGCAAGAGCTCAAACAACGTGCAGATGCAGCCGTAACGATGTAATTCCCAATTACAACTCAGCTGTCCATGTCCAATCTTCTGTATACAATTGTAAAATTCATATTATCAAAGGCAGTCCACAAGGGTACTTTCAGTCGTAAGTATCCATTCTTCAAGTGCAATTGCCAATTGGTTCCTGTGAGTTGTCCTAATAAAGTCATTCATTTTGGATCGCAATAGGAATATGCACGTCATAAAGGACGATACCAGTGTTTGGAGAAAGGAGAGGATTAAGAATCGTGTCTGGTGACTTTTGCATTTCGAGATGAGAACGAAGTGAGGCGCGTGGTCGGTGGACTAGGTGCACTTCCATGATTGCTGGAGCGCAGAAACTTCATACCAGTGGAGCTCTGTCGTATTTATTACTGTGCATTGTACGATTGCAAGTAGAGGCCGTGAAACTGTATGATGAGGCTGTAAGCTTTCTCCAATCGATTGTCTTGATATCGTACCCGGAGCAGATAGCAGAAGTTCTTTTTGTTACATGGGAGGATAGCTTCTGCATCAAAAAATCCTCATGATTTCTCGACACTCAGCCTAACACAGTGTAGGATTCCACAGATTGTGGAAATGATCATTTTTTACTTTCGTCCTCGAAAGTTACACTGCCCTTGAGATAAGGTTTTCTTGTTAATACACAGACAACACGTAGTTGATTTTAGGCCGGTCTCTGTGTTCCTTACTCGCCTGCAGACTGCCGTATAATCTGGAGGCAT

CDS

>Mapoly0024s0084.2
ATGTTTTCGTTGCTGTATGGGCTGTGGAAGTACCTGTTTAGCAAAGCGGAGTTTCATGTGCTCATACTTGGCATCGATAAGGCTGGCAAGACGACATTGCTGGAGAAGTTGAAAACTTTGTACTCTGATTTCGAAGGTCTTCCACCAGATCGAATTGTCCCCACCGTCGGGCTCAACATTGGACGTATAGAGGCACACAAATCAAAACTTATTTTCTGGGATCTTGGCGGTCAGCTAGGGTTGCGAACAATCTGGGAGAAGTATTACGAAGAGGCTCATGCGATATTGTATGTTGTAGATGCAGCGAGTGAATCTCGCTTGGAAGACACAAAGTCAGCATTTGAGAAAGTCCTAAGACATCAGGACTTACAAGGTGCCCCAGTATTAATTTTCGCCAACAAACAGGATCTAGAAGGGGCTGTCTCTGCAAAAGAGATTGGAACTGCCTTGAACCTCAAAGAGCTAGAGGAGCGGGAGTCTATGGCCATGGCCATTTCTGCCTATGACGGATCTGGAATTAGGGAGGGAGTCACATGGCTTGTGGATGCTATGCGGACTTGCAAAAGAACGCAAGAGCTCAAACAACGTGCAGATGCAGCCGTAACGATGTAA

Protein

>Mapoly0024s0084.2
MFSLLYGLWKYLFSKAEFHVLILGIDKAGKTTLLEKLKTLYSDFEGLPPDRIVPTVGLNIGRIEAHKSKLIFWDLGGQLGLRTIWEKYYEEAHAILYVVDAASESRLEDTKSAFEKVLRHQDLQGAPVLIFANKQDLEGAVSAKEIGTALNLKELEERESMAMAISAYDGSGIREGVTWLVDAMRTCKRTQELKQRADAAVTM

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>