Mapoly0029s0079



Description

Uncharacterized PHD Zn-finger protein

Reference DB

Database ID Description
GO GO:0005515 Protein binding
GO GO:0006355 Regulation of transcription, DNA-dependent
GO GO:0042393 Histone binding
KOG KOG1632 Uncharacterized PHD Zn-finger protein
OrthoMCL OG5_132765
PFAM PF00628 PHD-finger
PFAM PF12165 Domain of unknown function (DUF3594)
PANTHER PTHR12321 CPG BINDING PROTEIN

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpALFIN1 transcription factor, Alfin1-like Mapoly0029s0079.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0029s0079.1 scaffold_29:829218..834843  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0029s0079.1  

Gene structure:

mRNA scaffold_29:829218..834843  ( - strand )
three_prime_UTR scaffold_29:829218..829910  ( - strand )
CDS scaffold_29:829911..830183  ( - strand )
CDS scaffold_29:830605..830643  ( - strand )
CDS scaffold_29:832604..832739  ( - strand )
CDS scaffold_29:833571..833793  ( - strand )
CDS scaffold_29:833972..834004  ( - strand )
CDS scaffold_29:834467..834566  ( - strand )
five_prime_UTR scaffold_29:834567..834843  ( - strand )

Sequences:

Gene

>Mapoly0029s0079.1
CTCGGGTGCCTGATCTGCGAGTTGTGGTGGCAAAGAAGGGTTCTCGCGAGAAGGGTATTCAAGATGCGCAGTCGCCCGCTGGCTAGCTCTAGTGCGGCGTGGAGTCTTGTTAGCGATTTCTCTTCCCCCTCCTCTTGCAACCTCGTCTCGATTGAATTTGCGGCGCCTATCTTGAAGACTGTGTAGGTCGCACTGTCGTTTAGAGCACCGAGCGCGAGTTCGAAAGGCGGCGGGCTAACTTTCTTTGTAGGTGTGTTTTGAGAGCCCCTCGAGTGCAATGGAGGGAGGGTCGATGTCCACTGACCCTCGCACTGTGGAAGAAGTCTTCAAGGATTTCAAAGGCCGGCGAGCGGGAATGCTCAAAGCCCTGACCTCCGGTGAGTGTTGATGCCCGAGTCAACCTGCCTGGCTGCGTCCGATGCCAATCGCCTTCTCTGCCTGCCTCCTCTCGAGTCTCGTCGGATGTTTTCTTGTCGCCGACTGCAAGCTGCCTCTCGAGGTCGTCTGGCGACCTCGTCGCTTCGCTGATCTGGGTCTCTGCCAATTGACATAGACCGCGGTTCGGTGAAGTTCTTGGTCTCCGGAGTTGTCTGATGCTTTCCTTTCGCGCCTCTGATGCCTCTCTTTGTACCTTCCTCTGCGACGACTTCTCAACTGGGAAGTTTACAGTTCGGCCAGCAGGAATTGGTAGCTCGTCTTCAGTATAGCACAGTTGCTGTTTAAGGTCGTCAGGTCTTAACACGCTCGTCTCCTTTGCCGAGCCGTTTTTGTCAGTTTTCAACTTTGTTTTCAAAATCACCGCGGGAAACTGACGACATGTGTTCTGGTTGCATGTGCAGACGTCGAGGAATTCTTCCTCCAGTGCGATCCAGGTTGGCTTACAGATTTTGGAACTATATTCTTGACGTAATTGCTCTGAGTGTTTTGTTTTGACTAGTCTAAGTGACATGTGACCTGCTCAGTTCTCGTTGAACTCTGGTCGGATATATTGCGCCTTCCGCGACTCGTCGTTGTTGGTGACCGACGGGGTAATGTGATGTTTTTCTGCAGAGAAGGAGAATCTGTGTCTTTATGGCTTTCCTGACGAAGGATGGGAAGTCAATCTTCCTTCAGAGGAAGTACCACCTGAGCTCCCAGAGCCCGCTTTGGGGATCAACTTTGCAAGAGACGGCATGCTGCGGAAAGATTGGTTGTCACTTGTCGCCGTCCACAGCGACGCGTGGCTTCTTGCTGTCTCGTATTTTTATGGCGCTCGACTTGACAAAAATGAGAGGTGAGGGTCGGCGCCTGCTCCCGCGACGACACTTACTTTTAGGGTCTCCTGATCCCTGTTCTTGCTAGTCACTGTCGAATGTCGCCAATCTCCACAGCGATCGCGTTGACAAGTGAACAACTTGCTGGCTTGCTTCTCGATCTTGAGCTTAGAAGGACTGCCTTTTTTTATGTGAGCTGAGTGATAGGCCTTTGATGCCAACCCCGGATTGCACTCGACGATATTATACCGACACCTGCTTACTTATCTTCAAAGCTGTGGTTTGAATCAATTTAATTGTGTTGCCATCGGGAACTCCACCAATGTACGCGTTGGCAGCTTGCATTACAATTCGGAAGACGCAGTTTTACGAGCTGGCCTTGAAATGCATGGCACGGAGGCACTTGCTTTCTCGTTGGGGTTCTCCGCACTTTGAAAAGACACCTCATTTTCTCTTGGACATTTGCATTTTATTCAGAAACTTTCGCGCCGTGCCCTTGCACTCAGTGACATTTCCAGCCGCATTGCCGCCGCTCGAAATCGTTTTACCCCCACATGTCACAACTGACTGAATTTTTTATTAACGTTCTTCATGGAATCGTTTAATGTCTTGGGGTTTGAATCGTCTTTCCCTGTTTTGCTGAAGTCAGTTTTCAGCTCGTCATGAACTGCACTTTAGTTAAATTGGTGTTGGTCGTGAATCCCAAGATTTTCATCGTCAAACTCCTCTGTTCCGTCTGTAGTCAGAGAATTCTCTTCCGTACAGGTGCATGAAGAGGATGTCGAGTTTTATTGTTCATACATGTTGCGTGGTCTGACTTAGATGTTAACTTTTTCTCGTGTATTTTGCAGAAAACGGTTATTCAACATGATAAACGAGCTGCCCACTGTTTTTGATGTGGTCACTGGGAAGAAGCCCGTGAAGGAGAAAACTAGTGTGAACAACACTGGTGGTGGAAACAAGGCCAAGTCCACTGGTTCGAAAGTGGTAGGTCGCTCATTGTCTTAAGAGATGAGTCTCACCAGCTTGACGCCATTGGTGACAAGACTCTAATTGGGTCAAATGTGGTGGTGAATCCGTCGTTCAATCAGTACATATTGGAAATTCAGCTTGAAGGGAATATGTTTTCTAGTTTAAATATAATTGAGGGATGGGTAAGGACTACTTGCCCAGTGCTGAGGTTTTGGCACTGTCGGGATTCAAAGGGATCTTCAAAGTTTCCATTGCAATTCCACTGATGTGGAAAAGCGGACGTATTTGTGGACATGCATTAAGACGTTTACGGTTCTGTGGTATGAAATCGTGGAATTCGCTCCGAACGACATATTTCTTACACTATTGCACATCCTACCCGTTTATGGGAGATCGACGTCCACGTGAAGCCGGTTTCGTTGCTCACAGTCGTATCATAGAATTCATTACTTTCAGTTTGAATTCGTCCCATCCAGTCATAGATCTTGCAGTATCTGCTGGAGGAAGACAGGAACCAATTTAATCACGAATGGCTACTCAATCAGTAAGCAGCAGCTATTGAGAGGGACCTTTGACTATTTGGAGGGGATATTAGTTATATATAATTGAAGTATTTGCAGTTTCCCGTTGTGGTTCTGTGAGCACGTTAGAAGGATCTAACTCTGAGCGCTACTTGCTCTCGTGAGGCGCCAGTTGCGATTCACGAGGGCCAGGTCCAAACTAGACCTTGTCGCTTTTTCACCTCAACAGGAAGCACACCATTGTGCGTTTGCGCTTTCCCCACCCTTTTCTCGGGTGAACTGGGTAGCGAGTTGACAAGAAGATAAGTGCGATTCGCCAGGTGGGCCCATCTCGCGTGACACTATCAGCGCTTACGCGGTGCTGTTGAGGAGTCAAAAGAATTTGGCTTCCGTGCTCTCAACCGTGTTTTTCTAACATGCTACGGTCTTTTTCCATGCTCGGCATCTCGGCTCTCTTCTGAGGCCTGCATTTGAATGAAGAGGAAGCATTTTTGTTTACATTGCCGCTTTGCAAGTAGCTTCTCATCTTAGGTGTACGTATTCTCACGTCTAGCTACACGTCAGAAGAGGTCATAGTTCTAGAACCGAAAGGCTATGTCTGCCGTCCTGCTCTTTCCTTGCGCCAGTCATTTATTAGCATCAGTTCATGCATCTAAACATTGCTCAGGTCTCTTTGCTTTATTTTTGGTTATACCAGAAAGTTTGGCAAGTCACTTATGCTGATAGCTACCTGGTCCTTATCCACCAGCTTACCAAACTAGTTGGTTTCACTATTCCGTCTGATTACTCTGCAGGTCGATGTCGATGAGTCTCTTCCTGACTTTTCGTGTTGGCCGATTGCTTTTCCTCCCCTATTATTATGTCCCTAGGTTGTGCTTTCCACTATTTCCTACATCCCCACCATTTTCTCATCCATTGGAGCGATTTCGGTACTTCGAAAGCAGGGCTGTGTTTAGACGACATGATAGATTAAATTAAGGTCCTGGGTCGTTCATCTATTTCACTTGTAAATTTTTATCTGTCGACCTTACCATGCAGTATAGTCGGTATTTAGATTGGGTATCTTATCTTACTCACGAATCTTTTCTCCAAATTTGTATGCTTTAGCACCATCATCAGGTCCGTTTATTGCACATTGTCGTGAACTAAGATTTTTAATCAGTAGATTGCAAAATTGCACCATTCTCGAAAATCCACGTCGTTTCGAGTATTGTTCTGTAAGGCTTTAATCTTGACATCTTGTGTTACGAACGAGTTCAGTTGTCGACAGCTAGCATTTTTAACTGCAGAGTTCCTTGATGTATCTGTACGTTGTTAGAGTCAGCTTTGCCGAGACGCCGTTTCTCCACATACGAATGAGTATTGTATTGTGATTTTTGTTATCTTTTTTCAGGGCTAGACTAATGTTCCTAAATTCTGACCTTTCTATCTGTGGCTTTGTCCTGCACGAGTAGACGACTTCTCATCACGATAACCTGAAGGCAAATATGCATGTACGAACATCTTCTAATGTTTTAAAAAGTTGTGAATGTTGTTGGTACGCTTATAGTGACTATGTTATCAGCTATTTCTCGATCGACTTTTTGAATCAAACAGCTTTGACAGTCCTCCGAAGCTTTTTACAAAGTTGCAGTACAAGTCGTGGAAGTCATCCCACTGTCTTTTCGTTTTTGATGATTCTTTTTGAATGTCACGGTGTGGAAGATTGTCAGCCATTTTTTTTGTTTGGTTTTTGTTATAGTATAAGTGGTATGGGCCTCCTCGCAAGTTGGATGCCTGTCCCTTGGACCTCAGTGAGGTTGCCATCTCCCGTTCCGCATACTTTTATAGCTGTCGAGGTGAATGACGTTATAGATCTATCAAAGTTGACGCTGCGAGAATGGTGTCGCTTATTTTGTTGTCTTCATGTCGCAGCAGCGAGCCGCTGAAGTTCAGGCCAAACCCCAAAAGCCTCCTCCAGCTCCTCCTAAGGACGAAGAAGAAACTTTGGAAGAGGACGATGAGGAGCACGGCGACACGTTCTGTGGAAGCTGTGGAGGAAACTATACCGCCGATGAGTTTTGGATAGGCTGTGATAGCTGTGAAAAGTGGTTCCACGGAAAATGTGTGAAGATAACTCCAGCGAGAGCAGAGCACATTAAACACTACAAGTGTCCGTCGTGCAGCAACAAAAGGGCGCGTACGTAATGTACTGGGCTGCAGTTATTTTGTAGCTTTAGGGGCAAGTGCCTTCCGCAACAGTACCCTTGTAATGACACGCATTGTTCTTGGCCGCTAGCCGTGGGCAGCCCGTGGGGTACAGCATTTTCTACACAAGTTTCTCAATTGATTTTGGAAGGGGGAGGGCTGGTAGCCACTATCATTCGTAGTGTAGGATAGGCAACCTACATGACATCTCCACCGGGATCAGTGGCCCTGAGTCTGTAATCTTTGTTAGTAATCTCAATACTCTTTGTCTTACCGCTCATCTCTGTAAGACTTCTGGTGTGCATGGGCTCTGCACACGTTTTTAAGTTTCAAGAAGTTAACCTAGTTTCGGTCGATCAGGTGGTCTAAACTTGCATCTAAAGTTGTTGGGCTTGGTTCTCCTTCTTTGTTTGCCATGTACTTAAGTTCCCCGAGGCATGCCCGATATTAGCGGAATGATGATTGGCTGAGTCGTGCTGTGCTACATTTGCTGTGCAGCCTCGCAGCTCTCATGACCAACTATGACGGGCTTTCGTGGCTGCCTGCATGATCGTTCAGCCGAGTGGATTTGCATTCTACGCACAAGACCTGGCAACTAGGCTTCAGGAATATATGCAGAAGGTGATACAGATTGTAAATGGATTGGATGGACCATTTATGTGAAGCTCTGTGAATAATTCTTGTAAACTTTGG

mRNA

>Mapoly0029s0079.1
CTCGGGTGCCTGATCTGCGAGTTGTGGTGGCAAAGAAGGGTTCTCGCGAGAAGGGTATTCAAGATGCGCAGTCGCCCGCTGGCTAGCTCTAGTGCGGCGTGGAGTCTTGTTAGCGATTTCTCTTCCCCCTCCTCTTGCAACCTCGTCTCGATTGAATTTGCGGCGCCTATCTTGAAGACTGTGTAGGTCGCACTGTCGTTTAGAGCACCGAGCGCGAGTTCGAAAGGCGGCGGGCTAACTTTCTTTGTAGGTGTGTTTTGAGAGCCCCTCGAGTGCAATGGAGGGAGGGTCGATGTCCACTGACCCTCGCACTGTGGAAGAAGTCTTCAAGGATTTCAAAGGCCGGCGAGCGGGAATGCTCAAAGCCCTGACCTCCGACGTCGAGGAATTCTTCCTCCAGTGCGATCCAGAGAAGGAGAATCTGTGTCTTTATGGCTTTCCTGACGAAGGATGGGAAGTCAATCTTCCTTCAGAGGAAGTACCACCTGAGCTCCCAGAGCCCGCTTTGGGGATCAACTTTGCAAGAGACGGCATGCTGCGGAAAGATTGGTTGTCACTTGTCGCCGTCCACAGCGACGCGTGGCTTCTTGCTGTCTCGTATTTTTATGGCGCTCGACTTGACAAAAATGAGAGAAAACGGTTATTCAACATGATAAACGAGCTGCCCACTGTTTTTGATGTGGTCACTGGGAAGAAGCCCGTGAAGGAGAAAACTAGTGTGAACAACACTGGTGGTGGAAACAAGGCCAAGTCCACTGGTTCGAAAGTGACGACTTCTCATCACGATAACCTGAAGGCAAATATGCATCAGCGAGCCGCTGAAGTTCAGGCCAAACCCCAAAAGCCTCCTCCAGCTCCTCCTAAGGACGAAGAAGAAACTTTGGAAGAGGACGATGAGGAGCACGGCGACACGTTCTGTGGAAGCTGTGGAGGAAACTATACCGCCGATGAGTTTTGGATAGGCTGTGATAGCTGTGAAAAGTGGTTCCACGGAAAATGTGTGAAGATAACTCCAGCGAGAGCAGAGCACATTAAACACTACAAGTGTCCGTCGTGCAGCAACAAAAGGGCGCGTACGTAATGTACTGGGCTGCAGTTATTTTGTAGCTTTAGGGGCAAGTGCCTTCCGCAACAGTACCCTTGTAATGACACGCATTGTTCTTGGCCGCTAGCCGTGGGCAGCCCGTGGGGTACAGCATTTTCTACACAAGTTTCTCAATTGATTTTGGAAGGGGGAGGGCTGGTAGCCACTATCATTCGTAGTGTAGGATAGGCAACCTACATGACATCTCCACCGGGATCAGTGGCCCTGAGTCTGTAATCTTTGTTAGTAATCTCAATACTCTTTGTCTTACCGCTCATCTCTGTAAGACTTCTGGTGTGCATGGGCTCTGCACACGTTTTTAAGTTTCAAGAAGTTAACCTAGTTTCGGTCGATCAGGTGGTCTAAACTTGCATCTAAAGTTGTTGGGCTTGGTTCTCCTTCTTTGTTTGCCATGTACTTAAGTTCCCCGAGGCATGCCCGATATTAGCGGAATGATGATTGGCTGAGTCGTGCTGTGCTACATTTGCTGTGCAGCCTCGCAGCTCTCATGACCAACTATGACGGGCTTTCGTGGCTGCCTGCATGATCGTTCAGCCGAGTGGATTTGCATTCTACGCACAAGACCTGGCAACTAGGCTTCAGGAATATATGCAGAAGGTGATACAGATTGTAAATGGATTGGATGGACCATTTATGTGAAGCTCTGTGAATAATTCTTGTAAACTTTGG

CDS

>Mapoly0029s0079.1
ATGGAGGGAGGGTCGATGTCCACTGACCCTCGCACTGTGGAAGAAGTCTTCAAGGATTTCAAAGGCCGGCGAGCGGGAATGCTCAAAGCCCTGACCTCCGACGTCGAGGAATTCTTCCTCCAGTGCGATCCAGAGAAGGAGAATCTGTGTCTTTATGGCTTTCCTGACGAAGGATGGGAAGTCAATCTTCCTTCAGAGGAAGTACCACCTGAGCTCCCAGAGCCCGCTTTGGGGATCAACTTTGCAAGAGACGGCATGCTGCGGAAAGATTGGTTGTCACTTGTCGCCGTCCACAGCGACGCGTGGCTTCTTGCTGTCTCGTATTTTTATGGCGCTCGACTTGACAAAAATGAGAGAAAACGGTTATTCAACATGATAAACGAGCTGCCCACTGTTTTTGATGTGGTCACTGGGAAGAAGCCCGTGAAGGAGAAAACTAGTGTGAACAACACTGGTGGTGGAAACAAGGCCAAGTCCACTGGTTCGAAAGTGACGACTTCTCATCACGATAACCTGAAGGCAAATATGCATCAGCGAGCCGCTGAAGTTCAGGCCAAACCCCAAAAGCCTCCTCCAGCTCCTCCTAAGGACGAAGAAGAAACTTTGGAAGAGGACGATGAGGAGCACGGCGACACGTTCTGTGGAAGCTGTGGAGGAAACTATACCGCCGATGAGTTTTGGATAGGCTGTGATAGCTGTGAAAAGTGGTTCCACGGAAAATGTGTGAAGATAACTCCAGCGAGAGCAGAGCACATTAAACACTACAAGTGTCCGTCGTGCAGCAACAAAAGGGCGCGTACGTAA

Protein

>Mapoly0029s0079.1
MEGGSMSTDPRTVEEVFKDFKGRRAGMLKALTSDVEEFFLQCDPEKENLCLYGFPDEGWEVNLPSEEVPPELPEPALGINFARDGMLRKDWLSLVAVHSDAWLLAVSYFYGARLDKNERKRLFNMINELPTVFDVVTGKKPVKEKTSVNNTGGGNKAKSTGSKVTTSHHDNLKANMHQRAAEVQAKPQKPPPAPPKDEEETLEEDDEEHGDTFCGSCGGNYTADEFWIGCDSCEKWFHGKCVKITPARAEHIKHYKCPSCSNKRART

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>