Mapoly0031s0075



Description

Helix-loop-helix DNA-binding domain

Reference DB

Database ID Description
GO GO:0046983 Protein dimerization activity
PFAM PF00010 Helix-loop-helix DNA-binding domain

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpBHLH50 transcription factor, bHLH Mapoly0031s0075.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0031s0075.1 scaffold_31:542943..546065  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0031s0075.1  

Gene structure:

mRNA scaffold_31:542943..546065  ( - strand )
three_prime_UTR scaffold_31:542943..543171  ( - strand )
CDS scaffold_31:543172..543243  ( - strand )
CDS scaffold_31:543341..543748  ( - strand )
CDS scaffold_31:544203..544355  ( - strand )
CDS scaffold_31:544687..545721  ( - strand )
CDS scaffold_31:546060..546065  ( - strand )

Sequences:

Gene

>Mapoly0031s0075.1
ATGCAGGTTTAAATTTCTAAGAGTTACCACCACCACTGTATCGATCTGTTAGCAAAAGATAGACAGACCCTCGTTGATCTCATCAAGAATGTTATTGTACCACGGTCAAGTGGTACGTTGAGCTGGATTGAATGTACCCATATTGTACGTGGAGTTGCCTCCTTACAAGTTTGTTTCTCTTGATGCCATGATGGTAACTTCTTCACTGATGTCTGGAGCTTGTTCAGCTGGGTTCAATATACGTATCCAATGAAAGTAGTTGCTTCATGACAGCTTTGATGTTTTGAAGGCTTCGAGTCCAAGCTTGTTGGCTGATGTCTGCAGCTCGTAAACCTGTGTGGCAGCTCCAGTTGGCAGCAAGGCTGAACAACCATTTTCCTTCTGTCCACTACTCTCAAGAAGGATTTGAACAGTCTCCCTCAGCTGCGCAGCCAAAGAATTACGACTGTGAAGTCAGTGATACATCGGCCTTGTACTTACGAGGAGATAATTGTAGCAACAACGACTCTAACCACTTTTCAGAGCTGGATCAACTTGCTCAGAGGATGAACACAGGAGAAGGTGGTCTTCAGTATGTGCGGAATAGTATAGGGGAGAAATCCTCGCTCGGATTGTCTCATGGTCATTCGAGTCAAGACCATGGTGCTCAGTGCGTCAATCTGGACTCTGAGTTTTCCCAGAGAAACAAGGTTTACTCATCAAACCACACGTTGGCCAGTCATCAACAAATCATTCAAGAACCAGTGATCATCTACGAGTTTCCACAAGAACAGGAGAGGCCCGGACATCTATACATGATGAACACATACGGTTCAACTTGTGCAACTAATATTCCGTCGCAGGCGTCTAAAATGCACAATCAAGATTATCACAATATTGCAGTCCAGCATGATTTTGAGCAGGATCTCGCGCTCAACAGATTGACAGACTTGATCCAGCTCCAAGGGACTACATTCATGAAGGAATATCAACCACAACATGTACAAGCTCATCAAAGGCACTTGTCATTGTTCAACAATAACCCAAGCGAGATTCGAGGACGATCATGTCAAGGAGATCTTCAAGAGATAAACAGACAGAGTACTGGCGGTGAGATTGCCGCATGGGAGGGGATCAATAAGACCAATGAAGATATGTTTCATCAACAGGAGCAGTACGATCAACAACAAGCTTTCCTTAACTTTCTGAGATTTTCCAATGCCCCTCATGGAGGAAGCAAGTTTTCCCGACGTGACAGTGTGGATGGAAAGTCATTATACAGGAGAAGCAAGAGTCCTGAAGATGAACATGAGCTGCTAGAACTATTTGACGGGCGTTCCAGTGGATCTGTGACCGTCGCTGCAACTGCGGTTCTCCACAGCGAGGCCAGCGCTGTTAATGTAAGCGACACTGCTCGCTCCCTTCCTGATGCTTCAGAAGCTTGTTATCGTACACCGGCTCATATTGCTGAAAGTGAAGTAGAATTATCAAAGTTTACTGACTGAGAAACACTTCCTTCCGAGCTTGGTCATACCTTCTCCAAATCTATGACTTATTCTTGCAGCTGTCACCAAAAAAATACTGGAAATAATTCAGTCGTCTTGTCTAGAAGTAGAACCTCATTCTAACACCAAGGAAGCGTTTACATCTTGATGCCAAGCTGCTTCTAGTTCGGAGTTGGAGTTTAACTATAATACAACTGCCCCACGATCTTCTGTATTCTTTGATCAGCCAAGAACGAGCTACGATGATTGCGTTCAAATAAGATCGCTACCAGCAGTCGAGCCAAGAATGAAACAAGTCTTCAGAACAGAGAAACAGAGGAGAGACTTCATCAAAGAGAGGTATAAGACATTGCAGTCTTTGGTTCCCAGATACTCCAAGGTAAAGGCTGGAACCTCTTAAGTATGATTCTCACGTCTATAGTGATTTATGACATATACCAGTGCAATGATCATGGATGTATAAACGTAAATGTGGCTTAGATTTTGCCTTCTTCTGTTAACGAGGATATGTCTTGTTCTGCCTGATTCATTTAATGACTAGCACATATGCTTTTCTGTTCATTCTCTAGCCGTTGGTTTTTTCCCTTGATTCTCATTTCGGCCAATAGCTAATTAGCTTCTACAGGCAATCCATCTACTCAGCCAAGGCAACTGGGCTCCCAGTTTTTTTTAAACATCTAGGGGTTATCGGGTTCCTGGCTACAGTTTGTTTTTAATTGTTTCGGCTACAGTTCTGTTCTGTTTTATGCTAATTTATATCTTAGAATCTTGAGTGAGCCATAAAGATGTACAGCATCTGCAGTTGATTTCTAAGTTGAATGTCATTGATGCAGACTGATCGTGCTTCTATTGTGGGAGATACCATTAACTATATTCATGTACTACGAAAGCAAATCAGAGAGCTGACCCTGAAGAAAGAGAAGAGGCGAGAAAGAAAGATAATTGAGAGGAGCCAAACAACTGGGGAAGGTTGTGCAGAGTCTCACGACGAGAGACCAAGAAACTATGAAAGAGCCCTTTCAGAATTCCGGATCTCCGATGAAAATGAACTACGATTGGCATCTAAGCGTGGAGCAGCTATAAAGTTTCAGCTCACTGCTGATGAGCTGCATGTTAATATAGTGCAAAAACGTGAGCCGTATTTCCTCAATCGCTTTCTGGCTTCTCTTACTCGATTTGATCTGGTCAACTCTTCGGGTGGCATAATTGACAATCATCACATCCAGAGTTTCATTCTCAAGGTACGCTTCTTCGTTCTTCTTAATCTAGTTTTCACGGTTTAGAGTGTCTACCCCACACATTGTTGTGAATTAACTATCTTTATTTGTTTTCATGCAGATCAAGGGCAACTTACGACAAGTCTCCGTTAAGCTGATAAACAACATTATGGATACTTTAGATCAGATCTGAATTCTAGAATTTATACTTTGAATGCCCATTTTCGCTATTTATACATTATTTAATTATAGGTTTGGAATCTACGAACATGACAAATTCATATTTACTCTAAGCTCGTCTCAAGTTTTCCCGTAGATTCTACTTGTTTGTAATATTAGTTATTGAAATTTAGCGAGAGAAGAGCTCTGTATCCAAAACTCATGCTCGCTTTTCAATATTATTCAACGTCCTCTACGATTCA

mRNA

>Mapoly0031s0075.1
ATGCAGCTCCAGTTGGCAGCAAGGCTGAACAACCATTTTCCTTCTGTCCACTACTCTCAAGAAGGATTTGAACAGTCTCCCTCAGCTGCGCAGCCAAAGAATTACGACTGTGAAGTCAGTGATACATCGGCCTTGTACTTACGAGGAGATAATTGTAGCAACAACGACTCTAACCACTTTTCAGAGCTGGATCAACTTGCTCAGAGGATGAACACAGGAGAAGGTGGTCTTCAGTATGTGCGGAATAGTATAGGGGAGAAATCCTCGCTCGGATTGTCTCATGGTCATTCGAGTCAAGACCATGGTGCTCAGTGCGTCAATCTGGACTCTGAGTTTTCCCAGAGAAACAAGGTTTACTCATCAAACCACACGTTGGCCAGTCATCAACAAATCATTCAAGAACCAGTGATCATCTACGAGTTTCCACAAGAACAGGAGAGGCCCGGACATCTATACATGATGAACACATACGGTTCAACTTGTGCAACTAATATTCCGTCGCAGGCGTCTAAAATGCACAATCAAGATTATCACAATATTGCAGTCCAGCATGATTTTGAGCAGGATCTCGCGCTCAACAGATTGACAGACTTGATCCAGCTCCAAGGGACTACATTCATGAAGGAATATCAACCACAACATGTACAAGCTCATCAAAGGCACTTGTCATTGTTCAACAATAACCCAAGCGAGATTCGAGGACGATCATGTCAAGGAGATCTTCAAGAGATAAACAGACAGAGTACTGGCGGTGAGATTGCCGCATGGGAGGGGATCAATAAGACCAATGAAGATATGTTTCATCAACAGGAGCAGTACGATCAACAACAAGCTTTCCTTAACTTTCTGAGATTTTCCAATGCCCCTCATGGAGGAAGCAAGTTTTCCCGACGTGACAGTGTGGATGGAAAGTCATTATACAGGAGAAGCAAGAGTCCTGAAGATGAACATGAGCTGCTAGAACTATTTGACGGGCGTTCCAGTGGATCTGTGACCGTCGCTGCAACTGCGGTTCTCCACAGCGAGGCCAGCGCTGTTAATCCAAGAACGAGCTACGATGATTGCGTTCAAATAAGATCGCTACCAGCAGTCGAGCCAAGAATGAAACAAGTCTTCAGAACAGAGAAACAGAGGAGAGACTTCATCAAAGAGAGGTATAAGACATTGCAGTCTTTGGTTCCCAGATACTCCAAGACTGATCGTGCTTCTATTGTGGGAGATACCATTAACTATATTCATGTACTACGAAAGCAAATCAGAGAGCTGACCCTGAAGAAAGAGAAGAGGCGAGAAAGAAAGATAATTGAGAGGAGCCAAACAACTGGGGAAGGTTGTGCAGAGTCTCACGACGAGAGACCAAGAAACTATGAAAGAGCCCTTTCAGAATTCCGGATCTCCGATGAAAATGAACTACGATTGGCATCTAAGCGTGGAGCAGCTATAAAGTTTCAGCTCACTGCTGATGAGCTGCATGTTAATATAGTGCAAAAACGTGAGCCGTATTTCCTCAATCGCTTTCTGGCTTCTCTTACTCGATTTGATCTGGTCAACTCTTCGGGTGGCATAATTGACAATCATCACATCCAGAGTTTCATTCTCAAGATCAAGGGCAACTTACGACAAGTCTCCGTTAAGCTGATAAACAACATTATGGATACTTTAGATCAGATCTGAATTCTAGAATTTATACTTTGAATGCCCATTTTCGCTATTTATACATTATTTAATTATAGGTTTGGAATCTACGAACATGACAAATTCATATTTACTCTAAGCTCGTCTCAAGTTTTCCCGTAGATTCTACTTGTTTGTAATATTAGTTATTGAAATTTAGCGAGAGAAGAGCTCTGTATCCAAAACTCATGCTCGCTTTTCAATATTATTCAACGTCCTCTACGATTCA

CDS

>Mapoly0031s0075.1
ATGCAGCTCCAGTTGGCAGCAAGGCTGAACAACCATTTTCCTTCTGTCCACTACTCTCAAGAAGGATTTGAACAGTCTCCCTCAGCTGCGCAGCCAAAGAATTACGACTGTGAAGTCAGTGATACATCGGCCTTGTACTTACGAGGAGATAATTGTAGCAACAACGACTCTAACCACTTTTCAGAGCTGGATCAACTTGCTCAGAGGATGAACACAGGAGAAGGTGGTCTTCAGTATGTGCGGAATAGTATAGGGGAGAAATCCTCGCTCGGATTGTCTCATGGTCATTCGAGTCAAGACCATGGTGCTCAGTGCGTCAATCTGGACTCTGAGTTTTCCCAGAGAAACAAGGTTTACTCATCAAACCACACGTTGGCCAGTCATCAACAAATCATTCAAGAACCAGTGATCATCTACGAGTTTCCACAAGAACAGGAGAGGCCCGGACATCTATACATGATGAACACATACGGTTCAACTTGTGCAACTAATATTCCGTCGCAGGCGTCTAAAATGCACAATCAAGATTATCACAATATTGCAGTCCAGCATGATTTTGAGCAGGATCTCGCGCTCAACAGATTGACAGACTTGATCCAGCTCCAAGGGACTACATTCATGAAGGAATATCAACCACAACATGTACAAGCTCATCAAAGGCACTTGTCATTGTTCAACAATAACCCAAGCGAGATTCGAGGACGATCATGTCAAGGAGATCTTCAAGAGATAAACAGACAGAGTACTGGCGGTGAGATTGCCGCATGGGAGGGGATCAATAAGACCAATGAAGATATGTTTCATCAACAGGAGCAGTACGATCAACAACAAGCTTTCCTTAACTTTCTGAGATTTTCCAATGCCCCTCATGGAGGAAGCAAGTTTTCCCGACGTGACAGTGTGGATGGAAAGTCATTATACAGGAGAAGCAAGAGTCCTGAAGATGAACATGAGCTGCTAGAACTATTTGACGGGCGTTCCAGTGGATCTGTGACCGTCGCTGCAACTGCGGTTCTCCACAGCGAGGCCAGCGCTGTTAATCCAAGAACGAGCTACGATGATTGCGTTCAAATAAGATCGCTACCAGCAGTCGAGCCAAGAATGAAACAAGTCTTCAGAACAGAGAAACAGAGGAGAGACTTCATCAAAGAGAGGTATAAGACATTGCAGTCTTTGGTTCCCAGATACTCCAAGACTGATCGTGCTTCTATTGTGGGAGATACCATTAACTATATTCATGTACTACGAAAGCAAATCAGAGAGCTGACCCTGAAGAAAGAGAAGAGGCGAGAAAGAAAGATAATTGAGAGGAGCCAAACAACTGGGGAAGGTTGTGCAGAGTCTCACGACGAGAGACCAAGAAACTATGAAAGAGCCCTTTCAGAATTCCGGATCTCCGATGAAAATGAACTACGATTGGCATCTAAGCGTGGAGCAGCTATAAAGTTTCAGCTCACTGCTGATGAGCTGCATGTTAATATAGTGCAAAAACGTGAGCCGTATTTCCTCAATCGCTTTCTGGCTTCTCTTACTCGATTTGATCTGGTCAACTCTTCGGGTGGCATAATTGACAATCATCACATCCAGAGTTTCATTCTCAAGATCAAGGGCAACTTACGACAAGTCTCCGTTAAGCTGATAAACAACATTATGGATACTTTAGATCAGATCTGA

Protein

>Mapoly0031s0075.1
MQLQLAARLNNHFPSVHYSQEGFEQSPSAAQPKNYDCEVSDTSALYLRGDNCSNNDSNHFSELDQLAQRMNTGEGGLQYVRNSIGEKSSLGLSHGHSSQDHGAQCVNLDSEFSQRNKVYSSNHTLASHQQIIQEPVIIYEFPQEQERPGHLYMMNTYGSTCATNIPSQASKMHNQDYHNIAVQHDFEQDLALNRLTDLIQLQGTTFMKEYQPQHVQAHQRHLSLFNNNPSEIRGRSCQGDLQEINRQSTGGEIAAWEGINKTNEDMFHQQEQYDQQQAFLNFLRFSNAPHGGSKFSRRDSVDGKSLYRRSKSPEDEHELLELFDGRSSGSVTVAATAVLHSEASAVNPRTSYDDCVQIRSLPAVEPRMKQVFRTEKQRRDFIKERYKTLQSLVPRYSKTDRASIVGDTINYIHVLRKQIRELTLKKEKRRERKIIERSQTTGEGCAESHDERPRNYERALSEFRISDENELRLASKRGAAIKFQLTADELHVNIVQKREPYFLNRFLASLTRFDLVNSSGGIIDNHHIQSFILKIKGNLRQVSVKLINNIMDTLDQI

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>