Mapoly0031s0074



Description

MYC

Reference DB

Database ID Description
OrthoMCL OG5_170445
PANTHER PTHR11514 MYC
PANTHER PTHR11514:SF29

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpBHLH36 transcription factor, bHLH Mapoly0031s0074.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0031s0074.1 scaffold_31:538172..539700  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0031s0074.1  

Gene structure:

mRNA scaffold_31:538172..539700  ( + strand )
five_prime_UTR scaffold_31:538172..538418  ( + strand )
CDS scaffold_31:538419..538910  ( + strand )
CDS scaffold_31:539039..539485  ( + strand )
three_prime_UTR scaffold_31:539486..539700  ( + strand )

Sequences:

Gene

>Mapoly0031s0074.1
GAGGACTCTCCGCTGGTATTCAAGCTTTTACGAAACTCTCTGAGCTGGAAAAGATCCTTGAAGAACATGCTTTGAAAGACAAGTCGCTTGCGGATGTCTTCAATCTTCTCCAGCATCCTTCACATTCAATAAGTCCTCATGTTCTGCTCGGCTAGCATTTGCCTCGAGCGCTGGATCAGTGTACTCAAGTGTTTCTACTTTCAAAAGAGCTACCGGGTCAGTGAGTTCTTGTGAAGTGCAGGTTCCGATGCAAAATGTACATAGTTGTCAGCTGATGGACGGTGGGAAAAATTTGAGCTCCTTCTGTGGTACTGGTATACAAGCTCCTGCAGTGGCATATCCAAGGCCATCTTCCGAGTTCGAAATTTCCAACACTGTTTCAGGTGGTACCTCAAGATCTTTTTCCAATCTCTTCAATTACAACTCTCCTGCGGCTAGTGGCCCTGGGTTTTTCTCGACGATAGATCTTCCTCCAACCAAGTTCGGTCGCAACGTTGATCTACTGCAAATGGATTATGGTCATAACGAGGAGCTTCAAGATGTTGTCAGTGCTGCTCAGATGACAACAGCGTCTCCTTTTCTCCCTGAGATATCAAGTCGAGCCATAAGCGCTGCTGGAACGCTAACTAACCAAGCTGAGCAAAAACCACTGAACCATTTTCTCACTTGGAAAAAAAAACTGGAAGATTTGAATGAGAAGTATCAGACCCTGCGATCTTTGGTTGCAAACCCTACAAAGGTCCGTCTACAATCTTTGTATTCTTCTACGGATCTTATGGTTCCCATTCTATTTCTTCACGATCGTTTCTACCATATGCATGTGCATACTGAATGAAATGATCCTAATTCTTTGTTGTATGTCTGTAGGCTGATCGAGTTTCCATTCTCTCAGATGTTATCAACATGATACATGATCTGAAAAAAGAAGAAGAAAGTTTGCTGGATGAAAAGCAGAAAAGGCAGCATCGGAGACAGTTGAGACTTGAGATGAGAGCCAATGGAAAACGTCAGAGAACGATGGAATCTGAAACAGGTGTCAAAGAAGTACAAAGCTTGTCTATGGAAGCACTGTGCAACAGAAAGGTTTCCAAAAATGGGACGGAGATCGAAGTTCGCATAGTTTGTGATGAGGTGGATATCCACATCAGCCAGAAACATATGCCCCGATTTCTTATCCGAGTCATCACAGCGATAGAAGGAGGATTGAAGCTTGAAATCCTTGATTGCTGTGGCGGTGTTATACACAATTGTGATGTTTACAGATTCAGACTTAAGGTACTTCATATACATCCGAGAGAATGTGGACAGATTTAGTGAGGAATGGAAACCAAGTTTTTCATATCCTGCGCAGATTCTGCATATATACTTGAAGTTTTAGAAGTTAAGAGCTCGAGTAGCTTGTATCTGGAGCAGTGTATCTGTTGACTAAGAAATGTAATATTTTTTTGCCAGATTCAAGGACATTCGTGCAAGTTCATGGAAGGAATCATGACAAAACTCCTAGATATATTTGATGCAGTTTTTTAAGG

mRNA

>Mapoly0031s0074.1
GAGGACTCTCCGCTGGTATTCAAGCTTTTACGAAACTCTCTGAGCTGGAAAAGATCCTTGAAGAACATGCTTTGAAAGACAAGTCGCTTGCGGATGTCTTCAATCTTCTCCAGCATCCTTCACATTCAATAAGTCCTCATGTTCTGCTCGGCTAGCATTTGCCTCGAGCGCTGGATCAGTGTACTCAAGTGTTTCTACTTTCAAAAGAGCTACCGGGTCAGTGAGTTCTTGTGAAGTGCAGGTTCCGATGCAAAATGTACATAGTTGTCAGCTGATGGACGGTGGGAAAAATTTGAGCTCCTTCTGTGGTACTGGTATACAAGCTCCTGCAGTGGCATATCCAAGGCCATCTTCCGAGTTCGAAATTTCCAACACTGTTTCAGGTGGTACCTCAAGATCTTTTTCCAATCTCTTCAATTACAACTCTCCTGCGGCTAGTGGCCCTGGGTTTTTCTCGACGATAGATCTTCCTCCAACCAAGTTCGGTCGCAACGTTGATCTACTGCAAATGGATTATGGTCATAACGAGGAGCTTCAAGATGTTGTCAGTGCTGCTCAGATGACAACAGCGTCTCCTTTTCTCCCTGAGATATCAAGTCGAGCCATAAGCGCTGCTGGAACGCTAACTAACCAAGCTGAGCAAAAACCACTGAACCATTTTCTCACTTGGAAAAAAAAACTGGAAGATTTGAATGAGAAGTATCAGACCCTGCGATCTTTGGTTGCAAACCCTACAAAGGCTGATCGAGTTTCCATTCTCTCAGATGTTATCAACATGATACATGATCTGAAAAAAGAAGAAGAAAGTTTGCTGGATGAAAAGCAGAAAAGGCAGCATCGGAGACAGTTGAGACTTGAGATGAGAGCCAATGGAAAACGTCAGAGAACGATGGAATCTGAAACAGGTGTCAAAGAAGTACAAAGCTTGTCTATGGAAGCACTGTGCAACAGAAAGGTTTCCAAAAATGGGACGGAGATCGAAGTTCGCATAGTTTGTGATGAGGTGGATATCCACATCAGCCAGAAACATATGCCCCGATTTCTTATCCGAGTCATCACAGCGATAGAAGGAGGATTGAAGCTTGAAATCCTTGATTGCTGTGGCGGTGTTATACACAATTGTGATGTTTACAGATTCAGACTTAAGGTACTTCATATACATCCGAGAGAATGTGGACAGATTTAGTGAGGAATGGAAACCAAGTTTTTCATATCCTGCGCAGATTCTGCATATATACTTGAAGTTTTAGAAGTTAAGAGCTCGAGTAGCTTGTATCTGGAGCAGTGTATCTGTTGACTAAGAAATGTAATATTTTTTTGCCAGATTCAAGGACATTCGTGCAAGTTCATGGAAGGAATCATGACAAAACTCCTAGATATATTTGATGCAGTTTTTTAAGG

CDS

>Mapoly0031s0074.1
ATGCAAAATGTACATAGTTGTCAGCTGATGGACGGTGGGAAAAATTTGAGCTCCTTCTGTGGTACTGGTATACAAGCTCCTGCAGTGGCATATCCAAGGCCATCTTCCGAGTTCGAAATTTCCAACACTGTTTCAGGTGGTACCTCAAGATCTTTTTCCAATCTCTTCAATTACAACTCTCCTGCGGCTAGTGGCCCTGGGTTTTTCTCGACGATAGATCTTCCTCCAACCAAGTTCGGTCGCAACGTTGATCTACTGCAAATGGATTATGGTCATAACGAGGAGCTTCAAGATGTTGTCAGTGCTGCTCAGATGACAACAGCGTCTCCTTTTCTCCCTGAGATATCAAGTCGAGCCATAAGCGCTGCTGGAACGCTAACTAACCAAGCTGAGCAAAAACCACTGAACCATTTTCTCACTTGGAAAAAAAAACTGGAAGATTTGAATGAGAAGTATCAGACCCTGCGATCTTTGGTTGCAAACCCTACAAAGGCTGATCGAGTTTCCATTCTCTCAGATGTTATCAACATGATACATGATCTGAAAAAAGAAGAAGAAAGTTTGCTGGATGAAAAGCAGAAAAGGCAGCATCGGAGACAGTTGAGACTTGAGATGAGAGCCAATGGAAAACGTCAGAGAACGATGGAATCTGAAACAGGTGTCAAAGAAGTACAAAGCTTGTCTATGGAAGCACTGTGCAACAGAAAGGTTTCCAAAAATGGGACGGAGATCGAAGTTCGCATAGTTTGTGATGAGGTGGATATCCACATCAGCCAGAAACATATGCCCCGATTTCTTATCCGAGTCATCACAGCGATAGAAGGAGGATTGAAGCTTGAAATCCTTGATTGCTGTGGCGGTGTTATACACAATTGTGATGTTTACAGATTCAGACTTAAGGTACTTCATATACATCCGAGAGAATGTGGACAGATTTAG

Protein

>Mapoly0031s0074.1
MQNVHSCQLMDGGKNLSSFCGTGIQAPAVAYPRPSSEFEISNTVSGGTSRSFSNLFNYNSPAASGPGFFSTIDLPPTKFGRNVDLLQMDYGHNEELQDVVSAAQMTTASPFLPEISSRAISAAGTLTNQAEQKPLNHFLTWKKKLEDLNEKYQTLRSLVANPTKADRVSILSDVINMIHDLKKEEESLLDEKQKRQHRRQLRLEMRANGKRQRTMESETGVKEVQSLSMEALCNRKVSKNGTEIEVRIVCDEVDIHISQKHMPRFLIRVITAIEGGLKLEILDCCGGVIHNCDVYRFRLKVLHIHPRECGQI

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>