Mapoly0039s0059



Description

STEROL REGULATORY ELEMENT-BINDING PROTEIN

Reference DB

Database ID Description
GO GO:0046983 Protein dimerization activity
OrthoMCL OG5_146511
PFAM PF00010 Helix-loop-helix DNA-binding domain
PANTHER PTHR12565 STEROL REGULATORY ELEMENT-BINDING PROTEIN
PANTHER PTHR12565:SF80

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpBHLH6 transcription factor, bHLH Mapoly0039s0059.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0039s0059.1 scaffold_39:781195..787657  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
Mapoly0039s0059.2 scaffold_39:781195..787657  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
Mapoly0039s0059.3 scaffold_39:781195..787657  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
Mapoly0039s0059.4 scaffold_39:781195..787657  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
Mapoly0039s0059.5 scaffold_39:781195..786893  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
Mapoly0039s0059.6 scaffold_39:781195..786893  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
Mapoly0039s0059.7 scaffold_39:781195..786893  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
Mapoly0039s0059.8 scaffold_39:781195..786893  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
Mapoly0039s0059.9 scaffold_39:781195..786893  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
Mapoly0039s0059.10 scaffold_39:781195..786893  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
Mapoly0039s0059.11 scaffold_39:781195..786893  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
Mapoly0039s0059.12 scaffold_39:781195..786893  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
Mapoly0039s0059.13 scaffold_39:781195..786893  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0039s0059.1  

Gene structure:

mRNA scaffold_39:781195..787657  ( - strand )
three_prime_UTR scaffold_39:781195..782061  ( - strand )
CDS scaffold_39:782062..782211  ( - strand )
CDS scaffold_39:782354..782725  ( - strand )
CDS scaffold_39:782835..782900  ( - strand )
CDS scaffold_39:783016..783081  ( - strand )
CDS scaffold_39:783274..783375  ( - strand )
CDS scaffold_39:783497..784880  ( - strand )
CDS scaffold_39:785069..785211  ( - strand )
five_prime_UTR scaffold_39:785212..785214  ( - strand )
five_prime_UTR scaffold_39:785613..785687  ( - strand )
five_prime_UTR scaffold_39:786481..787657  ( - strand )

Sequences:

Gene

>Mapoly0039s0059.1
ACGACACCCTCGCCCGGTTTCGGATGATGTTTCGTAGACGAAGAGAAATCGCGGGCCACGGCGGCCTGATGTTGTGGAACCGGGACCCAGGTTCATCCTGGCGATACAAACCGCCACGTGGAAGATTCTCGTAGGACGCAGCCGTCGAGTTTTCAGGTGAGAAATCGGAGTGGGCAGGAGGCAAATACCAACTTGTAGCTCGTCGAAGGCCGAAAGCGGCCCGGATAATTGCATCGCCTCTGCTGCTCTCTGTGCCGCACCAATGCGGCCCGGATCTTAAAATACGAAAAAAGAAAAAAGAAGGCGTCCTGGGGGAAGGTAGTGCCACCGGTGAATCTCAGGGATGAGCTCGAGAGCTGAATTCCCGAGCACCTGGAGAGAGCCATCAATTTATTGCGCTATGGGGGAGAAATCCTTGTGCCAGAGTAGGAGCTCGAACGAAGTCCGCTCTCGTTTATTAATCTCTTACAGGGTGAGGTTTAGGTGCACTGTCCTGCAGGTCTGGATGGATGGTAGGATGAGAGCGAGGTGGGGACTCTGGTGATGGAGAGCCCTCCGGAGTTAGGCAAAGGCAAGGGAAGGATAGGCAGGGGAGGACGGGTCGATGAAGCGCGCTGCCGGAGTAAGGTAACTCTCCGTGGAACGGGTGCAGGCCAGGACCTTAGGTACAGGAGTGAAGAGTAGCATGGCTAGGCTACGTCGTAGGCCCGAGGAGTAGAGCTGAGCTAAAAGCTACACTGTACGTACCTGTAAAGAGAAGAGAAGCGAGTCGACGGACGGAAAGAAGGAAGGAAGGAAGGAAAGTGGGGCGGGGCGATGAGGGAGGCGAGGAGTACAAGAATGTGGAGTAGTAAGGATATCATTTTGCTGGATGTTGCTGAAGACGATCAAGAGTCGAATTCGAGTGCGAGTCTTTGGTGCTAGAGCGGGAGGGTGGGCGATCCGAGTGCCAGATGTGGACGAGAGAAGCAGCGGAATCGATGGCTGCAGATTCGGGGCCAGTGGGCAGAGGCGGCTCGAGTCTTCCGACGGGAGGATTGAGGAGGGACACGAAGAGCTCTGAGTGATGTGATGCCATTCTGGTAGAGAAAAAGAAGGGATTCTGCTCTTGGGATCGCGCGAGGTCCCTGGGGCCAGCAAGCGCCCAGCTTGCCGAGCGGGCTCTCTGACGTCGAAGGTGCTGCCGCCTCTGTGTGTTTATCCCTGTGTCTCTGTGTTCTAGGCGGTTGTTGGCGGAGGGACGAGGGAGAGGAGTGGCGTTATGTCTGTCTGCTTGACAAGTTGGTACTCCTTGTGGGTCATAAGTTGGGATTTCCTTCCGCCCGTGGCACTGTTTCTGTCGGCGTGAGAAGAGCAAGTTTTCCAGCTCAAGGTTCAGTCCTATCGTTTTTATCTTCGCCTTCCCTCTCCCGCGTGTCTCCATGCATTTGATGACCTTGTCTGTCGGCGACGCTAGCCTCGAGCATCCATGTCAGGCCCACGCCGCTCTAGTGTGTATGTTTGAGTAGACAGCTCTTGTTCTCCCACATAATGAAATGTCCGCGATCACTGAGCCTTGGTAATTTTGATCTCCTTTCTCGCTCACTCTGCCGCAGGAGAGTGTGCAGCTACTTCGTTAAGTGTGCTTGTCCGCACGGTTGACATAACCTCTATGAGATCTTTAGATTCTGAGCGAGATCCTTCTCTTGTGACAGAGCCGTGAGAAAGAGCCGGGGTGGCCTGTTGTATTTCCCGAGGAGATGAATGTACAAACTGCATAAAAACTGCATCTCCTTGATGCTCCGGAATGATGAGGACATGTAAGGAAGCGTTGAGTACACCGACCCAGAAGAATCGTAAATGCATCTGCACTCTGTGTTGTAGAGTTGGGCCCATTTAGTCGACGGCGATAAGTAGCAGATTGACCCGCTTAGCGGCAAGAACCCGTTGTGCCTCTGTTTAAACTGACTGGGTTCGAATTGCTCCTACAGGGACTGGATTTCGAATCGGGAACGGACTGAACACCGGAAGAATCCTCTCCGGTTGTCACTACATCCCCATCAGAGGTGAGTTCAGTGTGGGAAGCCTGTCGAGAGATCGGCGAGCTGGTGATTCTTACTTGCTTTCTGTCTGTGTTTGGAGCGTCTACCTTTCTCGTAATCTACCCATACCTTTCCCGTCACTGAGAAATGAAGAGGCTTTAAAAGTAGGTGAACTTCGAGACTTGGGTGCCATGAGAGTAGATTAGAAGTAGGACGAGCAGGAGACGACTGCAAACTGTCGAAGTCTTCACCTCTCATCTTCTCATTCCCACTGCCATGCCTTACTCACGACCATCCACTACCTCTATGTATGTGGGAGCGCTTCTGGCGAAGCGCTGGGCATTGACAGTGACAGGCCGAGAAGTCGATGCCGTAGCAGTCTAGGTAGGCATTTGATTTACCTCCTCCTGTTTGACTCGCAGACCATGAGTCACCTCGTTCCCGACTGGGATGGTAACGGTGGAGACTTAGAAGCTGTTTTACCCACAAGCGATTTCTCACTGCCGGTTAAGGGAAAGTGGGACTCATTGCCCCATAAAAGGTCGCACTTGTCTGGTTTGGCCTTCGTGTAAGCGCTTGCTCCGGCTTTTCAATCCCCATAGTTTTTTGTGTTCTTGATACCATTGTATGTAAGGTCAATTTCTTGATTGTGGATCTTTGAGAATGCCACTTCGTGATGCCGGCTCGTTGACATGCTGCTCTTCGTCACATGAGCTTCGAAGAGATGTTAAAGGTCGCGTTCTTCTTCTTCTACAGGCCAACCCACGATGCTGGCGAAACTGAGTGGGCAGAGGAAAGTCATATTGTAGCTATGCAGAACCAAAGCGGGAAGGGCAACAAGGCTATGTGGCAGCAGATGAATTTCCAGAATGGGTGGTCGAGTGTGCCAGAGTCTGAGGATGCCGTTACTCCTGTGAAGCCCATCAGCTCGTCGTCTCCGGGGAAGGAGCCGGTTCTTGTCAATGAGCCCGCGGTCGACACGCACCACTCCAGTGCCCTCAACATGCAGGAAGACGAGATGGTGTGCTGGCTGCAGTATCCGTTGGACGAACACCTCGAAAGAGACTACTGTTCCGAGTTCTTCGGCGAGCTGCCCAACTCCAACATATCGAACATGCAGCTGATGAAGGATTCATTCGCAGGGCAAAATCAAGTAGCGGGGCGCAACAACAGGAATCCAGGTCCCGTTAACGTAGGGAGTAACAGCAGAATGTCTAGTGCGGATGCGGCGATGGCCATGGGAGCGGGGCGAGCTGCCGGTTTGTTGCCTCAGACAGGGGTGGAGGTTTTCACCAAAGTTCGGACCACTTTGCAACCCTACGGAGGAAAGTGGTCCCCAAATCAGAACAACGCCGGGAAAACGCTGGGAGCGATGACCTCGACCCTGGCTCCGAGCCCGTCAAGATCCCCGCCGATGTCTGGGAACTTGTCGACCCCCATGCTCCCCCCGAAGTCTCAGGGACTCAGCTTCCAGCCTCCCAGAACCTCAGGCCCGATGAATTTCTCGCATTTCTCTCGCCCTGCGGCTGTGATGAAGGCCAATCTCCAGTGCCTAGGAATGTCTCACGTGGCCCCTCCGCACGGGAGCGGGACGAACGTCCGGCTCAAGAGCCAACCCTACAGCGGGAAGCCACCCGTCGACGCAAGCACGTCGACGGGGTCCTCCATTGCAGAGTCAACCACCACGAGGCAACGCAGCGGCGCTTTCCGCAAGGATACCGAATGCCAAGTCGAAGGTTCCGAAGCTCAACAGAGTCTTGGAACCGAATCGAGCTGGCCTTCGATGCAGAATTCGCTGTCGGGCAAGGACACCGACGCTGTCAATTCCTCCGTGGATGGTGTGGACTGCGATTCGAAGCCCGGTATAGCGGATGTGGACAATTGCAGGAATTCTAGCATCACAGGTAGTGGCGGTTTAGGAACTGAAAAGCATCAGTCTCAAGGAGCAGAAGTGCAGGAAGCTCCCGAACCCACCATTACCTCGTCTTCTGGTGGGTCCGGTAATAGTGCAGATAGAGGGAAAGAGGCCGCATCTAGTGGCAAGAGAAGAACCAGGGAAGGAGAGGAGTCCGAGTGCCAGAGCGAAGTGAGTAACTTGTTGCAACCCCAAGGGAGTCAAGTTGGTGCAGTAGCCCACAGGGTATGTTTTATCTAGTGATGCTAACTTTTTCCTGAATAACATCCCACTGACTGCTCTTTTTATGCGAGGATGTGTGAGAAGTGTACTTGCGTTTAATAAAAGCCAATGTTGTTTCTGGCAGCAAGATGGCGAGGACGAGATGGCCCAGCAAAAGAAACCTCAACAGAGAGGCTCCACCACTAAGAGGAGCAGGGCCGCGGAAGTCCACAACCTTTCCGAGCGAGTGAGAGTCCACCACTAACTGAGAAATTGAGCTCTGCGCCAATTGTACAGGATGGTCCAAGCCGTGAGCATATGACGGCAGTGGACAATCTAGGTCTCAAATCTTGTTTGGGTCGTCAATTTTGTGACTGATGTTAGTTTTGAAGCTCTTGGCTTCCGCAGCTTTACTGATAGAATTTCCTGCCCATTTCAGAGGCGAAGAGATCGTATCAACGAGAAGATGAAAGCTCTGCAAGAGCTGATCCCCAATTCCAACAAGGTTTGTTACAGCTTTCAGCCTTGTTCTTCGTACCTTGCCTCTTCTTTTGGATCACCGTGCGGTAACTTGCCCTTGAAATACAGTCAATGATGCAGACTTTTGATTCATATTGCAGACGGACAAAGCATCGATGCTGGATGAAGCGATCGAGTACTTGAAGATGCTCCAGTTGCAACTGCAGGTAACTATCCCAGCCTTTGACCTTCGCAGTAGTTCTCTGCTCCTCCTTGCGATGCAGGTGCTGTAGAGACGCCCGAGCACAAATACTGAATTCAATTTGCCCTCTTTAGCAGATGATGTCCATGAGAAGTGGAATGAGCATCCCCTCTATGGTGATGCCGGCGGGAATGCAACACCTTCAAATCCCGCAATTGCCCCAAATGGGCCCAATGCCTCCCATGGGAATGGGAATGGGCATGGGTATGGGCATGGGCCCGATGGGAATGGGAATGAGTATGATGGACATGGGAGGCGGAGCTCCCGGTCGACCGATGATACCCCTTCCGTCTCACAGTGGGCCTTCTCACTCTCACAACGTATCTGCAACCTCACCAGCTGTTTCTATGGTAGACACTCATGACCACCGCCTGCAAAACCCGAGCGTCATGGAGTCACTGAACGTCTTCATGGCGCAACACCGGCAAATGCAAATGGCTCCTCAGGTGATCCTTCTCTTTGAATGCCGGCTGGTTCTGTCCGATCTTCTGTCAGCTTTGTTTTTTGTGCAAATTTCCTAGGAGGAAGGAGCATGTGGTTGGGAGACGATGAAGTCTTGATTCTTACTCACTGTGCCTGTTCTTGCAGCCGATGAGTATGGATGCATTCAGTGCATTCATGATTCATCAGCACCAGCAGCAACACCAGCAGCAGCATCAACAACATCAGCTCCAACACCAACACCAGCATTCGCTCCATCATCTTCCGAGCAGCATGGGCGGTGGAGCCCCCCAATGAAGAGCGGGCCAAATTCTCGGTGGATCTTGATTTCCACGCTTGCTTTCCATTTGTCATGCCATTTCGCATTGGAGGCCAGCGATCTGTCAACAACTATCTGCTGTTCCGCTCTCGGAGAGCGTAATATACTCAGCTGCAGGCGTGGCTGTGAGTCTGACAGCCATCGTCGGGCATCAGGACACGATACAGCTGAAGGTGAAGGCGAAGGCCGATGGAGGTGTGGTCCGGTGCATCATTGGTTTCCACCTCTTAGTTTTGTAGTCTAGTTGGGGGATATGTAAACATCATGATCTCAGGTTGGAAAGTATGATTCTACTAGGACCGGATCTTGTGTAGGTGCCTTCAACCAGGCCGCAGCAGTGTTGAAGGCGTGTATTAGAACGCAGAATTGGATGATATGTATCAAGAAGGTCCTCGCTGCCCTCGCATTAGCGGCGTGCTGCGGTGCCATGCGGGGCCAGGGTCAGGGCCAGGGCGTTTCGCCTCTGTACTTTTATCAGCAAGCATAATTGCATCTTCTAACTAGCCTTAGCGAGGCGAGGTTTTGAGGATTAGTAGTTTTAGAAGAAGGAAGTGTCCGTAGTGCTGTCATTCCAGGGCCGGACCTTCTTCAATTGTTGCGGATCGGGATACTATGGCGCCGAAGTTTGCGCTCCGGCTTACGCTGTTCTCGTTGTGGATTTGGAGGGAACTCGTGTTGCCGGAAGCAGATTTCTAGTCGAAAGCCTGCCGCCCGAAATGTGCCATGTTTAATTGTCGATAAGGTTCAAGTTAAATGTTGGATTACATTCATTGTTCTCCGTTGGCTCAAGGCGAGCCACTTGTAAAAAGAAATGCCAAGTTTACCAACTTGAGACTCCTTGCACG

mRNA

>Mapoly0039s0059.1
ACGACACCCTCGCCCGGTTTCGGATGATGTTTCGTAGACGAAGAGAAATCGCGGGCCACGGCGGCCTGATGTTGTGGAACCGGGACCCAGGTTCATCCTGGCGATACAAACCGCCACGTGGAAGATTCTCGTAGGACGCAGCCGTCGAGTTTTCAGGTGAGAAATCGGAGTGGGCAGGAGGCAAATACCAACTTGTAGCTCGTCGAAGGCCGAAAGCGGCCCGGATAATTGCATCGCCTCTGCTGCTCTCTGTGCCGCACCAATGCGGCCCGGATCTTAAAATACGAAAAAAGAAAAAAGAAGGCGTCCTGGGGGAAGGTAGTGCCACCGGTGAATCTCAGGGATGAGCTCGAGAGCTGAATTCCCGAGCACCTGGAGAGAGCCATCAATTTATTGCGCTATGGGGGAGAAATCCTTGTGCCAGAGTAGGAGCTCGAACGAAGTCCGCTCTCGTTTATTAATCTCTTACAGGGTGAGGTTTAGGTGCACTGTCCTGCAGGTCTGGATGGATGGTAGGATGAGAGCGAGGTGGGGACTCTGGTGATGGAGAGCCCTCCGGAGTTAGGCAAAGGCAAGGGAAGGATAGGCAGGGGAGGACGGGTCGATGAAGCGCGCTGCCGGAGTAAGGTAACTCTCCGTGGAACGGGTGCAGGCCAGGACCTTAGGTACAGGAGTGAAGAGTAGCATGGCTAGGCTACGTCGTAGGCCCGAGGAGTAGAGCTGAGCTAAAAGCTACACTGTACGTACCTGTAAAGAGAAGAGAAGCGAGTCGACGGACGGAAAGAAGGAAGGAAGGAAGGAAAGTGGGGCGGGGCGATGAGGGAGGCGAGGAGTACAAGAATGTGGAGTAGTAAGGATATCATTTTGCTGGATGTTGCTGAAGACGATCAAGAGTCGAATTCGAGTGCGAGTCTTTGGTGCTAGAGCGGGAGGGTGGGCGATCCGAGTGCCAGATGTGGACGAGAGAAGCAGCGGAATCGATGGCTGCAGATTCGGGGCCAGTGGGCAGAGGCGGCTCGAGTCTTCCGACGGGAGGATTGAGGAGGGACACGAAGAGCTCTGAGTGATGTGATGCCATTCTGGTAGAGAAAAAGAAGGGATTCTGCTCTTGGGATCGCGCGAGGTCCCTGGGGCCAGCAAGCGCCCAGCTTGCCGAGCGGGCTCTCTGACGTCGAAGGGACTGGATTTCGAATCGGGAACGGACTGAACACCGGAAGAATCCTCTCCGGTTGTCACTACATCCCCATCAGAGACCATGAGTCACCTCGTTCCCGACTGGGATGGTAACGGTGGAGACTTAGAAGCTGTTTTACCCACAAGCGATTTCTCACTGCCGGTTAAGGGAAAGTGGGACTCATTGCCCCATAAAAGGTCGCACTTGTCTGGTTTGGCCTTCGTGCCAACCCACGATGCTGGCGAAACTGAGTGGGCAGAGGAAAGTCATATTGTAGCTATGCAGAACCAAAGCGGGAAGGGCAACAAGGCTATGTGGCAGCAGATGAATTTCCAGAATGGGTGGTCGAGTGTGCCAGAGTCTGAGGATGCCGTTACTCCTGTGAAGCCCATCAGCTCGTCGTCTCCGGGGAAGGAGCCGGTTCTTGTCAATGAGCCCGCGGTCGACACGCACCACTCCAGTGCCCTCAACATGCAGGAAGACGAGATGGTGTGCTGGCTGCAGTATCCGTTGGACGAACACCTCGAAAGAGACTACTGTTCCGAGTTCTTCGGCGAGCTGCCCAACTCCAACATATCGAACATGCAGCTGATGAAGGATTCATTCGCAGGGCAAAATCAAGTAGCGGGGCGCAACAACAGGAATCCAGGTCCCGTTAACGTAGGGAGTAACAGCAGAATGTCTAGTGCGGATGCGGCGATGGCCATGGGAGCGGGGCGAGCTGCCGGTTTGTTGCCTCAGACAGGGGTGGAGGTTTTCACCAAAGTTCGGACCACTTTGCAACCCTACGGAGGAAAGTGGTCCCCAAATCAGAACAACGCCGGGAAAACGCTGGGAGCGATGACCTCGACCCTGGCTCCGAGCCCGTCAAGATCCCCGCCGATGTCTGGGAACTTGTCGACCCCCATGCTCCCCCCGAAGTCTCAGGGACTCAGCTTCCAGCCTCCCAGAACCTCAGGCCCGATGAATTTCTCGCATTTCTCTCGCCCTGCGGCTGTGATGAAGGCCAATCTCCAGTGCCTAGGAATGTCTCACGTGGCCCCTCCGCACGGGAGCGGGACGAACGTCCGGCTCAAGAGCCAACCCTACAGCGGGAAGCCACCCGTCGACGCAAGCACGTCGACGGGGTCCTCCATTGCAGAGTCAACCACCACGAGGCAACGCAGCGGCGCTTTCCGCAAGGATACCGAATGCCAAGTCGAAGGTTCCGAAGCTCAACAGAGTCTTGGAACCGAATCGAGCTGGCCTTCGATGCAGAATTCGCTGTCGGGCAAGGACACCGACGCTGTCAATTCCTCCGTGGATGGTGTGGACTGCGATTCGAAGCCCGGTATAGCGGATGTGGACAATTGCAGGAATTCTAGCATCACAGGTAGTGGCGGTTTAGGAACTGAAAAGCATCAGTCTCAAGGAGCAGAAGTGCAGGAAGCTCCCGAACCCACCATTACCTCGTCTTCTGGTGGGTCCGGTAATAGTGCAGATAGAGGGAAAGAGGCCGCATCTAGTGGCAAGAGAAGAACCAGGGAAGGAGAGGAGTCCGAGTGCCAGAGCGAAGTGAGTAACTTGTTGCAACCCCAAGGGAGTCAAGTTGGTGCAGTAGCCCACAGGCAAGATGGCGAGGACGAGATGGCCCAGCAAAAGAAACCTCAACAGAGAGGCTCCACCACTAAGAGGAGCAGGGCCGCGGAAGTCCACAACCTTTCCGAGCGAAGGCGAAGAGATCGTATCAACGAGAAGATGAAAGCTCTGCAAGAGCTGATCCCCAATTCCAACAAGACGGACAAAGCATCGATGCTGGATGAAGCGATCGAGTACTTGAAGATGCTCCAGTTGCAACTGCAGCAGATGATGTCCATGAGAAGTGGAATGAGCATCCCCTCTATGGTGATGCCGGCGGGAATGCAACACCTTCAAATCCCGCAATTGCCCCAAATGGGCCCAATGCCTCCCATGGGAATGGGAATGGGCATGGGTATGGGCATGGGCCCGATGGGAATGGGAATGAGTATGATGGACATGGGAGGCGGAGCTCCCGGTCGACCGATGATACCCCTTCCGTCTCACAGTGGGCCTTCTCACTCTCACAACGTATCTGCAACCTCACCAGCTGTTTCTATGGTAGACACTCATGACCACCGCCTGCAAAACCCGAGCGTCATGGAGTCACTGAACGTCTTCATGGCGCAACACCGGCAAATGCAAATGGCTCCTCAGCCGATGAGTATGGATGCATTCAGTGCATTCATGATTCATCAGCACCAGCAGCAACACCAGCAGCAGCATCAACAACATCAGCTCCAACACCAACACCAGCATTCGCTCCATCATCTTCCGAGCAGCATGGGCGGTGGAGCCCCCCAATGAAGAGCGGGCCAAATTCTCGGTGGATCTTGATTTCCACGCTTGCTTTCCATTTGTCATGCCATTTCGCATTGGAGGCCAGCGATCTGTCAACAACTATCTGCTGTTCCGCTCTCGGAGAGCGTAATATACTCAGCTGCAGGCGTGGCTGTGAGTCTGACAGCCATCGTCGGGCATCAGGACACGATACAGCTGAAGGTGAAGGCGAAGGCCGATGGAGGTGTGGTCCGGTGCATCATTGGTTTCCACCTCTTAGTTTTGTAGTCTAGTTGGGGGATATGTAAACATCATGATCTCAGGTTGGAAAGTATGATTCTACTAGGACCGGATCTTGTGTAGGTGCCTTCAACCAGGCCGCAGCAGTGTTGAAGGCGTGTATTAGAACGCAGAATTGGATGATATGTATCAAGAAGGTCCTCGCTGCCCTCGCATTAGCGGCGTGCTGCGGTGCCATGCGGGGCCAGGGTCAGGGCCAGGGCGTTTCGCCTCTGTACTTTTATCAGCAAGCATAATTGCATCTTCTAACTAGCCTTAGCGAGGCGAGGTTTTGAGGATTAGTAGTTTTAGAAGAAGGAAGTGTCCGTAGTGCTGTCATTCCAGGGCCGGACCTTCTTCAATTGTTGCGGATCGGGATACTATGGCGCCGAAGTTTGCGCTCCGGCTTACGCTGTTCTCGTTGTGGATTTGGAGGGAACTCGTGTTGCCGGAAGCAGATTTCTAGTCGAAAGCCTGCCGCCCGAAATGTGCCATGTTTAATTGTCGATAAGGTTCAAGTTAAATGTTGGATTACATTCATTGTTCTCCGTTGGCTCAAGGCGAGCCACTTGTAAAAAGAAATGCCAAGTTTACCAACTTGAGACTCCTTGCACG

CDS

>Mapoly0039s0059.1
ATGAGTCACCTCGTTCCCGACTGGGATGGTAACGGTGGAGACTTAGAAGCTGTTTTACCCACAAGCGATTTCTCACTGCCGGTTAAGGGAAAGTGGGACTCATTGCCCCATAAAAGGTCGCACTTGTCTGGTTTGGCCTTCGTGCCAACCCACGATGCTGGCGAAACTGAGTGGGCAGAGGAAAGTCATATTGTAGCTATGCAGAACCAAAGCGGGAAGGGCAACAAGGCTATGTGGCAGCAGATGAATTTCCAGAATGGGTGGTCGAGTGTGCCAGAGTCTGAGGATGCCGTTACTCCTGTGAAGCCCATCAGCTCGTCGTCTCCGGGGAAGGAGCCGGTTCTTGTCAATGAGCCCGCGGTCGACACGCACCACTCCAGTGCCCTCAACATGCAGGAAGACGAGATGGTGTGCTGGCTGCAGTATCCGTTGGACGAACACCTCGAAAGAGACTACTGTTCCGAGTTCTTCGGCGAGCTGCCCAACTCCAACATATCGAACATGCAGCTGATGAAGGATTCATTCGCAGGGCAAAATCAAGTAGCGGGGCGCAACAACAGGAATCCAGGTCCCGTTAACGTAGGGAGTAACAGCAGAATGTCTAGTGCGGATGCGGCGATGGCCATGGGAGCGGGGCGAGCTGCCGGTTTGTTGCCTCAGACAGGGGTGGAGGTTTTCACCAAAGTTCGGACCACTTTGCAACCCTACGGAGGAAAGTGGTCCCCAAATCAGAACAACGCCGGGAAAACGCTGGGAGCGATGACCTCGACCCTGGCTCCGAGCCCGTCAAGATCCCCGCCGATGTCTGGGAACTTGTCGACCCCCATGCTCCCCCCGAAGTCTCAGGGACTCAGCTTCCAGCCTCCCAGAACCTCAGGCCCGATGAATTTCTCGCATTTCTCTCGCCCTGCGGCTGTGATGAAGGCCAATCTCCAGTGCCTAGGAATGTCTCACGTGGCCCCTCCGCACGGGAGCGGGACGAACGTCCGGCTCAAGAGCCAACCCTACAGCGGGAAGCCACCCGTCGACGCAAGCACGTCGACGGGGTCCTCCATTGCAGAGTCAACCACCACGAGGCAACGCAGCGGCGCTTTCCGCAAGGATACCGAATGCCAAGTCGAAGGTTCCGAAGCTCAACAGAGTCTTGGAACCGAATCGAGCTGGCCTTCGATGCAGAATTCGCTGTCGGGCAAGGACACCGACGCTGTCAATTCCTCCGTGGATGGTGTGGACTGCGATTCGAAGCCCGGTATAGCGGATGTGGACAATTGCAGGAATTCTAGCATCACAGGTAGTGGCGGTTTAGGAACTGAAAAGCATCAGTCTCAAGGAGCAGAAGTGCAGGAAGCTCCCGAACCCACCATTACCTCGTCTTCTGGTGGGTCCGGTAATAGTGCAGATAGAGGGAAAGAGGCCGCATCTAGTGGCAAGAGAAGAACCAGGGAAGGAGAGGAGTCCGAGTGCCAGAGCGAAGTGAGTAACTTGTTGCAACCCCAAGGGAGTCAAGTTGGTGCAGTAGCCCACAGGCAAGATGGCGAGGACGAGATGGCCCAGCAAAAGAAACCTCAACAGAGAGGCTCCACCACTAAGAGGAGCAGGGCCGCGGAAGTCCACAACCTTTCCGAGCGAAGGCGAAGAGATCGTATCAACGAGAAGATGAAAGCTCTGCAAGAGCTGATCCCCAATTCCAACAAGACGGACAAAGCATCGATGCTGGATGAAGCGATCGAGTACTTGAAGATGCTCCAGTTGCAACTGCAGCAGATGATGTCCATGAGAAGTGGAATGAGCATCCCCTCTATGGTGATGCCGGCGGGAATGCAACACCTTCAAATCCCGCAATTGCCCCAAATGGGCCCAATGCCTCCCATGGGAATGGGAATGGGCATGGGTATGGGCATGGGCCCGATGGGAATGGGAATGAGTATGATGGACATGGGAGGCGGAGCTCCCGGTCGACCGATGATACCCCTTCCGTCTCACAGTGGGCCTTCTCACTCTCACAACGTATCTGCAACCTCACCAGCTGTTTCTATGGTAGACACTCATGACCACCGCCTGCAAAACCCGAGCGTCATGGAGTCACTGAACGTCTTCATGGCGCAACACCGGCAAATGCAAATGGCTCCTCAGCCGATGAGTATGGATGCATTCAGTGCATTCATGATTCATCAGCACCAGCAGCAACACCAGCAGCAGCATCAACAACATCAGCTCCAACACCAACACCAGCATTCGCTCCATCATCTTCCGAGCAGCATGGGCGGTGGAGCCCCCCAATGA

Protein

>Mapoly0039s0059.1
MSHLVPDWDGNGGDLEAVLPTSDFSLPVKGKWDSLPHKRSHLSGLAFVPTHDAGETEWAEESHIVAMQNQSGKGNKAMWQQMNFQNGWSSVPESEDAVTPVKPISSSSPGKEPVLVNEPAVDTHHSSALNMQEDEMVCWLQYPLDEHLERDYCSEFFGELPNSNISNMQLMKDSFAGQNQVAGRNNRNPGPVNVGSNSRMSSADAAMAMGAGRAAGLLPQTGVEVFTKVRTTLQPYGGKWSPNQNNAGKTLGAMTSTLAPSPSRSPPMSGNLSTPMLPPKSQGLSFQPPRTSGPMNFSHFSRPAAVMKANLQCLGMSHVAPPHGSGTNVRLKSQPYSGKPPVDASTSTGSSIAESTTTRQRSGAFRKDTECQVEGSEAQQSLGTESSWPSMQNSLSGKDTDAVNSSVDGVDCDSKPGIADVDNCRNSSITGSGGLGTEKHQSQGAEVQEAPEPTITSSSGGSGNSADRGKEAASSGKRRTREGEESECQSEVSNLLQPQGSQVGAVAHRQDGEDEMAQQKKPQQRGSTTKRSRAAEVHNLSERRRRDRINEKMKALQELIPNSNKTDKASMLDEAIEYLKMLQLQLQQMMSMRSGMSIPSMVMPAGMQHLQIPQLPQMGPMPPMGMGMGMGMGMGPMGMGMSMMDMGGGAPGRPMIPLPSHSGPSHSHNVSATSPAVSMVDTHDHRLQNPSVMESLNVFMAQHRQMQMAPQPMSMDAFSAFMIHQHQQQHQQQHQQHQLQHQHQHSLHHLPSSMGGGAPQ

Mapoly0039s0059.2  

Gene structure:

mRNA scaffold_39:781195..787657  ( - strand )
three_prime_UTR scaffold_39:781195..782061  ( - strand )
CDS scaffold_39:782062..782211  ( - strand )
CDS scaffold_39:782354..782722  ( - strand )
CDS scaffold_39:782835..782900  ( - strand )
CDS scaffold_39:783016..783081  ( - strand )
CDS scaffold_39:783274..783375  ( - strand )
CDS scaffold_39:783551..784880  ( - strand )
CDS scaffold_39:785069..785211  ( - strand )
five_prime_UTR scaffold_39:785212..785214  ( - strand )
five_prime_UTR scaffold_39:785613..785687  ( - strand )
five_prime_UTR scaffold_39:786481..787657  ( - strand )

Sequences:

Gene

>Mapoly0039s0059.2
ACGACACCCTCGCCCGGTTTCGGATGATGTTTCGTAGACGAAGAGAAATCGCGGGCCACGGCGGCCTGATGTTGTGGAACCGGGACCCAGGTTCATCCTGGCGATACAAACCGCCACGTGGAAGATTCTCGTAGGACGCAGCCGTCGAGTTTTCAGGTGAGAAATCGGAGTGGGCAGGAGGCAAATACCAACTTGTAGCTCGTCGAAGGCCGAAAGCGGCCCGGATAATTGCATCGCCTCTGCTGCTCTCTGTGCCGCACCAATGCGGCCCGGATCTTAAAATACGAAAAAAGAAAAAAGAAGGCGTCCTGGGGGAAGGTAGTGCCACCGGTGAATCTCAGGGATGAGCTCGAGAGCTGAATTCCCGAGCACCTGGAGAGAGCCATCAATTTATTGCGCTATGGGGGAGAAATCCTTGTGCCAGAGTAGGAGCTCGAACGAAGTCCGCTCTCGTTTATTAATCTCTTACAGGGTGAGGTTTAGGTGCACTGTCCTGCAGGTCTGGATGGATGGTAGGATGAGAGCGAGGTGGGGACTCTGGTGATGGAGAGCCCTCCGGAGTTAGGCAAAGGCAAGGGAAGGATAGGCAGGGGAGGACGGGTCGATGAAGCGCGCTGCCGGAGTAAGGTAACTCTCCGTGGAACGGGTGCAGGCCAGGACCTTAGGTACAGGAGTGAAGAGTAGCATGGCTAGGCTACGTCGTAGGCCCGAGGAGTAGAGCTGAGCTAAAAGCTACACTGTACGTACCTGTAAAGAGAAGAGAAGCGAGTCGACGGACGGAAAGAAGGAAGGAAGGAAGGAAAGTGGGGCGGGGCGATGAGGGAGGCGAGGAGTACAAGAATGTGGAGTAGTAAGGATATCATTTTGCTGGATGTTGCTGAAGACGATCAAGAGTCGAATTCGAGTGCGAGTCTTTGGTGCTAGAGCGGGAGGGTGGGCGATCCGAGTGCCAGATGTGGACGAGAGAAGCAGCGGAATCGATGGCTGCAGATTCGGGGCCAGTGGGCAGAGGCGGCTCGAGTCTTCCGACGGGAGGATTGAGGAGGGACACGAAGAGCTCTGAGTGATGTGATGCCATTCTGGTAGAGAAAAAGAAGGGATTCTGCTCTTGGGATCGCGCGAGGTCCCTGGGGCCAGCAAGCGCCCAGCTTGCCGAGCGGGCTCTCTGACGTCGAAGGTGCTGCCGCCTCTGTGTGTTTATCCCTGTGTCTCTGTGTTCTAGGCGGTTGTTGGCGGAGGGACGAGGGAGAGGAGTGGCGTTATGTCTGTCTGCTTGACAAGTTGGTACTCCTTGTGGGTCATAAGTTGGGATTTCCTTCCGCCCGTGGCACTGTTTCTGTCGGCGTGAGAAGAGCAAGTTTTCCAGCTCAAGGTTCAGTCCTATCGTTTTTATCTTCGCCTTCCCTCTCCCGCGTGTCTCCATGCATTTGATGACCTTGTCTGTCGGCGACGCTAGCCTCGAGCATCCATGTCAGGCCCACGCCGCTCTAGTGTGTATGTTTGAGTAGACAGCTCTTGTTCTCCCACATAATGAAATGTCCGCGATCACTGAGCCTTGGTAATTTTGATCTCCTTTCTCGCTCACTCTGCCGCAGGAGAGTGTGCAGCTACTTCGTTAAGTGTGCTTGTCCGCACGGTTGACATAACCTCTATGAGATCTTTAGATTCTGAGCGAGATCCTTCTCTTGTGACAGAGCCGTGAGAAAGAGCCGGGGTGGCCTGTTGTATTTCCCGAGGAGATGAATGTACAAACTGCATAAAAACTGCATCTCCTTGATGCTCCGGAATGATGAGGACATGTAAGGAAGCGTTGAGTACACCGACCCAGAAGAATCGTAAATGCATCTGCACTCTGTGTTGTAGAGTTGGGCCCATTTAGTCGACGGCGATAAGTAGCAGATTGACCCGCTTAGCGGCAAGAACCCGTTGTGCCTCTGTTTAAACTGACTGGGTTCGAATTGCTCCTACAGGGACTGGATTTCGAATCGGGAACGGACTGAACACCGGAAGAATCCTCTCCGGTTGTCACTACATCCCCATCAGAGGTGAGTTCAGTGTGGGAAGCCTGTCGAGAGATCGGCGAGCTGGTGATTCTTACTTGCTTTCTGTCTGTGTTTGGAGCGTCTACCTTTCTCGTAATCTACCCATACCTTTCCCGTCACTGAGAAATGAAGAGGCTTTAAAAGTAGGTGAACTTCGAGACTTGGGTGCCATGAGAGTAGATTAGAAGTAGGACGAGCAGGAGACGACTGCAAACTGTCGAAGTCTTCACCTCTCATCTTCTCATTCCCACTGCCATGCCTTACTCACGACCATCCACTACCTCTATGTATGTGGGAGCGCTTCTGGCGAAGCGCTGGGCATTGACAGTGACAGGCCGAGAAGTCGATGCCGTAGCAGTCTAGGTAGGCATTTGATTTACCTCCTCCTGTTTGACTCGCAGACCATGAGTCACCTCGTTCCCGACTGGGATGGTAACGGTGGAGACTTAGAAGCTGTTTTACCCACAAGCGATTTCTCACTGCCGGTTAAGGGAAAGTGGGACTCATTGCCCCATAAAAGGTCGCACTTGTCTGGTTTGGCCTTCGTGTAAGCGCTTGCTCCGGCTTTTCAATCCCCATAGTTTTTTGTGTTCTTGATACCATTGTATGTAAGGTCAATTTCTTGATTGTGGATCTTTGAGAATGCCACTTCGTGATGCCGGCTCGTTGACATGCTGCTCTTCGTCACATGAGCTTCGAAGAGATGTTAAAGGTCGCGTTCTTCTTCTTCTACAGGCCAACCCACGATGCTGGCGAAACTGAGTGGGCAGAGGAAAGTCATATTGTAGCTATGCAGAACCAAAGCGGGAAGGGCAACAAGGCTATGTGGCAGCAGATGAATTTCCAGAATGGGTGGTCGAGTGTGCCAGAGTCTGAGGATGCCGTTACTCCTGTGAAGCCCATCAGCTCGTCGTCTCCGGGGAAGGAGCCGGTTCTTGTCAATGAGCCCGCGGTCGACACGCACCACTCCAGTGCCCTCAACATGCAGGAAGACGAGATGGTGTGCTGGCTGCAGTATCCGTTGGACGAACACCTCGAAAGAGACTACTGTTCCGAGTTCTTCGGCGAGCTGCCCAACTCCAACATATCGAACATGCAGCTGATGAAGGATTCATTCGCAGGGCAAAATCAAGTAGCGGGGCGCAACAACAGGAATCCAGGTCCCGTTAACGTAGGGAGTAACAGCAGAATGTCTAGTGCGGATGCGGCGATGGCCATGGGAGCGGGGCGAGCTGCCGGTTTGTTGCCTCAGACAGGGGTGGAGGTTTTCACCAAAGTTCGGACCACTTTGCAACCCTACGGAGGAAAGTGGTCCCCAAATCAGAACAACGCCGGGAAAACGCTGGGAGCGATGACCTCGACCCTGGCTCCGAGCCCGTCAAGATCCCCGCCGATGTCTGGGAACTTGTCGACCCCCATGCTCCCCCCGAAGTCTCAGGGACTCAGCTTCCAGCCTCCCAGAACCTCAGGCCCGATGAATTTCTCGCATTTCTCTCGCCCTGCGGCTGTGATGAAGGCCAATCTCCAGTGCCTAGGAATGTCTCACGTGGCCCCTCCGCACGGGAGCGGGACGAACGTCCGGCTCAAGAGCCAACCCTACAGCGGGAAGCCACCCGTCGACGCAAGCACGTCGACGGGGTCCTCCATTGCAGAGTCAACCACCACGAGGCAACGCAGCGGCGCTTTCCGCAAGGATACCGAATGCCAAGTCGAAGGTTCCGAAGCTCAACAGAGTCTTGGAACCGAATCGAGCTGGCCTTCGATGCAGAATTCGCTGTCGGGCAAGGACACCGACGCTGTCAATTCCTCCGTGGATGGTGTGGACTGCGATTCGAAGCCCGGTATAGCGGATGTGGACAATTGCAGGAATTCTAGCATCACAGGTAGTGGCGGTTTAGGAACTGAAAAGCATCAGTCTCAAGGAGCAGAAGTGCAGGAAGCTCCCGAACCCACCATTACCTCGTCTTCTGGTGGGTCCGGTAATAGTGCAGATAGAGGGAAAGAGGCCGCATCTAGTGGCAAGAGAAGAACCAGGGAAGGAGAGGAGTCCGAGTGCCAGAGCGAAGTGAGTAACTTGTTGCAACCCCAAGGGAGTCAAGTTGGTGCAGTAGCCCACAGGGTATGTTTTATCTAGTGATGCTAACTTTTTCCTGAATAACATCCCACTGACTGCTCTTTTTATGCGAGGATGTGTGAGAAGTGTACTTGCGTTTAATAAAAGCCAATGTTGTTTCTGGCAGCAAGATGGCGAGGACGAGATGGCCCAGCAAAAGAAACCTCAACAGAGAGGCTCCACCACTAAGAGGAGCAGGGCCGCGGAAGTCCACAACCTTTCCGAGCGAGTGAGAGTCCACCACTAACTGAGAAATTGAGCTCTGCGCCAATTGTACAGGATGGTCCAAGCCGTGAGCATATGACGGCAGTGGACAATCTAGGTCTCAAATCTTGTTTGGGTCGTCAATTTTGTGACTGATGTTAGTTTTGAAGCTCTTGGCTTCCGCAGCTTTACTGATAGAATTTCCTGCCCATTTCAGAGGCGAAGAGATCGTATCAACGAGAAGATGAAAGCTCTGCAAGAGCTGATCCCCAATTCCAACAAGGTTTGTTACAGCTTTCAGCCTTGTTCTTCGTACCTTGCCTCTTCTTTTGGATCACCGTGCGGTAACTTGCCCTTGAAATACAGTCAATGATGCAGACTTTTGATTCATATTGCAGACGGACAAAGCATCGATGCTGGATGAAGCGATCGAGTACTTGAAGATGCTCCAGTTGCAACTGCAGGTAACTATCCCAGCCTTTGACCTTCGCAGTAGTTCTCTGCTCCTCCTTGCGATGCAGGTGCTGTAGAGACGCCCGAGCACAAATACTGAATTCAATTTGCCCTCTTTAGCAGATGATGTCCATGAGAAGTGGAATGAGCATCCCCTCTATGGTGATGCCGGCGGGAATGCAACACCTTCAAATCCCGCAATTGCCCCAAATGGGCCCAATGCCTCCCATGGGAATGGGAATGGGCATGGGTATGGGCATGGGCCCGATGGGAATGGGAATGAGTATGATGGACATGGGAGGCGGAGCTCCCGGTCGACCGATGATACCCCTTCCGTCTCACAGTGGGCCTTCTCACTCTCACAACGTATCTGCAACCTCACCAGCTGTTTCTATGGTAGACACTCATGACCACCGCCTGCAAAACCCGAGCGTCATGGAGTCACTGAACGTCTTCATGGCGCAACACCGGCAAATGCAAATGGCTCCTCAGGTGATCCTTCTCTTTGAATGCCGGCTGGTTCTGTCCGATCTTCTGTCAGCTTTGTTTTTTGTGCAAATTTCCTAGGAGGAAGGAGCATGTGGTTGGGAGACGATGAAGTCTTGATTCTTACTCACTGTGCCTGTTCTTGCAGCCGATGAGTATGGATGCATTCAGTGCATTCATGATTCATCAGCACCAGCAGCAACACCAGCAGCAGCATCAACAACATCAGCTCCAACACCAACACCAGCATTCGCTCCATCATCTTCCGAGCAGCATGGGCGGTGGAGCCCCCCAATGAAGAGCGGGCCAAATTCTCGGTGGATCTTGATTTCCACGCTTGCTTTCCATTTGTCATGCCATTTCGCATTGGAGGCCAGCGATCTGTCAACAACTATCTGCTGTTCCGCTCTCGGAGAGCGTAATATACTCAGCTGCAGGCGTGGCTGTGAGTCTGACAGCCATCGTCGGGCATCAGGACACGATACAGCTGAAGGTGAAGGCGAAGGCCGATGGAGGTGTGGTCCGGTGCATCATTGGTTTCCACCTCTTAGTTTTGTAGTCTAGTTGGGGGATATGTAAACATCATGATCTCAGGTTGGAAAGTATGATTCTACTAGGACCGGATCTTGTGTAGGTGCCTTCAACCAGGCCGCAGCAGTGTTGAAGGCGTGTATTAGAACGCAGAATTGGATGATATGTATCAAGAAGGTCCTCGCTGCCCTCGCATTAGCGGCGTGCTGCGGTGCCATGCGGGGCCAGGGTCAGGGCCAGGGCGTTTCGCCTCTGTACTTTTATCAGCAAGCATAATTGCATCTTCTAACTAGCCTTAGCGAGGCGAGGTTTTGAGGATTAGTAGTTTTAGAAGAAGGAAGTGTCCGTAGTGCTGTCATTCCAGGGCCGGACCTTCTTCAATTGTTGCGGATCGGGATACTATGGCGCCGAAGTTTGCGCTCCGGCTTACGCTGTTCTCGTTGTGGATTTGGAGGGAACTCGTGTTGCCGGAAGCAGATTTCTAGTCGAAAGCCTGCCGCCCGAAATGTGCCATGTTTAATTGTCGATAAGGTTCAAGTTAAATGTTGGATTACATTCATTGTTCTCCGTTGGCTCAAGGCGAGCCACTTGTAAAAAGAAATGCCAAGTTTACCAACTTGAGACTCCTTGCACG

mRNA

>Mapoly0039s0059.2
ACGACACCCTCGCCCGGTTTCGGATGATGTTTCGTAGACGAAGAGAAATCGCGGGCCACGGCGGCCTGATGTTGTGGAACCGGGACCCAGGTTCATCCTGGCGATACAAACCGCCACGTGGAAGATTCTCGTAGGACGCAGCCGTCGAGTTTTCAGGTGAGAAATCGGAGTGGGCAGGAGGCAAATACCAACTTGTAGCTCGTCGAAGGCCGAAAGCGGCCCGGATAATTGCATCGCCTCTGCTGCTCTCTGTGCCGCACCAATGCGGCCCGGATCTTAAAATACGAAAAAAGAAAAAAGAAGGCGTCCTGGGGGAAGGTAGTGCCACCGGTGAATCTCAGGGATGAGCTCGAGAGCTGAATTCCCGAGCACCTGGAGAGAGCCATCAATTTATTGCGCTATGGGGGAGAAATCCTTGTGCCAGAGTAGGAGCTCGAACGAAGTCCGCTCTCGTTTATTAATCTCTTACAGGGTGAGGTTTAGGTGCACTGTCCTGCAGGTCTGGATGGATGGTAGGATGAGAGCGAGGTGGGGACTCTGGTGATGGAGAGCCCTCCGGAGTTAGGCAAAGGCAAGGGAAGGATAGGCAGGGGAGGACGGGTCGATGAAGCGCGCTGCCGGAGTAAGGTAACTCTCCGTGGAACGGGTGCAGGCCAGGACCTTAGGTACAGGAGTGAAGAGTAGCATGGCTAGGCTACGTCGTAGGCCCGAGGAGTAGAGCTGAGCTAAAAGCTACACTGTACGTACCTGTAAAGAGAAGAGAAGCGAGTCGACGGACGGAAAGAAGGAAGGAAGGAAGGAAAGTGGGGCGGGGCGATGAGGGAGGCGAGGAGTACAAGAATGTGGAGTAGTAAGGATATCATTTTGCTGGATGTTGCTGAAGACGATCAAGAGTCGAATTCGAGTGCGAGTCTTTGGTGCTAGAGCGGGAGGGTGGGCGATCCGAGTGCCAGATGTGGACGAGAGAAGCAGCGGAATCGATGGCTGCAGATTCGGGGCCAGTGGGCAGAGGCGGCTCGAGTCTTCCGACGGGAGGATTGAGGAGGGACACGAAGAGCTCTGAGTGATGTGATGCCATTCTGGTAGAGAAAAAGAAGGGATTCTGCTCTTGGGATCGCGCGAGGTCCCTGGGGCCAGCAAGCGCCCAGCTTGCCGAGCGGGCTCTCTGACGTCGAAGGGACTGGATTTCGAATCGGGAACGGACTGAACACCGGAAGAATCCTCTCCGGTTGTCACTACATCCCCATCAGAGACCATGAGTCACCTCGTTCCCGACTGGGATGGTAACGGTGGAGACTTAGAAGCTGTTTTACCCACAAGCGATTTCTCACTGCCGGTTAAGGGAAAGTGGGACTCATTGCCCCATAAAAGGTCGCACTTGTCTGGTTTGGCCTTCGTGCCAACCCACGATGCTGGCGAAACTGAGTGGGCAGAGGAAAGTCATATTGTAGCTATGCAGAACCAAAGCGGGAAGGGCAACAAGGCTATGTGGCAGCAGATGAATTTCCAGAATGGGTGGTCGAGTGTGCCAGAGTCTGAGGATGCCGTTACTCCTGTGAAGCCCATCAGCTCGTCGTCTCCGGGGAAGGAGCCGGTTCTTGTCAATGAGCCCGCGGTCGACACGCACCACTCCAGTGCCCTCAACATGCAGGAAGACGAGATGGTGTGCTGGCTGCAGTATCCGTTGGACGAACACCTCGAAAGAGACTACTGTTCCGAGTTCTTCGGCGAGCTGCCCAACTCCAACATATCGAACATGCAGCTGATGAAGGATTCATTCGCAGGGCAAAATCAAGTAGCGGGGCGCAACAACAGGAATCCAGGTCCCGTTAACGTAGGGAGTAACAGCAGAATGTCTAGTGCGGATGCGGCGATGGCCATGGGAGCGGGGCGAGCTGCCGGTTTGTTGCCTCAGACAGGGGTGGAGGTTTTCACCAAAGTTCGGACCACTTTGCAACCCTACGGAGGAAAGTGGTCCCCAAATCAGAACAACGCCGGGAAAACGCTGGGAGCGATGACCTCGACCCTGGCTCCGAGCCCGTCAAGATCCCCGCCGATGTCTGGGAACTTGTCGACCCCCATGCTCCCCCCGAAGTCTCAGGGACTCAGCTTCCAGCCTCCCAGAACCTCAGGCCCGATGAATTTCTCGCATTTCTCTCGCCCTGCGGCTGTGATGAAGGCCAATCTCCAGTGCCTAGGAATGTCTCACGTGGCCCCTCCGCACGGGAGCGGGACGAACGTCCGGCTCAAGAGCCAACCCTACAGCGGGAAGCCACCCGTCGACGCAAGCACGTCGACGGGGTCCTCCATTGCAGAGTCAACCACCACGAGGCAACGCAGCGGCGCTTTCCGCAAGGATACCGAATGCCAAGTCGAAGGTTCCGAAGCTCAACAGAGTCTTGGAACCGAATCGAGCTGGCCTTCGATGCAGAATTCGCTGTCGGGCAAGGACACCGACGCTGTCAATTCCTCCGTGGATGGTGTGGACTGCGATTCGAAGCCCGGTATAGCGGATGTGGACAATTGCAGGAATTCTAGCATCACAGGTAGTGGCGGTTTAGGAACTGAAAAGCATCAGTCTCAAGGAGCAGAAGTGCAGGAAGCTCCCGAACCCACCATTACCTCGTCTTCTGGTGGGTCCGGTAATAGTGCAGATAGAGGGAAAGAGGCCGCATCTAGTGGCAAGAGAAGAACCAGGGAAGGAGAGGAGTCCGAGTGCCAGAGCGAACAAGATGGCGAGGACGAGATGGCCCAGCAAAAGAAACCTCAACAGAGAGGCTCCACCACTAAGAGGAGCAGGGCCGCGGAAGTCCACAACCTTTCCGAGCGAAGGCGAAGAGATCGTATCAACGAGAAGATGAAAGCTCTGCAAGAGCTGATCCCCAATTCCAACAAGACGGACAAAGCATCGATGCTGGATGAAGCGATCGAGTACTTGAAGATGCTCCAGTTGCAACTGCAGATGATGTCCATGAGAAGTGGAATGAGCATCCCCTCTATGGTGATGCCGGCGGGAATGCAACACCTTCAAATCCCGCAATTGCCCCAAATGGGCCCAATGCCTCCCATGGGAATGGGAATGGGCATGGGTATGGGCATGGGCCCGATGGGAATGGGAATGAGTATGATGGACATGGGAGGCGGAGCTCCCGGTCGACCGATGATACCCCTTCCGTCTCACAGTGGGCCTTCTCACTCTCACAACGTATCTGCAACCTCACCAGCTGTTTCTATGGTAGACACTCATGACCACCGCCTGCAAAACCCGAGCGTCATGGAGTCACTGAACGTCTTCATGGCGCAACACCGGCAAATGCAAATGGCTCCTCAGCCGATGAGTATGGATGCATTCAGTGCATTCATGATTCATCAGCACCAGCAGCAACACCAGCAGCAGCATCAACAACATCAGCTCCAACACCAACACCAGCATTCGCTCCATCATCTTCCGAGCAGCATGGGCGGTGGAGCCCCCCAATGAAGAGCGGGCCAAATTCTCGGTGGATCTTGATTTCCACGCTTGCTTTCCATTTGTCATGCCATTTCGCATTGGAGGCCAGCGATCTGTCAACAACTATCTGCTGTTCCGCTCTCGGAGAGCGTAATATACTCAGCTGCAGGCGTGGCTGTGAGTCTGACAGCCATCGTCGGGCATCAGGACACGATACAGCTGAAGGTGAAGGCGAAGGCCGATGGAGGTGTGGTCCGGTGCATCATTGGTTTCCACCTCTTAGTTTTGTAGTCTAGTTGGGGGATATGTAAACATCATGATCTCAGGTTGGAAAGTATGATTCTACTAGGACCGGATCTTGTGTAGGTGCCTTCAACCAGGCCGCAGCAGTGTTGAAGGCGTGTATTAGAACGCAGAATTGGATGATATGTATCAAGAAGGTCCTCGCTGCCCTCGCATTAGCGGCGTGCTGCGGTGCCATGCGGGGCCAGGGTCAGGGCCAGGGCGTTTCGCCTCTGTACTTTTATCAGCAAGCATAATTGCATCTTCTAACTAGCCTTAGCGAGGCGAGGTTTTGAGGATTAGTAGTTTTAGAAGAAGGAAGTGTCCGTAGTGCTGTCATTCCAGGGCCGGACCTTCTTCAATTGTTGCGGATCGGGATACTATGGCGCCGAAGTTTGCGCTCCGGCTTACGCTGTTCTCGTTGTGGATTTGGAGGGAACTCGTGTTGCCGGAAGCAGATTTCTAGTCGAAAGCCTGCCGCCCGAAATGTGCCATGTTTAATTGTCGATAAGGTTCAAGTTAAATGTTGGATTACATTCATTGTTCTCCGTTGGCTCAAGGCGAGCCACTTGTAAAAAGAAATGCCAAGTTTACCAACTTGAGACTCCTTGCACG

CDS

>Mapoly0039s0059.2
ATGAGTCACCTCGTTCCCGACTGGGATGGTAACGGTGGAGACTTAGAAGCTGTTTTACCCACAAGCGATTTCTCACTGCCGGTTAAGGGAAAGTGGGACTCATTGCCCCATAAAAGGTCGCACTTGTCTGGTTTGGCCTTCGTGCCAACCCACGATGCTGGCGAAACTGAGTGGGCAGAGGAAAGTCATATTGTAGCTATGCAGAACCAAAGCGGGAAGGGCAACAAGGCTATGTGGCAGCAGATGAATTTCCAGAATGGGTGGTCGAGTGTGCCAGAGTCTGAGGATGCCGTTACTCCTGTGAAGCCCATCAGCTCGTCGTCTCCGGGGAAGGAGCCGGTTCTTGTCAATGAGCCCGCGGTCGACACGCACCACTCCAGTGCCCTCAACATGCAGGAAGACGAGATGGTGTGCTGGCTGCAGTATCCGTTGGACGAACACCTCGAAAGAGACTACTGTTCCGAGTTCTTCGGCGAGCTGCCCAACTCCAACATATCGAACATGCAGCTGATGAAGGATTCATTCGCAGGGCAAAATCAAGTAGCGGGGCGCAACAACAGGAATCCAGGTCCCGTTAACGTAGGGAGTAACAGCAGAATGTCTAGTGCGGATGCGGCGATGGCCATGGGAGCGGGGCGAGCTGCCGGTTTGTTGCCTCAGACAGGGGTGGAGGTTTTCACCAAAGTTCGGACCACTTTGCAACCCTACGGAGGAAAGTGGTCCCCAAATCAGAACAACGCCGGGAAAACGCTGGGAGCGATGACCTCGACCCTGGCTCCGAGCCCGTCAAGATCCCCGCCGATGTCTGGGAACTTGTCGACCCCCATGCTCCCCCCGAAGTCTCAGGGACTCAGCTTCCAGCCTCCCAGAACCTCAGGCCCGATGAATTTCTCGCATTTCTCTCGCCCTGCGGCTGTGATGAAGGCCAATCTCCAGTGCCTAGGAATGTCTCACGTGGCCCCTCCGCACGGGAGCGGGACGAACGTCCGGCTCAAGAGCCAACCCTACAGCGGGAAGCCACCCGTCGACGCAAGCACGTCGACGGGGTCCTCCATTGCAGAGTCAACCACCACGAGGCAACGCAGCGGCGCTTTCCGCAAGGATACCGAATGCCAAGTCGAAGGTTCCGAAGCTCAACAGAGTCTTGGAACCGAATCGAGCTGGCCTTCGATGCAGAATTCGCTGTCGGGCAAGGACACCGACGCTGTCAATTCCTCCGTGGATGGTGTGGACTGCGATTCGAAGCCCGGTATAGCGGATGTGGACAATTGCAGGAATTCTAGCATCACAGGTAGTGGCGGTTTAGGAACTGAAAAGCATCAGTCTCAAGGAGCAGAAGTGCAGGAAGCTCCCGAACCCACCATTACCTCGTCTTCTGGTGGGTCCGGTAATAGTGCAGATAGAGGGAAAGAGGCCGCATCTAGTGGCAAGAGAAGAACCAGGGAAGGAGAGGAGTCCGAGTGCCAGAGCGAACAAGATGGCGAGGACGAGATGGCCCAGCAAAAGAAACCTCAACAGAGAGGCTCCACCACTAAGAGGAGCAGGGCCGCGGAAGTCCACAACCTTTCCGAGCGAAGGCGAAGAGATCGTATCAACGAGAAGATGAAAGCTCTGCAAGAGCTGATCCCCAATTCCAACAAGACGGACAAAGCATCGATGCTGGATGAAGCGATCGAGTACTTGAAGATGCTCCAGTTGCAACTGCAGATGATGTCCATGAGAAGTGGAATGAGCATCCCCTCTATGGTGATGCCGGCGGGAATGCAACACCTTCAAATCCCGCAATTGCCCCAAATGGGCCCAATGCCTCCCATGGGAATGGGAATGGGCATGGGTATGGGCATGGGCCCGATGGGAATGGGAATGAGTATGATGGACATGGGAGGCGGAGCTCCCGGTCGACCGATGATACCCCTTCCGTCTCACAGTGGGCCTTCTCACTCTCACAACGTATCTGCAACCTCACCAGCTGTTTCTATGGTAGACACTCATGACCACCGCCTGCAAAACCCGAGCGTCATGGAGTCACTGAACGTCTTCATGGCGCAACACCGGCAAATGCAAATGGCTCCTCAGCCGATGAGTATGGATGCATTCAGTGCATTCATGATTCATCAGCACCAGCAGCAACACCAGCAGCAGCATCAACAACATCAGCTCCAACACCAACACCAGCATTCGCTCCATCATCTTCCGAGCAGCATGGGCGGTGGAGCCCCCCAATGA

Protein

>Mapoly0039s0059.2
MSHLVPDWDGNGGDLEAVLPTSDFSLPVKGKWDSLPHKRSHLSGLAFVPTHDAGETEWAEESHIVAMQNQSGKGNKAMWQQMNFQNGWSSVPESEDAVTPVKPISSSSPGKEPVLVNEPAVDTHHSSALNMQEDEMVCWLQYPLDEHLERDYCSEFFGELPNSNISNMQLMKDSFAGQNQVAGRNNRNPGPVNVGSNSRMSSADAAMAMGAGRAAGLLPQTGVEVFTKVRTTLQPYGGKWSPNQNNAGKTLGAMTSTLAPSPSRSPPMSGNLSTPMLPPKSQGLSFQPPRTSGPMNFSHFSRPAAVMKANLQCLGMSHVAPPHGSGTNVRLKSQPYSGKPPVDASTSTGSSIAESTTTRQRSGAFRKDTECQVEGSEAQQSLGTESSWPSMQNSLSGKDTDAVNSSVDGVDCDSKPGIADVDNCRNSSITGSGGLGTEKHQSQGAEVQEAPEPTITSSSGGSGNSADRGKEAASSGKRRTREGEESECQSEQDGEDEMAQQKKPQQRGSTTKRSRAAEVHNLSERRRRDRINEKMKALQELIPNSNKTDKASMLDEAIEYLKMLQLQLQMMSMRSGMSIPSMVMPAGMQHLQIPQLPQMGPMPPMGMGMGMGMGMGPMGMGMSMMDMGGGAPGRPMIPLPSHSGPSHSHNVSATSPAVSMVDTHDHRLQNPSVMESLNVFMAQHRQMQMAPQPMSMDAFSAFMIHQHQQQHQQQHQQHQLQHQHQHSLHHLPSSMGGGAPQ

Mapoly0039s0059.3  

Gene structure:

mRNA scaffold_39:781195..787657  ( - strand )
three_prime_UTR scaffold_39:781195..782061  ( - strand )
CDS scaffold_39:782062..782211  ( - strand )
CDS scaffold_39:782354..782725  ( - strand )
CDS scaffold_39:782835..782900  ( - strand )
CDS scaffold_39:783016..783081  ( - strand )
CDS scaffold_39:783274..783375  ( - strand )
CDS scaffold_39:783551..784880  ( - strand )
CDS scaffold_39:785069..785211  ( - strand )
five_prime_UTR scaffold_39:785212..785214  ( - strand )
five_prime_UTR scaffold_39:785613..785687  ( - strand )
five_prime_UTR scaffold_39:786481..787657  ( - strand )

Sequences:

Gene

>Mapoly0039s0059.3
ACGACACCCTCGCCCGGTTTCGGATGATGTTTCGTAGACGAAGAGAAATCGCGGGCCACGGCGGCCTGATGTTGTGGAACCGGGACCCAGGTTCATCCTGGCGATACAAACCGCCACGTGGAAGATTCTCGTAGGACGCAGCCGTCGAGTTTTCAGGTGAGAAATCGGAGTGGGCAGGAGGCAAATACCAACTTGTAGCTCGTCGAAGGCCGAAAGCGGCCCGGATAATTGCATCGCCTCTGCTGCTCTCTGTGCCGCACCAATGCGGCCCGGATCTTAAAATACGAAAAAAGAAAAAAGAAGGCGTCCTGGGGGAAGGTAGTGCCACCGGTGAATCTCAGGGATGAGCTCGAGAGCTGAATTCCCGAGCACCTGGAGAGAGCCATCAATTTATTGCGCTATGGGGGAGAAATCCTTGTGCCAGAGTAGGAGCTCGAACGAAGTCCGCTCTCGTTTATTAATCTCTTACAGGGTGAGGTTTAGGTGCACTGTCCTGCAGGTCTGGATGGATGGTAGGATGAGAGCGAGGTGGGGACTCTGGTGATGGAGAGCCCTCCGGAGTTAGGCAAAGGCAAGGGAAGGATAGGCAGGGGAGGACGGGTCGATGAAGCGCGCTGCCGGAGTAAGGTAACTCTCCGTGGAACGGGTGCAGGCCAGGACCTTAGGTACAGGAGTGAAGAGTAGCATGGCTAGGCTACGTCGTAGGCCCGAGGAGTAGAGCTGAGCTAAAAGCTACACTGTACGTACCTGTAAAGAGAAGAGAAGCGAGTCGACGGACGGAAAGAAGGAAGGAAGGAAGGAAAGTGGGGCGGGGCGATGAGGGAGGCGAGGAGTACAAGAATGTGGAGTAGTAAGGATATCATTTTGCTGGATGTTGCTGAAGACGATCAAGAGTCGAATTCGAGTGCGAGTCTTTGGTGCTAGAGCGGGAGGGTGGGCGATCCGAGTGCCAGATGTGGACGAGAGAAGCAGCGGAATCGATGGCTGCAGATTCGGGGCCAGTGGGCAGAGGCGGCTCGAGTCTTCCGACGGGAGGATTGAGGAGGGACACGAAGAGCTCTGAGTGATGTGATGCCATTCTGGTAGAGAAAAAGAAGGGATTCTGCTCTTGGGATCGCGCGAGGTCCCTGGGGCCAGCAAGCGCCCAGCTTGCCGAGCGGGCTCTCTGACGTCGAAGGTGCTGCCGCCTCTGTGTGTTTATCCCTGTGTCTCTGTGTTCTAGGCGGTTGTTGGCGGAGGGACGAGGGAGAGGAGTGGCGTTATGTCTGTCTGCTTGACAAGTTGGTACTCCTTGTGGGTCATAAGTTGGGATTTCCTTCCGCCCGTGGCACTGTTTCTGTCGGCGTGAGAAGAGCAAGTTTTCCAGCTCAAGGTTCAGTCCTATCGTTTTTATCTTCGCCTTCCCTCTCCCGCGTGTCTCCATGCATTTGATGACCTTGTCTGTCGGCGACGCTAGCCTCGAGCATCCATGTCAGGCCCACGCCGCTCTAGTGTGTATGTTTGAGTAGACAGCTCTTGTTCTCCCACATAATGAAATGTCCGCGATCACTGAGCCTTGGTAATTTTGATCTCCTTTCTCGCTCACTCTGCCGCAGGAGAGTGTGCAGCTACTTCGTTAAGTGTGCTTGTCCGCACGGTTGACATAACCTCTATGAGATCTTTAGATTCTGAGCGAGATCCTTCTCTTGTGACAGAGCCGTGAGAAAGAGCCGGGGTGGCCTGTTGTATTTCCCGAGGAGATGAATGTACAAACTGCATAAAAACTGCATCTCCTTGATGCTCCGGAATGATGAGGACATGTAAGGAAGCGTTGAGTACACCGACCCAGAAGAATCGTAAATGCATCTGCACTCTGTGTTGTAGAGTTGGGCCCATTTAGTCGACGGCGATAAGTAGCAGATTGACCCGCTTAGCGGCAAGAACCCGTTGTGCCTCTGTTTAAACTGACTGGGTTCGAATTGCTCCTACAGGGACTGGATTTCGAATCGGGAACGGACTGAACACCGGAAGAATCCTCTCCGGTTGTCACTACATCCCCATCAGAGGTGAGTTCAGTGTGGGAAGCCTGTCGAGAGATCGGCGAGCTGGTGATTCTTACTTGCTTTCTGTCTGTGTTTGGAGCGTCTACCTTTCTCGTAATCTACCCATACCTTTCCCGTCACTGAGAAATGAAGAGGCTTTAAAAGTAGGTGAACTTCGAGACTTGGGTGCCATGAGAGTAGATTAGAAGTAGGACGAGCAGGAGACGACTGCAAACTGTCGAAGTCTTCACCTCTCATCTTCTCATTCCCACTGCCATGCCTTACTCACGACCATCCACTACCTCTATGTATGTGGGAGCGCTTCTGGCGAAGCGCTGGGCATTGACAGTGACAGGCCGAGAAGTCGATGCCGTAGCAGTCTAGGTAGGCATTTGATTTACCTCCTCCTGTTTGACTCGCAGACCATGAGTCACCTCGTTCCCGACTGGGATGGTAACGGTGGAGACTTAGAAGCTGTTTTACCCACAAGCGATTTCTCACTGCCGGTTAAGGGAAAGTGGGACTCATTGCCCCATAAAAGGTCGCACTTGTCTGGTTTGGCCTTCGTGTAAGCGCTTGCTCCGGCTTTTCAATCCCCATAGTTTTTTGTGTTCTTGATACCATTGTATGTAAGGTCAATTTCTTGATTGTGGATCTTTGAGAATGCCACTTCGTGATGCCGGCTCGTTGACATGCTGCTCTTCGTCACATGAGCTTCGAAGAGATGTTAAAGGTCGCGTTCTTCTTCTTCTACAGGCCAACCCACGATGCTGGCGAAACTGAGTGGGCAGAGGAAAGTCATATTGTAGCTATGCAGAACCAAAGCGGGAAGGGCAACAAGGCTATGTGGCAGCAGATGAATTTCCAGAATGGGTGGTCGAGTGTGCCAGAGTCTGAGGATGCCGTTACTCCTGTGAAGCCCATCAGCTCGTCGTCTCCGGGGAAGGAGCCGGTTCTTGTCAATGAGCCCGCGGTCGACACGCACCACTCCAGTGCCCTCAACATGCAGGAAGACGAGATGGTGTGCTGGCTGCAGTATCCGTTGGACGAACACCTCGAAAGAGACTACTGTTCCGAGTTCTTCGGCGAGCTGCCCAACTCCAACATATCGAACATGCAGCTGATGAAGGATTCATTCGCAGGGCAAAATCAAGTAGCGGGGCGCAACAACAGGAATCCAGGTCCCGTTAACGTAGGGAGTAACAGCAGAATGTCTAGTGCGGATGCGGCGATGGCCATGGGAGCGGGGCGAGCTGCCGGTTTGTTGCCTCAGACAGGGGTGGAGGTTTTCACCAAAGTTCGGACCACTTTGCAACCCTACGGAGGAAAGTGGTCCCCAAATCAGAACAACGCCGGGAAAACGCTGGGAGCGATGACCTCGACCCTGGCTCCGAGCCCGTCAAGATCCCCGCCGATGTCTGGGAACTTGTCGACCCCCATGCTCCCCCCGAAGTCTCAGGGACTCAGCTTCCAGCCTCCCAGAACCTCAGGCCCGATGAATTTCTCGCATTTCTCTCGCCCTGCGGCTGTGATGAAGGCCAATCTCCAGTGCCTAGGAATGTCTCACGTGGCCCCTCCGCACGGGAGCGGGACGAACGTCCGGCTCAAGAGCCAACCCTACAGCGGGAAGCCACCCGTCGACGCAAGCACGTCGACGGGGTCCTCCATTGCAGAGTCAACCACCACGAGGCAACGCAGCGGCGCTTTCCGCAAGGATACCGAATGCCAAGTCGAAGGTTCCGAAGCTCAACAGAGTCTTGGAACCGAATCGAGCTGGCCTTCGATGCAGAATTCGCTGTCGGGCAAGGACACCGACGCTGTCAATTCCTCCGTGGATGGTGTGGACTGCGATTCGAAGCCCGGTATAGCGGATGTGGACAATTGCAGGAATTCTAGCATCACAGGTAGTGGCGGTTTAGGAACTGAAAAGCATCAGTCTCAAGGAGCAGAAGTGCAGGAAGCTCCCGAACCCACCATTACCTCGTCTTCTGGTGGGTCCGGTAATAGTGCAGATAGAGGGAAAGAGGCCGCATCTAGTGGCAAGAGAAGAACCAGGGAAGGAGAGGAGTCCGAGTGCCAGAGCGAAGTGAGTAACTTGTTGCAACCCCAAGGGAGTCAAGTTGGTGCAGTAGCCCACAGGGTATGTTTTATCTAGTGATGCTAACTTTTTCCTGAATAACATCCCACTGACTGCTCTTTTTATGCGAGGATGTGTGAGAAGTGTACTTGCGTTTAATAAAAGCCAATGTTGTTTCTGGCAGCAAGATGGCGAGGACGAGATGGCCCAGCAAAAGAAACCTCAACAGAGAGGCTCCACCACTAAGAGGAGCAGGGCCGCGGAAGTCCACAACCTTTCCGAGCGAGTGAGAGTCCACCACTAACTGAGAAATTGAGCTCTGCGCCAATTGTACAGGATGGTCCAAGCCGTGAGCATATGACGGCAGTGGACAATCTAGGTCTCAAATCTTGTTTGGGTCGTCAATTTTGTGACTGATGTTAGTTTTGAAGCTCTTGGCTTCCGCAGCTTTACTGATAGAATTTCCTGCCCATTTCAGAGGCGAAGAGATCGTATCAACGAGAAGATGAAAGCTCTGCAAGAGCTGATCCCCAATTCCAACAAGGTTTGTTACAGCTTTCAGCCTTGTTCTTCGTACCTTGCCTCTTCTTTTGGATCACCGTGCGGTAACTTGCCCTTGAAATACAGTCAATGATGCAGACTTTTGATTCATATTGCAGACGGACAAAGCATCGATGCTGGATGAAGCGATCGAGTACTTGAAGATGCTCCAGTTGCAACTGCAGGTAACTATCCCAGCCTTTGACCTTCGCAGTAGTTCTCTGCTCCTCCTTGCGATGCAGGTGCTGTAGAGACGCCCGAGCACAAATACTGAATTCAATTTGCCCTCTTTAGCAGATGATGTCCATGAGAAGTGGAATGAGCATCCCCTCTATGGTGATGCCGGCGGGAATGCAACACCTTCAAATCCCGCAATTGCCCCAAATGGGCCCAATGCCTCCCATGGGAATGGGAATGGGCATGGGTATGGGCATGGGCCCGATGGGAATGGGAATGAGTATGATGGACATGGGAGGCGGAGCTCCCGGTCGACCGATGATACCCCTTCCGTCTCACAGTGGGCCTTCTCACTCTCACAACGTATCTGCAACCTCACCAGCTGTTTCTATGGTAGACACTCATGACCACCGCCTGCAAAACCCGAGCGTCATGGAGTCACTGAACGTCTTCATGGCGCAACACCGGCAAATGCAAATGGCTCCTCAGGTGATCCTTCTCTTTGAATGCCGGCTGGTTCTGTCCGATCTTCTGTCAGCTTTGTTTTTTGTGCAAATTTCCTAGGAGGAAGGAGCATGTGGTTGGGAGACGATGAAGTCTTGATTCTTACTCACTGTGCCTGTTCTTGCAGCCGATGAGTATGGATGCATTCAGTGCATTCATGATTCATCAGCACCAGCAGCAACACCAGCAGCAGCATCAACAACATCAGCTCCAACACCAACACCAGCATTCGCTCCATCATCTTCCGAGCAGCATGGGCGGTGGAGCCCCCCAATGAAGAGCGGGCCAAATTCTCGGTGGATCTTGATTTCCACGCTTGCTTTCCATTTGTCATGCCATTTCGCATTGGAGGCCAGCGATCTGTCAACAACTATCTGCTGTTCCGCTCTCGGAGAGCGTAATATACTCAGCTGCAGGCGTGGCTGTGAGTCTGACAGCCATCGTCGGGCATCAGGACACGATACAGCTGAAGGTGAAGGCGAAGGCCGATGGAGGTGTGGTCCGGTGCATCATTGGTTTCCACCTCTTAGTTTTGTAGTCTAGTTGGGGGATATGTAAACATCATGATCTCAGGTTGGAAAGTATGATTCTACTAGGACCGGATCTTGTGTAGGTGCCTTCAACCAGGCCGCAGCAGTGTTGAAGGCGTGTATTAGAACGCAGAATTGGATGATATGTATCAAGAAGGTCCTCGCTGCCCTCGCATTAGCGGCGTGCTGCGGTGCCATGCGGGGCCAGGGTCAGGGCCAGGGCGTTTCGCCTCTGTACTTTTATCAGCAAGCATAATTGCATCTTCTAACTAGCCTTAGCGAGGCGAGGTTTTGAGGATTAGTAGTTTTAGAAGAAGGAAGTGTCCGTAGTGCTGTCATTCCAGGGCCGGACCTTCTTCAATTGTTGCGGATCGGGATACTATGGCGCCGAAGTTTGCGCTCCGGCTTACGCTGTTCTCGTTGTGGATTTGGAGGGAACTCGTGTTGCCGGAAGCAGATTTCTAGTCGAAAGCCTGCCGCCCGAAATGTGCCATGTTTAATTGTCGATAAGGTTCAAGTTAAATGTTGGATTACATTCATTGTTCTCCGTTGGCTCAAGGCGAGCCACTTGTAAAAAGAAATGCCAAGTTTACCAACTTGAGACTCCTTGCACG

mRNA

>Mapoly0039s0059.3
ACGACACCCTCGCCCGGTTTCGGATGATGTTTCGTAGACGAAGAGAAATCGCGGGCCACGGCGGCCTGATGTTGTGGAACCGGGACCCAGGTTCATCCTGGCGATACAAACCGCCACGTGGAAGATTCTCGTAGGACGCAGCCGTCGAGTTTTCAGGTGAGAAATCGGAGTGGGCAGGAGGCAAATACCAACTTGTAGCTCGTCGAAGGCCGAAAGCGGCCCGGATAATTGCATCGCCTCTGCTGCTCTCTGTGCCGCACCAATGCGGCCCGGATCTTAAAATACGAAAAAAGAAAAAAGAAGGCGTCCTGGGGGAAGGTAGTGCCACCGGTGAATCTCAGGGATGAGCTCGAGAGCTGAATTCCCGAGCACCTGGAGAGAGCCATCAATTTATTGCGCTATGGGGGAGAAATCCTTGTGCCAGAGTAGGAGCTCGAACGAAGTCCGCTCTCGTTTATTAATCTCTTACAGGGTGAGGTTTAGGTGCACTGTCCTGCAGGTCTGGATGGATGGTAGGATGAGAGCGAGGTGGGGACTCTGGTGATGGAGAGCCCTCCGGAGTTAGGCAAAGGCAAGGGAAGGATAGGCAGGGGAGGACGGGTCGATGAAGCGCGCTGCCGGAGTAAGGTAACTCTCCGTGGAACGGGTGCAGGCCAGGACCTTAGGTACAGGAGTGAAGAGTAGCATGGCTAGGCTACGTCGTAGGCCCGAGGAGTAGAGCTGAGCTAAAAGCTACACTGTACGTACCTGTAAAGAGAAGAGAAGCGAGTCGACGGACGGAAAGAAGGAAGGAAGGAAGGAAAGTGGGGCGGGGCGATGAGGGAGGCGAGGAGTACAAGAATGTGGAGTAGTAAGGATATCATTTTGCTGGATGTTGCTGAAGACGATCAAGAGTCGAATTCGAGTGCGAGTCTTTGGTGCTAGAGCGGGAGGGTGGGCGATCCGAGTGCCAGATGTGGACGAGAGAAGCAGCGGAATCGATGGCTGCAGATTCGGGGCCAGTGGGCAGAGGCGGCTCGAGTCTTCCGACGGGAGGATTGAGGAGGGACACGAAGAGCTCTGAGTGATGTGATGCCATTCTGGTAGAGAAAAAGAAGGGATTCTGCTCTTGGGATCGCGCGAGGTCCCTGGGGCCAGCAAGCGCCCAGCTTGCCGAGCGGGCTCTCTGACGTCGAAGGGACTGGATTTCGAATCGGGAACGGACTGAACACCGGAAGAATCCTCTCCGGTTGTCACTACATCCCCATCAGAGACCATGAGTCACCTCGTTCCCGACTGGGATGGTAACGGTGGAGACTTAGAAGCTGTTTTACCCACAAGCGATTTCTCACTGCCGGTTAAGGGAAAGTGGGACTCATTGCCCCATAAAAGGTCGCACTTGTCTGGTTTGGCCTTCGTGCCAACCCACGATGCTGGCGAAACTGAGTGGGCAGAGGAAAGTCATATTGTAGCTATGCAGAACCAAAGCGGGAAGGGCAACAAGGCTATGTGGCAGCAGATGAATTTCCAGAATGGGTGGTCGAGTGTGCCAGAGTCTGAGGATGCCGTTACTCCTGTGAAGCCCATCAGCTCGTCGTCTCCGGGGAAGGAGCCGGTTCTTGTCAATGAGCCCGCGGTCGACACGCACCACTCCAGTGCCCTCAACATGCAGGAAGACGAGATGGTGTGCTGGCTGCAGTATCCGTTGGACGAACACCTCGAAAGAGACTACTGTTCCGAGTTCTTCGGCGAGCTGCCCAACTCCAACATATCGAACATGCAGCTGATGAAGGATTCATTCGCAGGGCAAAATCAAGTAGCGGGGCGCAACAACAGGAATCCAGGTCCCGTTAACGTAGGGAGTAACAGCAGAATGTCTAGTGCGGATGCGGCGATGGCCATGGGAGCGGGGCGAGCTGCCGGTTTGTTGCCTCAGACAGGGGTGGAGGTTTTCACCAAAGTTCGGACCACTTTGCAACCCTACGGAGGAAAGTGGTCCCCAAATCAGAACAACGCCGGGAAAACGCTGGGAGCGATGACCTCGACCCTGGCTCCGAGCCCGTCAAGATCCCCGCCGATGTCTGGGAACTTGTCGACCCCCATGCTCCCCCCGAAGTCTCAGGGACTCAGCTTCCAGCCTCCCAGAACCTCAGGCCCGATGAATTTCTCGCATTTCTCTCGCCCTGCGGCTGTGATGAAGGCCAATCTCCAGTGCCTAGGAATGTCTCACGTGGCCCCTCCGCACGGGAGCGGGACGAACGTCCGGCTCAAGAGCCAACCCTACAGCGGGAAGCCACCCGTCGACGCAAGCACGTCGACGGGGTCCTCCATTGCAGAGTCAACCACCACGAGGCAACGCAGCGGCGCTTTCCGCAAGGATACCGAATGCCAAGTCGAAGGTTCCGAAGCTCAACAGAGTCTTGGAACCGAATCGAGCTGGCCTTCGATGCAGAATTCGCTGTCGGGCAAGGACACCGACGCTGTCAATTCCTCCGTGGATGGTGTGGACTGCGATTCGAAGCCCGGTATAGCGGATGTGGACAATTGCAGGAATTCTAGCATCACAGGTAGTGGCGGTTTAGGAACTGAAAAGCATCAGTCTCAAGGAGCAGAAGTGCAGGAAGCTCCCGAACCCACCATTACCTCGTCTTCTGGTGGGTCCGGTAATAGTGCAGATAGAGGGAAAGAGGCCGCATCTAGTGGCAAGAGAAGAACCAGGGAAGGAGAGGAGTCCGAGTGCCAGAGCGAACAAGATGGCGAGGACGAGATGGCCCAGCAAAAGAAACCTCAACAGAGAGGCTCCACCACTAAGAGGAGCAGGGCCGCGGAAGTCCACAACCTTTCCGAGCGAAGGCGAAGAGATCGTATCAACGAGAAGATGAAAGCTCTGCAAGAGCTGATCCCCAATTCCAACAAGACGGACAAAGCATCGATGCTGGATGAAGCGATCGAGTACTTGAAGATGCTCCAGTTGCAACTGCAGCAGATGATGTCCATGAGAAGTGGAATGAGCATCCCCTCTATGGTGATGCCGGCGGGAATGCAACACCTTCAAATCCCGCAATTGCCCCAAATGGGCCCAATGCCTCCCATGGGAATGGGAATGGGCATGGGTATGGGCATGGGCCCGATGGGAATGGGAATGAGTATGATGGACATGGGAGGCGGAGCTCCCGGTCGACCGATGATACCCCTTCCGTCTCACAGTGGGCCTTCTCACTCTCACAACGTATCTGCAACCTCACCAGCTGTTTCTATGGTAGACACTCATGACCACCGCCTGCAAAACCCGAGCGTCATGGAGTCACTGAACGTCTTCATGGCGCAACACCGGCAAATGCAAATGGCTCCTCAGCCGATGAGTATGGATGCATTCAGTGCATTCATGATTCATCAGCACCAGCAGCAACACCAGCAGCAGCATCAACAACATCAGCTCCAACACCAACACCAGCATTCGCTCCATCATCTTCCGAGCAGCATGGGCGGTGGAGCCCCCCAATGAAGAGCGGGCCAAATTCTCGGTGGATCTTGATTTCCACGCTTGCTTTCCATTTGTCATGCCATTTCGCATTGGAGGCCAGCGATCTGTCAACAACTATCTGCTGTTCCGCTCTCGGAGAGCGTAATATACTCAGCTGCAGGCGTGGCTGTGAGTCTGACAGCCATCGTCGGGCATCAGGACACGATACAGCTGAAGGTGAAGGCGAAGGCCGATGGAGGTGTGGTCCGGTGCATCATTGGTTTCCACCTCTTAGTTTTGTAGTCTAGTTGGGGGATATGTAAACATCATGATCTCAGGTTGGAAAGTATGATTCTACTAGGACCGGATCTTGTGTAGGTGCCTTCAACCAGGCCGCAGCAGTGTTGAAGGCGTGTATTAGAACGCAGAATTGGATGATATGTATCAAGAAGGTCCTCGCTGCCCTCGCATTAGCGGCGTGCTGCGGTGCCATGCGGGGCCAGGGTCAGGGCCAGGGCGTTTCGCCTCTGTACTTTTATCAGCAAGCATAATTGCATCTTCTAACTAGCCTTAGCGAGGCGAGGTTTTGAGGATTAGTAGTTTTAGAAGAAGGAAGTGTCCGTAGTGCTGTCATTCCAGGGCCGGACCTTCTTCAATTGTTGCGGATCGGGATACTATGGCGCCGAAGTTTGCGCTCCGGCTTACGCTGTTCTCGTTGTGGATTTGGAGGGAACTCGTGTTGCCGGAAGCAGATTTCTAGTCGAAAGCCTGCCGCCCGAAATGTGCCATGTTTAATTGTCGATAAGGTTCAAGTTAAATGTTGGATTACATTCATTGTTCTCCGTTGGCTCAAGGCGAGCCACTTGTAAAAAGAAATGCCAAGTTTACCAACTTGAGACTCCTTGCACG

CDS

>Mapoly0039s0059.3
ATGAGTCACCTCGTTCCCGACTGGGATGGTAACGGTGGAGACTTAGAAGCTGTTTTACCCACAAGCGATTTCTCACTGCCGGTTAAGGGAAAGTGGGACTCATTGCCCCATAAAAGGTCGCACTTGTCTGGTTTGGCCTTCGTGCCAACCCACGATGCTGGCGAAACTGAGTGGGCAGAGGAAAGTCATATTGTAGCTATGCAGAACCAAAGCGGGAAGGGCAACAAGGCTATGTGGCAGCAGATGAATTTCCAGAATGGGTGGTCGAGTGTGCCAGAGTCTGAGGATGCCGTTACTCCTGTGAAGCCCATCAGCTCGTCGTCTCCGGGGAAGGAGCCGGTTCTTGTCAATGAGCCCGCGGTCGACACGCACCACTCCAGTGCCCTCAACATGCAGGAAGACGAGATGGTGTGCTGGCTGCAGTATCCGTTGGACGAACACCTCGAAAGAGACTACTGTTCCGAGTTCTTCGGCGAGCTGCCCAACTCCAACATATCGAACATGCAGCTGATGAAGGATTCATTCGCAGGGCAAAATCAAGTAGCGGGGCGCAACAACAGGAATCCAGGTCCCGTTAACGTAGGGAGTAACAGCAGAATGTCTAGTGCGGATGCGGCGATGGCCATGGGAGCGGGGCGAGCTGCCGGTTTGTTGCCTCAGACAGGGGTGGAGGTTTTCACCAAAGTTCGGACCACTTTGCAACCCTACGGAGGAAAGTGGTCCCCAAATCAGAACAACGCCGGGAAAACGCTGGGAGCGATGACCTCGACCCTGGCTCCGAGCCCGTCAAGATCCCCGCCGATGTCTGGGAACTTGTCGACCCCCATGCTCCCCCCGAAGTCTCAGGGACTCAGCTTCCAGCCTCCCAGAACCTCAGGCCCGATGAATTTCTCGCATTTCTCTCGCCCTGCGGCTGTGATGAAGGCCAATCTCCAGTGCCTAGGAATGTCTCACGTGGCCCCTCCGCACGGGAGCGGGACGAACGTCCGGCTCAAGAGCCAACCCTACAGCGGGAAGCCACCCGTCGACGCAAGCACGTCGACGGGGTCCTCCATTGCAGAGTCAACCACCACGAGGCAACGCAGCGGCGCTTTCCGCAAGGATACCGAATGCCAAGTCGAAGGTTCCGAAGCTCAACAGAGTCTTGGAACCGAATCGAGCTGGCCTTCGATGCAGAATTCGCTGTCGGGCAAGGACACCGACGCTGTCAATTCCTCCGTGGATGGTGTGGACTGCGATTCGAAGCCCGGTATAGCGGATGTGGACAATTGCAGGAATTCTAGCATCACAGGTAGTGGCGGTTTAGGAACTGAAAAGCATCAGTCTCAAGGAGCAGAAGTGCAGGAAGCTCCCGAACCCACCATTACCTCGTCTTCTGGTGGGTCCGGTAATAGTGCAGATAGAGGGAAAGAGGCCGCATCTAGTGGCAAGAGAAGAACCAGGGAAGGAGAGGAGTCCGAGTGCCAGAGCGAACAAGATGGCGAGGACGAGATGGCCCAGCAAAAGAAACCTCAACAGAGAGGCTCCACCACTAAGAGGAGCAGGGCCGCGGAAGTCCACAACCTTTCCGAGCGAAGGCGAAGAGATCGTATCAACGAGAAGATGAAAGCTCTGCAAGAGCTGATCCCCAATTCCAACAAGACGGACAAAGCATCGATGCTGGATGAAGCGATCGAGTACTTGAAGATGCTCCAGTTGCAACTGCAGCAGATGATGTCCATGAGAAGTGGAATGAGCATCCCCTCTATGGTGATGCCGGCGGGAATGCAACACCTTCAAATCCCGCAATTGCCCCAAATGGGCCCAATGCCTCCCATGGGAATGGGAATGGGCATGGGTATGGGCATGGGCCCGATGGGAATGGGAATGAGTATGATGGACATGGGAGGCGGAGCTCCCGGTCGACCGATGATACCCCTTCCGTCTCACAGTGGGCCTTCTCACTCTCACAACGTATCTGCAACCTCACCAGCTGTTTCTATGGTAGACACTCATGACCACCGCCTGCAAAACCCGAGCGTCATGGAGTCACTGAACGTCTTCATGGCGCAACACCGGCAAATGCAAATGGCTCCTCAGCCGATGAGTATGGATGCATTCAGTGCATTCATGATTCATCAGCACCAGCAGCAACACCAGCAGCAGCATCAACAACATCAGCTCCAACACCAACACCAGCATTCGCTCCATCATCTTCCGAGCAGCATGGGCGGTGGAGCCCCCCAATGA

Protein

>Mapoly0039s0059.3
MSHLVPDWDGNGGDLEAVLPTSDFSLPVKGKWDSLPHKRSHLSGLAFVPTHDAGETEWAEESHIVAMQNQSGKGNKAMWQQMNFQNGWSSVPESEDAVTPVKPISSSSPGKEPVLVNEPAVDTHHSSALNMQEDEMVCWLQYPLDEHLERDYCSEFFGELPNSNISNMQLMKDSFAGQNQVAGRNNRNPGPVNVGSNSRMSSADAAMAMGAGRAAGLLPQTGVEVFTKVRTTLQPYGGKWSPNQNNAGKTLGAMTSTLAPSPSRSPPMSGNLSTPMLPPKSQGLSFQPPRTSGPMNFSHFSRPAAVMKANLQCLGMSHVAPPHGSGTNVRLKSQPYSGKPPVDASTSTGSSIAESTTTRQRSGAFRKDTECQVEGSEAQQSLGTESSWPSMQNSLSGKDTDAVNSSVDGVDCDSKPGIADVDNCRNSSITGSGGLGTEKHQSQGAEVQEAPEPTITSSSGGSGNSADRGKEAASSGKRRTREGEESECQSEQDGEDEMAQQKKPQQRGSTTKRSRAAEVHNLSERRRRDRINEKMKALQELIPNSNKTDKASMLDEAIEYLKMLQLQLQQMMSMRSGMSIPSMVMPAGMQHLQIPQLPQMGPMPPMGMGMGMGMGMGPMGMGMSMMDMGGGAPGRPMIPLPSHSGPSHSHNVSATSPAVSMVDTHDHRLQNPSVMESLNVFMAQHRQMQMAPQPMSMDAFSAFMIHQHQQQHQQQHQQHQLQHQHQHSLHHLPSSMGGGAPQ

Mapoly0039s0059.4  

Gene structure:

mRNA scaffold_39:781195..787657  ( - strand )
three_prime_UTR scaffold_39:781195..782061  ( - strand )
CDS scaffold_39:782062..782211  ( - strand )
CDS scaffold_39:782354..782722  ( - strand )
CDS scaffold_39:782835..782900  ( - strand )
CDS scaffold_39:783016..783081  ( - strand )
CDS scaffold_39:783274..783375  ( - strand )
CDS scaffold_39:783497..784880  ( - strand )
CDS scaffold_39:785069..785211  ( - strand )
five_prime_UTR scaffold_39:785212..785214  ( - strand )
five_prime_UTR scaffold_39:785613..785687  ( - strand )
five_prime_UTR scaffold_39:786481..787657  ( - strand )

Sequences:

Gene

>Mapoly0039s0059.4
ACGACACCCTCGCCCGGTTTCGGATGATGTTTCGTAGACGAAGAGAAATCGCGGGCCACGGCGGCCTGATGTTGTGGAACCGGGACCCAGGTTCATCCTGGCGATACAAACCGCCACGTGGAAGATTCTCGTAGGACGCAGCCGTCGAGTTTTCAGGTGAGAAATCGGAGTGGGCAGGAGGCAAATACCAACTTGTAGCTCGTCGAAGGCCGAAAGCGGCCCGGATAATTGCATCGCCTCTGCTGCTCTCTGTGCCGCACCAATGCGGCCCGGATCTTAAAATACGAAAAAAGAAAAAAGAAGGCGTCCTGGGGGAAGGTAGTGCCACCGGTGAATCTCAGGGATGAGCTCGAGAGCTGAATTCCCGAGCACCTGGAGAGAGCCATCAATTTATTGCGCTATGGGGGAGAAATCCTTGTGCCAGAGTAGGAGCTCGAACGAAGTCCGCTCTCGTTTATTAATCTCTTACAGGGTGAGGTTTAGGTGCACTGTCCTGCAGGTCTGGATGGATGGTAGGATGAGAGCGAGGTGGGGACTCTGGTGATGGAGAGCCCTCCGGAGTTAGGCAAAGGCAAGGGAAGGATAGGCAGGGGAGGACGGGTCGATGAAGCGCGCTGCCGGAGTAAGGTAACTCTCCGTGGAACGGGTGCAGGCCAGGACCTTAGGTACAGGAGTGAAGAGTAGCATGGCTAGGCTACGTCGTAGGCCCGAGGAGTAGAGCTGAGCTAAAAGCTACACTGTACGTACCTGTAAAGAGAAGAGAAGCGAGTCGACGGACGGAAAGAAGGAAGGAAGGAAGGAAAGTGGGGCGGGGCGATGAGGGAGGCGAGGAGTACAAGAATGTGGAGTAGTAAGGATATCATTTTGCTGGATGTTGCTGAAGACGATCAAGAGTCGAATTCGAGTGCGAGTCTTTGGTGCTAGAGCGGGAGGGTGGGCGATCCGAGTGCCAGATGTGGACGAGAGAAGCAGCGGAATCGATGGCTGCAGATTCGGGGCCAGTGGGCAGAGGCGGCTCGAGTCTTCCGACGGGAGGATTGAGGAGGGACACGAAGAGCTCTGAGTGATGTGATGCCATTCTGGTAGAGAAAAAGAAGGGATTCTGCTCTTGGGATCGCGCGAGGTCCCTGGGGCCAGCAAGCGCCCAGCTTGCCGAGCGGGCTCTCTGACGTCGAAGGTGCTGCCGCCTCTGTGTGTTTATCCCTGTGTCTCTGTGTTCTAGGCGGTTGTTGGCGGAGGGACGAGGGAGAGGAGTGGCGTTATGTCTGTCTGCTTGACAAGTTGGTACTCCTTGTGGGTCATAAGTTGGGATTTCCTTCCGCCCGTGGCACTGTTTCTGTCGGCGTGAGAAGAGCAAGTTTTCCAGCTCAAGGTTCAGTCCTATCGTTTTTATCTTCGCCTTCCCTCTCCCGCGTGTCTCCATGCATTTGATGACCTTGTCTGTCGGCGACGCTAGCCTCGAGCATCCATGTCAGGCCCACGCCGCTCTAGTGTGTATGTTTGAGTAGACAGCTCTTGTTCTCCCACATAATGAAATGTCCGCGATCACTGAGCCTTGGTAATTTTGATCTCCTTTCTCGCTCACTCTGCCGCAGGAGAGTGTGCAGCTACTTCGTTAAGTGTGCTTGTCCGCACGGTTGACATAACCTCTATGAGATCTTTAGATTCTGAGCGAGATCCTTCTCTTGTGACAGAGCCGTGAGAAAGAGCCGGGGTGGCCTGTTGTATTTCCCGAGGAGATGAATGTACAAACTGCATAAAAACTGCATCTCCTTGATGCTCCGGAATGATGAGGACATGTAAGGAAGCGTTGAGTACACCGACCCAGAAGAATCGTAAATGCATCTGCACTCTGTGTTGTAGAGTTGGGCCCATTTAGTCGACGGCGATAAGTAGCAGATTGACCCGCTTAGCGGCAAGAACCCGTTGTGCCTCTGTTTAAACTGACTGGGTTCGAATTGCTCCTACAGGGACTGGATTTCGAATCGGGAACGGACTGAACACCGGAAGAATCCTCTCCGGTTGTCACTACATCCCCATCAGAGGTGAGTTCAGTGTGGGAAGCCTGTCGAGAGATCGGCGAGCTGGTGATTCTTACTTGCTTTCTGTCTGTGTTTGGAGCGTCTACCTTTCTCGTAATCTACCCATACCTTTCCCGTCACTGAGAAATGAAGAGGCTTTAAAAGTAGGTGAACTTCGAGACTTGGGTGCCATGAGAGTAGATTAGAAGTAGGACGAGCAGGAGACGACTGCAAACTGTCGAAGTCTTCACCTCTCATCTTCTCATTCCCACTGCCATGCCTTACTCACGACCATCCACTACCTCTATGTATGTGGGAGCGCTTCTGGCGAAGCGCTGGGCATTGACAGTGACAGGCCGAGAAGTCGATGCCGTAGCAGTCTAGGTAGGCATTTGATTTACCTCCTCCTGTTTGACTCGCAGACCATGAGTCACCTCGTTCCCGACTGGGATGGTAACGGTGGAGACTTAGAAGCTGTTTTACCCACAAGCGATTTCTCACTGCCGGTTAAGGGAAAGTGGGACTCATTGCCCCATAAAAGGTCGCACTTGTCTGGTTTGGCCTTCGTGTAAGCGCTTGCTCCGGCTTTTCAATCCCCATAGTTTTTTGTGTTCTTGATACCATTGTATGTAAGGTCAATTTCTTGATTGTGGATCTTTGAGAATGCCACTTCGTGATGCCGGCTCGTTGACATGCTGCTCTTCGTCACATGAGCTTCGAAGAGATGTTAAAGGTCGCGTTCTTCTTCTTCTACAGGCCAACCCACGATGCTGGCGAAACTGAGTGGGCAGAGGAAAGTCATATTGTAGCTATGCAGAACCAAAGCGGGAAGGGCAACAAGGCTATGTGGCAGCAGATGAATTTCCAGAATGGGTGGTCGAGTGTGCCAGAGTCTGAGGATGCCGTTACTCCTGTGAAGCCCATCAGCTCGTCGTCTCCGGGGAAGGAGCCGGTTCTTGTCAATGAGCCCGCGGTCGACACGCACCACTCCAGTGCCCTCAACATGCAGGAAGACGAGATGGTGTGCTGGCTGCAGTATCCGTTGGACGAACACCTCGAAAGAGACTACTGTTCCGAGTTCTTCGGCGAGCTGCCCAACTCCAACATATCGAACATGCAGCTGATGAAGGATTCATTCGCAGGGCAAAATCAAGTAGCGGGGCGCAACAACAGGAATCCAGGTCCCGTTAACGTAGGGAGTAACAGCAGAATGTCTAGTGCGGATGCGGCGATGGCCATGGGAGCGGGGCGAGCTGCCGGTTTGTTGCCTCAGACAGGGGTGGAGGTTTTCACCAAAGTTCGGACCACTTTGCAACCCTACGGAGGAAAGTGGTCCCCAAATCAGAACAACGCCGGGAAAACGCTGGGAGCGATGACCTCGACCCTGGCTCCGAGCCCGTCAAGATCCCCGCCGATGTCTGGGAACTTGTCGACCCCCATGCTCCCCCCGAAGTCTCAGGGACTCAGCTTCCAGCCTCCCAGAACCTCAGGCCCGATGAATTTCTCGCATTTCTCTCGCCCTGCGGCTGTGATGAAGGCCAATCTCCAGTGCCTAGGAATGTCTCACGTGGCCCCTCCGCACGGGAGCGGGACGAACGTCCGGCTCAAGAGCCAACCCTACAGCGGGAAGCCACCCGTCGACGCAAGCACGTCGACGGGGTCCTCCATTGCAGAGTCAACCACCACGAGGCAACGCAGCGGCGCTTTCCGCAAGGATACCGAATGCCAAGTCGAAGGTTCCGAAGCTCAACAGAGTCTTGGAACCGAATCGAGCTGGCCTTCGATGCAGAATTCGCTGTCGGGCAAGGACACCGACGCTGTCAATTCCTCCGTGGATGGTGTGGACTGCGATTCGAAGCCCGGTATAGCGGATGTGGACAATTGCAGGAATTCTAGCATCACAGGTAGTGGCGGTTTAGGAACTGAAAAGCATCAGTCTCAAGGAGCAGAAGTGCAGGAAGCTCCCGAACCCACCATTACCTCGTCTTCTGGTGGGTCCGGTAATAGTGCAGATAGAGGGAAAGAGGCCGCATCTAGTGGCAAGAGAAGAACCAGGGAAGGAGAGGAGTCCGAGTGCCAGAGCGAAGTGAGTAACTTGTTGCAACCCCAAGGGAGTCAAGTTGGTGCAGTAGCCCACAGGGTATGTTTTATCTAGTGATGCTAACTTTTTCCTGAATAACATCCCACTGACTGCTCTTTTTATGCGAGGATGTGTGAGAAGTGTACTTGCGTTTAATAAAAGCCAATGTTGTTTCTGGCAGCAAGATGGCGAGGACGAGATGGCCCAGCAAAAGAAACCTCAACAGAGAGGCTCCACCACTAAGAGGAGCAGGGCCGCGGAAGTCCACAACCTTTCCGAGCGAGTGAGAGTCCACCACTAACTGAGAAATTGAGCTCTGCGCCAATTGTACAGGATGGTCCAAGCCGTGAGCATATGACGGCAGTGGACAATCTAGGTCTCAAATCTTGTTTGGGTCGTCAATTTTGTGACTGATGTTAGTTTTGAAGCTCTTGGCTTCCGCAGCTTTACTGATAGAATTTCCTGCCCATTTCAGAGGCGAAGAGATCGTATCAACGAGAAGATGAAAGCTCTGCAAGAGCTGATCCCCAATTCCAACAAGGTTTGTTACAGCTTTCAGCCTTGTTCTTCGTACCTTGCCTCTTCTTTTGGATCACCGTGCGGTAACTTGCCCTTGAAATACAGTCAATGATGCAGACTTTTGATTCATATTGCAGACGGACAAAGCATCGATGCTGGATGAAGCGATCGAGTACTTGAAGATGCTCCAGTTGCAACTGCAGGTAACTATCCCAGCCTTTGACCTTCGCAGTAGTTCTCTGCTCCTCCTTGCGATGCAGGTGCTGTAGAGACGCCCGAGCACAAATACTGAATTCAATTTGCCCTCTTTAGCAGATGATGTCCATGAGAAGTGGAATGAGCATCCCCTCTATGGTGATGCCGGCGGGAATGCAACACCTTCAAATCCCGCAATTGCCCCAAATGGGCCCAATGCCTCCCATGGGAATGGGAATGGGCATGGGTATGGGCATGGGCCCGATGGGAATGGGAATGAGTATGATGGACATGGGAGGCGGAGCTCCCGGTCGACCGATGATACCCCTTCCGTCTCACAGTGGGCCTTCTCACTCTCACAACGTATCTGCAACCTCACCAGCTGTTTCTATGGTAGACACTCATGACCACCGCCTGCAAAACCCGAGCGTCATGGAGTCACTGAACGTCTTCATGGCGCAACACCGGCAAATGCAAATGGCTCCTCAGGTGATCCTTCTCTTTGAATGCCGGCTGGTTCTGTCCGATCTTCTGTCAGCTTTGTTTTTTGTGCAAATTTCCTAGGAGGAAGGAGCATGTGGTTGGGAGACGATGAAGTCTTGATTCTTACTCACTGTGCCTGTTCTTGCAGCCGATGAGTATGGATGCATTCAGTGCATTCATGATTCATCAGCACCAGCAGCAACACCAGCAGCAGCATCAACAACATCAGCTCCAACACCAACACCAGCATTCGCTCCATCATCTTCCGAGCAGCATGGGCGGTGGAGCCCCCCAATGAAGAGCGGGCCAAATTCTCGGTGGATCTTGATTTCCACGCTTGCTTTCCATTTGTCATGCCATTTCGCATTGGAGGCCAGCGATCTGTCAACAACTATCTGCTGTTCCGCTCTCGGAGAGCGTAATATACTCAGCTGCAGGCGTGGCTGTGAGTCTGACAGCCATCGTCGGGCATCAGGACACGATACAGCTGAAGGTGAAGGCGAAGGCCGATGGAGGTGTGGTCCGGTGCATCATTGGTTTCCACCTCTTAGTTTTGTAGTCTAGTTGGGGGATATGTAAACATCATGATCTCAGGTTGGAAAGTATGATTCTACTAGGACCGGATCTTGTGTAGGTGCCTTCAACCAGGCCGCAGCAGTGTTGAAGGCGTGTATTAGAACGCAGAATTGGATGATATGTATCAAGAAGGTCCTCGCTGCCCTCGCATTAGCGGCGTGCTGCGGTGCCATGCGGGGCCAGGGTCAGGGCCAGGGCGTTTCGCCTCTGTACTTTTATCAGCAAGCATAATTGCATCTTCTAACTAGCCTTAGCGAGGCGAGGTTTTGAGGATTAGTAGTTTTAGAAGAAGGAAGTGTCCGTAGTGCTGTCATTCCAGGGCCGGACCTTCTTCAATTGTTGCGGATCGGGATACTATGGCGCCGAAGTTTGCGCTCCGGCTTACGCTGTTCTCGTTGTGGATTTGGAGGGAACTCGTGTTGCCGGAAGCAGATTTCTAGTCGAAAGCCTGCCGCCCGAAATGTGCCATGTTTAATTGTCGATAAGGTTCAAGTTAAATGTTGGATTACATTCATTGTTCTCCGTTGGCTCAAGGCGAGCCACTTGTAAAAAGAAATGCCAAGTTTACCAACTTGAGACTCCTTGCACG

mRNA

>Mapoly0039s0059.4
ACGACACCCTCGCCCGGTTTCGGATGATGTTTCGTAGACGAAGAGAAATCGCGGGCCACGGCGGCCTGATGTTGTGGAACCGGGACCCAGGTTCATCCTGGCGATACAAACCGCCACGTGGAAGATTCTCGTAGGACGCAGCCGTCGAGTTTTCAGGTGAGAAATCGGAGTGGGCAGGAGGCAAATACCAACTTGTAGCTCGTCGAAGGCCGAAAGCGGCCCGGATAATTGCATCGCCTCTGCTGCTCTCTGTGCCGCACCAATGCGGCCCGGATCTTAAAATACGAAAAAAGAAAAAAGAAGGCGTCCTGGGGGAAGGTAGTGCCACCGGTGAATCTCAGGGATGAGCTCGAGAGCTGAATTCCCGAGCACCTGGAGAGAGCCATCAATTTATTGCGCTATGGGGGAGAAATCCTTGTGCCAGAGTAGGAGCTCGAACGAAGTCCGCTCTCGTTTATTAATCTCTTACAGGGTGAGGTTTAGGTGCACTGTCCTGCAGGTCTGGATGGATGGTAGGATGAGAGCGAGGTGGGGACTCTGGTGATGGAGAGCCCTCCGGAGTTAGGCAAAGGCAAGGGAAGGATAGGCAGGGGAGGACGGGTCGATGAAGCGCGCTGCCGGAGTAAGGTAACTCTCCGTGGAACGGGTGCAGGCCAGGACCTTAGGTACAGGAGTGAAGAGTAGCATGGCTAGGCTACGTCGTAGGCCCGAGGAGTAGAGCTGAGCTAAAAGCTACACTGTACGTACCTGTAAAGAGAAGAGAAGCGAGTCGACGGACGGAAAGAAGGAAGGAAGGAAGGAAAGTGGGGCGGGGCGATGAGGGAGGCGAGGAGTACAAGAATGTGGAGTAGTAAGGATATCATTTTGCTGGATGTTGCTGAAGACGATCAAGAGTCGAATTCGAGTGCGAGTCTTTGGTGCTAGAGCGGGAGGGTGGGCGATCCGAGTGCCAGATGTGGACGAGAGAAGCAGCGGAATCGATGGCTGCAGATTCGGGGCCAGTGGGCAGAGGCGGCTCGAGTCTTCCGACGGGAGGATTGAGGAGGGACACGAAGAGCTCTGAGTGATGTGATGCCATTCTGGTAGAGAAAAAGAAGGGATTCTGCTCTTGGGATCGCGCGAGGTCCCTGGGGCCAGCAAGCGCCCAGCTTGCCGAGCGGGCTCTCTGACGTCGAAGGGACTGGATTTCGAATCGGGAACGGACTGAACACCGGAAGAATCCTCTCCGGTTGTCACTACATCCCCATCAGAGACCATGAGTCACCTCGTTCCCGACTGGGATGGTAACGGTGGAGACTTAGAAGCTGTTTTACCCACAAGCGATTTCTCACTGCCGGTTAAGGGAAAGTGGGACTCATTGCCCCATAAAAGGTCGCACTTGTCTGGTTTGGCCTTCGTGCCAACCCACGATGCTGGCGAAACTGAGTGGGCAGAGGAAAGTCATATTGTAGCTATGCAGAACCAAAGCGGGAAGGGCAACAAGGCTATGTGGCAGCAGATGAATTTCCAGAATGGGTGGTCGAGTGTGCCAGAGTCTGAGGATGCCGTTACTCCTGTGAAGCCCATCAGCTCGTCGTCTCCGGGGAAGGAGCCGGTTCTTGTCAATGAGCCCGCGGTCGACACGCACCACTCCAGTGCCCTCAACATGCAGGAAGACGAGATGGTGTGCTGGCTGCAGTATCCGTTGGACGAACACCTCGAAAGAGACTACTGTTCCGAGTTCTTCGGCGAGCTGCCCAACTCCAACATATCGAACATGCAGCTGATGAAGGATTCATTCGCAGGGCAAAATCAAGTAGCGGGGCGCAACAACAGGAATCCAGGTCCCGTTAACGTAGGGAGTAACAGCAGAATGTCTAGTGCGGATGCGGCGATGGCCATGGGAGCGGGGCGAGCTGCCGGTTTGTTGCCTCAGACAGGGGTGGAGGTTTTCACCAAAGTTCGGACCACTTTGCAACCCTACGGAGGAAAGTGGTCCCCAAATCAGAACAACGCCGGGAAAACGCTGGGAGCGATGACCTCGACCCTGGCTCCGAGCCCGTCAAGATCCCCGCCGATGTCTGGGAACTTGTCGACCCCCATGCTCCCCCCGAAGTCTCAGGGACTCAGCTTCCAGCCTCCCAGAACCTCAGGCCCGATGAATTTCTCGCATTTCTCTCGCCCTGCGGCTGTGATGAAGGCCAATCTCCAGTGCCTAGGAATGTCTCACGTGGCCCCTCCGCACGGGAGCGGGACGAACGTCCGGCTCAAGAGCCAACCCTACAGCGGGAAGCCACCCGTCGACGCAAGCACGTCGACGGGGTCCTCCATTGCAGAGTCAACCACCACGAGGCAACGCAGCGGCGCTTTCCGCAAGGATACCGAATGCCAAGTCGAAGGTTCCGAAGCTCAACAGAGTCTTGGAACCGAATCGAGCTGGCCTTCGATGCAGAATTCGCTGTCGGGCAAGGACACCGACGCTGTCAATTCCTCCGTGGATGGTGTGGACTGCGATTCGAAGCCCGGTATAGCGGATGTGGACAATTGCAGGAATTCTAGCATCACAGGTAGTGGCGGTTTAGGAACTGAAAAGCATCAGTCTCAAGGAGCAGAAGTGCAGGAAGCTCCCGAACCCACCATTACCTCGTCTTCTGGTGGGTCCGGTAATAGTGCAGATAGAGGGAAAGAGGCCGCATCTAGTGGCAAGAGAAGAACCAGGGAAGGAGAGGAGTCCGAGTGCCAGAGCGAAGTGAGTAACTTGTTGCAACCCCAAGGGAGTCAAGTTGGTGCAGTAGCCCACAGGCAAGATGGCGAGGACGAGATGGCCCAGCAAAAGAAACCTCAACAGAGAGGCTCCACCACTAAGAGGAGCAGGGCCGCGGAAGTCCACAACCTTTCCGAGCGAAGGCGAAGAGATCGTATCAACGAGAAGATGAAAGCTCTGCAAGAGCTGATCCCCAATTCCAACAAGACGGACAAAGCATCGATGCTGGATGAAGCGATCGAGTACTTGAAGATGCTCCAGTTGCAACTGCAGATGATGTCCATGAGAAGTGGAATGAGCATCCCCTCTATGGTGATGCCGGCGGGAATGCAACACCTTCAAATCCCGCAATTGCCCCAAATGGGCCCAATGCCTCCCATGGGAATGGGAATGGGCATGGGTATGGGCATGGGCCCGATGGGAATGGGAATGAGTATGATGGACATGGGAGGCGGAGCTCCCGGTCGACCGATGATACCCCTTCCGTCTCACAGTGGGCCTTCTCACTCTCACAACGTATCTGCAACCTCACCAGCTGTTTCTATGGTAGACACTCATGACCACCGCCTGCAAAACCCGAGCGTCATGGAGTCACTGAACGTCTTCATGGCGCAACACCGGCAAATGCAAATGGCTCCTCAGCCGATGAGTATGGATGCATTCAGTGCATTCATGATTCATCAGCACCAGCAGCAACACCAGCAGCAGCATCAACAACATCAGCTCCAACACCAACACCAGCATTCGCTCCATCATCTTCCGAGCAGCATGGGCGGTGGAGCCCCCCAATGAAGAGCGGGCCAAATTCTCGGTGGATCTTGATTTCCACGCTTGCTTTCCATTTGTCATGCCATTTCGCATTGGAGGCCAGCGATCTGTCAACAACTATCTGCTGTTCCGCTCTCGGAGAGCGTAATATACTCAGCTGCAGGCGTGGCTGTGAGTCTGACAGCCATCGTCGGGCATCAGGACACGATACAGCTGAAGGTGAAGGCGAAGGCCGATGGAGGTGTGGTCCGGTGCATCATTGGTTTCCACCTCTTAGTTTTGTAGTCTAGTTGGGGGATATGTAAACATCATGATCTCAGGTTGGAAAGTATGATTCTACTAGGACCGGATCTTGTGTAGGTGCCTTCAACCAGGCCGCAGCAGTGTTGAAGGCGTGTATTAGAACGCAGAATTGGATGATATGTATCAAGAAGGTCCTCGCTGCCCTCGCATTAGCGGCGTGCTGCGGTGCCATGCGGGGCCAGGGTCAGGGCCAGGGCGTTTCGCCTCTGTACTTTTATCAGCAAGCATAATTGCATCTTCTAACTAGCCTTAGCGAGGCGAGGTTTTGAGGATTAGTAGTTTTAGAAGAAGGAAGTGTCCGTAGTGCTGTCATTCCAGGGCCGGACCTTCTTCAATTGTTGCGGATCGGGATACTATGGCGCCGAAGTTTGCGCTCCGGCTTACGCTGTTCTCGTTGTGGATTTGGAGGGAACTCGTGTTGCCGGAAGCAGATTTCTAGTCGAAAGCCTGCCGCCCGAAATGTGCCATGTTTAATTGTCGATAAGGTTCAAGTTAAATGTTGGATTACATTCATTGTTCTCCGTTGGCTCAAGGCGAGCCACTTGTAAAAAGAAATGCCAAGTTTACCAACTTGAGACTCCTTGCACG

CDS

>Mapoly0039s0059.4
ATGAGTCACCTCGTTCCCGACTGGGATGGTAACGGTGGAGACTTAGAAGCTGTTTTACCCACAAGCGATTTCTCACTGCCGGTTAAGGGAAAGTGGGACTCATTGCCCCATAAAAGGTCGCACTTGTCTGGTTTGGCCTTCGTGCCAACCCACGATGCTGGCGAAACTGAGTGGGCAGAGGAAAGTCATATTGTAGCTATGCAGAACCAAAGCGGGAAGGGCAACAAGGCTATGTGGCAGCAGATGAATTTCCAGAATGGGTGGTCGAGTGTGCCAGAGTCTGAGGATGCCGTTACTCCTGTGAAGCCCATCAGCTCGTCGTCTCCGGGGAAGGAGCCGGTTCTTGTCAATGAGCCCGCGGTCGACACGCACCACTCCAGTGCCCTCAACATGCAGGAAGACGAGATGGTGTGCTGGCTGCAGTATCCGTTGGACGAACACCTCGAAAGAGACTACTGTTCCGAGTTCTTCGGCGAGCTGCCCAACTCCAACATATCGAACATGCAGCTGATGAAGGATTCATTCGCAGGGCAAAATCAAGTAGCGGGGCGCAACAACAGGAATCCAGGTCCCGTTAACGTAGGGAGTAACAGCAGAATGTCTAGTGCGGATGCGGCGATGGCCATGGGAGCGGGGCGAGCTGCCGGTTTGTTGCCTCAGACAGGGGTGGAGGTTTTCACCAAAGTTCGGACCACTTTGCAACCCTACGGAGGAAAGTGGTCCCCAAATCAGAACAACGCCGGGAAAACGCTGGGAGCGATGACCTCGACCCTGGCTCCGAGCCCGTCAAGATCCCCGCCGATGTCTGGGAACTTGTCGACCCCCATGCTCCCCCCGAAGTCTCAGGGACTCAGCTTCCAGCCTCCCAGAACCTCAGGCCCGATGAATTTCTCGCATTTCTCTCGCCCTGCGGCTGTGATGAAGGCCAATCTCCAGTGCCTAGGAATGTCTCACGTGGCCCCTCCGCACGGGAGCGGGACGAACGTCCGGCTCAAGAGCCAACCCTACAGCGGGAAGCCACCCGTCGACGCAAGCACGTCGACGGGGTCCTCCATTGCAGAGTCAACCACCACGAGGCAACGCAGCGGCGCTTTCCGCAAGGATACCGAATGCCAAGTCGAAGGTTCCGAAGCTCAACAGAGTCTTGGAACCGAATCGAGCTGGCCTTCGATGCAGAATTCGCTGTCGGGCAAGGACACCGACGCTGTCAATTCCTCCGTGGATGGTGTGGACTGCGATTCGAAGCCCGGTATAGCGGATGTGGACAATTGCAGGAATTCTAGCATCACAGGTAGTGGCGGTTTAGGAACTGAAAAGCATCAGTCTCAAGGAGCAGAAGTGCAGGAAGCTCCCGAACCCACCATTACCTCGTCTTCTGGTGGGTCCGGTAATAGTGCAGATAGAGGGAAAGAGGCCGCATCTAGTGGCAAGAGAAGAACCAGGGAAGGAGAGGAGTCCGAGTGCCAGAGCGAAGTGAGTAACTTGTTGCAACCCCAAGGGAGTCAAGTTGGTGCAGTAGCCCACAGGCAAGATGGCGAGGACGAGATGGCCCAGCAAAAGAAACCTCAACAGAGAGGCTCCACCACTAAGAGGAGCAGGGCCGCGGAAGTCCACAACCTTTCCGAGCGAAGGCGAAGAGATCGTATCAACGAGAAGATGAAAGCTCTGCAAGAGCTGATCCCCAATTCCAACAAGACGGACAAAGCATCGATGCTGGATGAAGCGATCGAGTACTTGAAGATGCTCCAGTTGCAACTGCAGATGATGTCCATGAGAAGTGGAATGAGCATCCCCTCTATGGTGATGCCGGCGGGAATGCAACACCTTCAAATCCCGCAATTGCCCCAAATGGGCCCAATGCCTCCCATGGGAATGGGAATGGGCATGGGTATGGGCATGGGCCCGATGGGAATGGGAATGAGTATGATGGACATGGGAGGCGGAGCTCCCGGTCGACCGATGATACCCCTTCCGTCTCACAGTGGGCCTTCTCACTCTCACAACGTATCTGCAACCTCACCAGCTGTTTCTATGGTAGACACTCATGACCACCGCCTGCAAAACCCGAGCGTCATGGAGTCACTGAACGTCTTCATGGCGCAACACCGGCAAATGCAAATGGCTCCTCAGCCGATGAGTATGGATGCATTCAGTGCATTCATGATTCATCAGCACCAGCAGCAACACCAGCAGCAGCATCAACAACATCAGCTCCAACACCAACACCAGCATTCGCTCCATCATCTTCCGAGCAGCATGGGCGGTGGAGCCCCCCAATGA

Protein

>Mapoly0039s0059.4
MSHLVPDWDGNGGDLEAVLPTSDFSLPVKGKWDSLPHKRSHLSGLAFVPTHDAGETEWAEESHIVAMQNQSGKGNKAMWQQMNFQNGWSSVPESEDAVTPVKPISSSSPGKEPVLVNEPAVDTHHSSALNMQEDEMVCWLQYPLDEHLERDYCSEFFGELPNSNISNMQLMKDSFAGQNQVAGRNNRNPGPVNVGSNSRMSSADAAMAMGAGRAAGLLPQTGVEVFTKVRTTLQPYGGKWSPNQNNAGKTLGAMTSTLAPSPSRSPPMSGNLSTPMLPPKSQGLSFQPPRTSGPMNFSHFSRPAAVMKANLQCLGMSHVAPPHGSGTNVRLKSQPYSGKPPVDASTSTGSSIAESTTTRQRSGAFRKDTECQVEGSEAQQSLGTESSWPSMQNSLSGKDTDAVNSSVDGVDCDSKPGIADVDNCRNSSITGSGGLGTEKHQSQGAEVQEAPEPTITSSSGGSGNSADRGKEAASSGKRRTREGEESECQSEVSNLLQPQGSQVGAVAHRQDGEDEMAQQKKPQQRGSTTKRSRAAEVHNLSERRRRDRINEKMKALQELIPNSNKTDKASMLDEAIEYLKMLQLQLQMMSMRSGMSIPSMVMPAGMQHLQIPQLPQMGPMPPMGMGMGMGMGMGPMGMGMSMMDMGGGAPGRPMIPLPSHSGPSHSHNVSATSPAVSMVDTHDHRLQNPSVMESLNVFMAQHRQMQMAPQPMSMDAFSAFMIHQHQQQHQQQHQQHQLQHQHQHSLHHLPSSMGGGAPQ

Mapoly0039s0059.5  

Gene structure:

mRNA scaffold_39:781195..786893  ( - strand )
three_prime_UTR scaffold_39:781195..782061  ( - strand )
CDS scaffold_39:782062..782211  ( - strand )
CDS scaffold_39:782354..782722  ( - strand )
CDS scaffold_39:782835..782900  ( - strand )
CDS scaffold_39:783016..783081  ( - strand )
CDS scaffold_39:783274..783375  ( - strand )
CDS scaffold_39:783497..784825  ( - strand )
five_prime_UTR scaffold_39:784826..784880  ( - strand )
five_prime_UTR scaffold_39:785613..785687  ( - strand )
five_prime_UTR scaffold_39:786481..786893  ( - strand )

Sequences:

Gene

>Mapoly0039s0059.5
GCGAGTCGACGGACGGAAAGAAGGAAGGAAGGAAGGAAAGTGGGGCGGGGCGATGAGGGAGGCGAGGAGTACAAGAATGTGGAGTAGTAAGGATATCATTTTGCTGGATGTTGCTGAAGACGATCAAGAGTCGAATTCGAGTGCGAGTCTTTGGTGCTAGAGCGGGAGGGTGGGCGATCCGAGTGCCAGATGTGGACGAGAGAAGCAGCGGAATCGATGGCTGCAGATTCGGGGCCAGTGGGCAGAGGCGGCTCGAGTCTTCCGACGGGAGGATTGAGGAGGGACACGAAGAGCTCTGAGTGATGTGATGCCATTCTGGTAGAGAAAAAGAAGGGATTCTGCTCTTGGGATCGCGCGAGGTCCCTGGGGCCAGCAAGCGCCCAGCTTGCCGAGCGGGCTCTCTGACGTCGAAGGTGCTGCCGCCTCTGTGTGTTTATCCCTGTGTCTCTGTGTTCTAGGCGGTTGTTGGCGGAGGGACGAGGGAGAGGAGTGGCGTTATGTCTGTCTGCTTGACAAGTTGGTACTCCTTGTGGGTCATAAGTTGGGATTTCCTTCCGCCCGTGGCACTGTTTCTGTCGGCGTGAGAAGAGCAAGTTTTCCAGCTCAAGGTTCAGTCCTATCGTTTTTATCTTCGCCTTCCCTCTCCCGCGTGTCTCCATGCATTTGATGACCTTGTCTGTCGGCGACGCTAGCCTCGAGCATCCATGTCAGGCCCACGCCGCTCTAGTGTGTATGTTTGAGTAGACAGCTCTTGTTCTCCCACATAATGAAATGTCCGCGATCACTGAGCCTTGGTAATTTTGATCTCCTTTCTCGCTCACTCTGCCGCAGGAGAGTGTGCAGCTACTTCGTTAAGTGTGCTTGTCCGCACGGTTGACATAACCTCTATGAGATCTTTAGATTCTGAGCGAGATCCTTCTCTTGTGACAGAGCCGTGAGAAAGAGCCGGGGTGGCCTGTTGTATTTCCCGAGGAGATGAATGTACAAACTGCATAAAAACTGCATCTCCTTGATGCTCCGGAATGATGAGGACATGTAAGGAAGCGTTGAGTACACCGACCCAGAAGAATCGTAAATGCATCTGCACTCTGTGTTGTAGAGTTGGGCCCATTTAGTCGACGGCGATAAGTAGCAGATTGACCCGCTTAGCGGCAAGAACCCGTTGTGCCTCTGTTTAAACTGACTGGGTTCGAATTGCTCCTACAGGGACTGGATTTCGAATCGGGAACGGACTGAACACCGGAAGAATCCTCTCCGGTTGTCACTACATCCCCATCAGAGGTGAGTTCAGTGTGGGAAGCCTGTCGAGAGATCGGCGAGCTGGTGATTCTTACTTGCTTTCTGTCTGTGTTTGGAGCGTCTACCTTTCTCGTAATCTACCCATACCTTTCCCGTCACTGAGAAATGAAGAGGCTTTAAAAGTAGGTGAACTTCGAGACTTGGGTGCCATGAGAGTAGATTAGAAGTAGGACGAGCAGGAGACGACTGCAAACTGTCGAAGTCTTCACCTCTCATCTTCTCATTCCCACTGCCATGCCTTACTCACGACCATCCACTACCTCTATGTATGTGGGAGCGCTTCTGGCGAAGCGCTGGGCATTGACAGTGACAGGCCGAGAAGTCGATGCCGTAGCAGTCTAGGTAGGCATTTGATTTACCTCCTCCTGTTTGACTCGCAGACCATGAGTCACCTCGTTCCCGACTGGGATGGTAACGGTGGAGACTTAGAAGCTGTTTTACCCACAAGCGATTTCTCACTGCCGGTTAAGGGAAAGTGGGACTCATTGCCCCATAAAAGGTCGCACTTGTCTGGTTTGGCCTTCGTGTAAGCGCTTGCTCCGGCTTTTCAATCCCCATAGTTTTTTGTGTTCTTGATACCATTGTATGTAAGGTCAATTTCTTGATTGTGGATCTTTGAGAATGCCACTTCGTGATGCCGGCTCGTTGACATGCTGCTCTTCGTCACATGAGCTTCGAAGAGATGTTAAAGGTCGCGTTCTTCTTCTTCTACAGGCCAACCCACGATGCTGGCGAAACTGAGTGGGCAGAGGAAAGTCATATTGTAGCTATGCAGAACCAAAGCGGGAAGGGCAACAAGGCTATGTGGCAGCAGATGAATTTCCAGAATGGGTGGTCGAGTGTGCCAGAGTCTGAGGATGCCGTTACTCCTGTGAAGCCCATCAGCTCGTCGTCTCCGGGGAAGGAGCCGGTTCTTGTCAATGAGCCCGCGGTCGACACGCACCACTCCAGTGCCCTCAACATGCAGGAAGACGAGATGGTGTGCTGGCTGCAGTATCCGTTGGACGAACACCTCGAAAGAGACTACTGTTCCGAGTTCTTCGGCGAGCTGCCCAACTCCAACATATCGAACATGCAGCTGATGAAGGATTCATTCGCAGGGCAAAATCAAGTAGCGGGGCGCAACAACAGGAATCCAGGTCCCGTTAACGTAGGGAGTAACAGCAGAATGTCTAGTGCGGATGCGGCGATGGCCATGGGAGCGGGGCGAGCTGCCGGTTTGTTGCCTCAGACAGGGGTGGAGGTTTTCACCAAAGTTCGGACCACTTTGCAACCCTACGGAGGAAAGTGGTCCCCAAATCAGAACAACGCCGGGAAAACGCTGGGAGCGATGACCTCGACCCTGGCTCCGAGCCCGTCAAGATCCCCGCCGATGTCTGGGAACTTGTCGACCCCCATGCTCCCCCCGAAGTCTCAGGGACTCAGCTTCCAGCCTCCCAGAACCTCAGGCCCGATGAATTTCTCGCATTTCTCTCGCCCTGCGGCTGTGATGAAGGCCAATCTCCAGTGCCTAGGAATGTCTCACGTGGCCCCTCCGCACGGGAGCGGGACGAACGTCCGGCTCAAGAGCCAACCCTACAGCGGGAAGCCACCCGTCGACGCAAGCACGTCGACGGGGTCCTCCATTGCAGAGTCAACCACCACGAGGCAACGCAGCGGCGCTTTCCGCAAGGATACCGAATGCCAAGTCGAAGGTTCCGAAGCTCAACAGAGTCTTGGAACCGAATCGAGCTGGCCTTCGATGCAGAATTCGCTGTCGGGCAAGGACACCGACGCTGTCAATTCCTCCGTGGATGGTGTGGACTGCGATTCGAAGCCCGGTATAGCGGATGTGGACAATTGCAGGAATTCTAGCATCACAGGTAGTGGCGGTTTAGGAACTGAAAAGCATCAGTCTCAAGGAGCAGAAGTGCAGGAAGCTCCCGAACCCACCATTACCTCGTCTTCTGGTGGGTCCGGTAATAGTGCAGATAGAGGGAAAGAGGCCGCATCTAGTGGCAAGAGAAGAACCAGGGAAGGAGAGGAGTCCGAGTGCCAGAGCGAAGTGAGTAACTTGTTGCAACCCCAAGGGAGTCAAGTTGGTGCAGTAGCCCACAGGGTATGTTTTATCTAGTGATGCTAACTTTTTCCTGAATAACATCCCACTGACTGCTCTTTTTATGCGAGGATGTGTGAGAAGTGTACTTGCGTTTAATAAAAGCCAATGTTGTTTCTGGCAGCAAGATGGCGAGGACGAGATGGCCCAGCAAAAGAAACCTCAACAGAGAGGCTCCACCACTAAGAGGAGCAGGGCCGCGGAAGTCCACAACCTTTCCGAGCGAGTGAGAGTCCACCACTAACTGAGAAATTGAGCTCTGCGCCAATTGTACAGGATGGTCCAAGCCGTGAGCATATGACGGCAGTGGACAATCTAGGTCTCAAATCTTGTTTGGGTCGTCAATTTTGTGACTGATGTTAGTTTTGAAGCTCTTGGCTTCCGCAGCTTTACTGATAGAATTTCCTGCCCATTTCAGAGGCGAAGAGATCGTATCAACGAGAAGATGAAAGCTCTGCAAGAGCTGATCCCCAATTCCAACAAGGTTTGTTACAGCTTTCAGCCTTGTTCTTCGTACCTTGCCTCTTCTTTTGGATCACCGTGCGGTAACTTGCCCTTGAAATACAGTCAATGATGCAGACTTTTGATTCATATTGCAGACGGACAAAGCATCGATGCTGGATGAAGCGATCGAGTACTTGAAGATGCTCCAGTTGCAACTGCAGGTAACTATCCCAGCCTTTGACCTTCGCAGTAGTTCTCTGCTCCTCCTTGCGATGCAGGTGCTGTAGAGACGCCCGAGCACAAATACTGAATTCAATTTGCCCTCTTTAGCAGATGATGTCCATGAGAAGTGGAATGAGCATCCCCTCTATGGTGATGCCGGCGGGAATGCAACACCTTCAAATCCCGCAATTGCCCCAAATGGGCCCAATGCCTCCCATGGGAATGGGAATGGGCATGGGTATGGGCATGGGCCCGATGGGAATGGGAATGAGTATGATGGACATGGGAGGCGGAGCTCCCGGTCGACCGATGATACCCCTTCCGTCTCACAGTGGGCCTTCTCACTCTCACAACGTATCTGCAACCTCACCAGCTGTTTCTATGGTAGACACTCATGACCACCGCCTGCAAAACCCGAGCGTCATGGAGTCACTGAACGTCTTCATGGCGCAACACCGGCAAATGCAAATGGCTCCTCAGGTGATCCTTCTCTTTGAATGCCGGCTGGTTCTGTCCGATCTTCTGTCAGCTTTGTTTTTTGTGCAAATTTCCTAGGAGGAAGGAGCATGTGGTTGGGAGACGATGAAGTCTTGATTCTTACTCACTGTGCCTGTTCTTGCAGCCGATGAGTATGGATGCATTCAGTGCATTCATGATTCATCAGCACCAGCAGCAACACCAGCAGCAGCATCAACAACATCAGCTCCAACACCAACACCAGCATTCGCTCCATCATCTTCCGAGCAGCATGGGCGGTGGAGCCCCCCAATGAAGAGCGGGCCAAATTCTCGGTGGATCTTGATTTCCACGCTTGCTTTCCATTTGTCATGCCATTTCGCATTGGAGGCCAGCGATCTGTCAACAACTATCTGCTGTTCCGCTCTCGGAGAGCGTAATATACTCAGCTGCAGGCGTGGCTGTGAGTCTGACAGCCATCGTCGGGCATCAGGACACGATACAGCTGAAGGTGAAGGCGAAGGCCGATGGAGGTGTGGTCCGGTGCATCATTGGTTTCCACCTCTTAGTTTTGTAGTCTAGTTGGGGGATATGTAAACATCATGATCTCAGGTTGGAAAGTATGATTCTACTAGGACCGGATCTTGTGTAGGTGCCTTCAACCAGGCCGCAGCAGTGTTGAAGGCGTGTATTAGAACGCAGAATTGGATGATATGTATCAAGAAGGTCCTCGCTGCCCTCGCATTAGCGGCGTGCTGCGGTGCCATGCGGGGCCAGGGTCAGGGCCAGGGCGTTTCGCCTCTGTACTTTTATCAGCAAGCATAATTGCATCTTCTAACTAGCCTTAGCGAGGCGAGGTTTTGAGGATTAGTAGTTTTAGAAGAAGGAAGTGTCCGTAGTGCTGTCATTCCAGGGCCGGACCTTCTTCAATTGTTGCGGATCGGGATACTATGGCGCCGAAGTTTGCGCTCCGGCTTACGCTGTTCTCGTTGTGGATTTGGAGGGAACTCGTGTTGCCGGAAGCAGATTTCTAGTCGAAAGCCTGCCGCCCGAAATGTGCCATGTTTAATTGTCGATAAGGTTCAAGTTAAATGTTGGATTACATTCATTGTTCTCCGTTGGCTCAAGGCGAGCCACTTGTAAAAAGAAATGCCAAGTTTACCAACTTGAGACTCCTTGCACG

mRNA

>Mapoly0039s0059.5
GCGAGTCGACGGACGGAAAGAAGGAAGGAAGGAAGGAAAGTGGGGCGGGGCGATGAGGGAGGCGAGGAGTACAAGAATGTGGAGTAGTAAGGATATCATTTTGCTGGATGTTGCTGAAGACGATCAAGAGTCGAATTCGAGTGCGAGTCTTTGGTGCTAGAGCGGGAGGGTGGGCGATCCGAGTGCCAGATGTGGACGAGAGAAGCAGCGGAATCGATGGCTGCAGATTCGGGGCCAGTGGGCAGAGGCGGCTCGAGTCTTCCGACGGGAGGATTGAGGAGGGACACGAAGAGCTCTGAGTGATGTGATGCCATTCTGGTAGAGAAAAAGAAGGGATTCTGCTCTTGGGATCGCGCGAGGTCCCTGGGGCCAGCAAGCGCCCAGCTTGCCGAGCGGGCTCTCTGACGTCGAAGGGACTGGATTTCGAATCGGGAACGGACTGAACACCGGAAGAATCCTCTCCGGTTGTCACTACATCCCCATCAGAGGCCAACCCACGATGCTGGCGAAACTGAGTGGGCAGAGGAAAGTCATATTGTAGCTATGCAGAACCAAAGCGGGAAGGGCAACAAGGCTATGTGGCAGCAGATGAATTTCCAGAATGGGTGGTCGAGTGTGCCAGAGTCTGAGGATGCCGTTACTCCTGTGAAGCCCATCAGCTCGTCGTCTCCGGGGAAGGAGCCGGTTCTTGTCAATGAGCCCGCGGTCGACACGCACCACTCCAGTGCCCTCAACATGCAGGAAGACGAGATGGTGTGCTGGCTGCAGTATCCGTTGGACGAACACCTCGAAAGAGACTACTGTTCCGAGTTCTTCGGCGAGCTGCCCAACTCCAACATATCGAACATGCAGCTGATGAAGGATTCATTCGCAGGGCAAAATCAAGTAGCGGGGCGCAACAACAGGAATCCAGGTCCCGTTAACGTAGGGAGTAACAGCAGAATGTCTAGTGCGGATGCGGCGATGGCCATGGGAGCGGGGCGAGCTGCCGGTTTGTTGCCTCAGACAGGGGTGGAGGTTTTCACCAAAGTTCGGACCACTTTGCAACCCTACGGAGGAAAGTGGTCCCCAAATCAGAACAACGCCGGGAAAACGCTGGGAGCGATGACCTCGACCCTGGCTCCGAGCCCGTCAAGATCCCCGCCGATGTCTGGGAACTTGTCGACCCCCATGCTCCCCCCGAAGTCTCAGGGACTCAGCTTCCAGCCTCCCAGAACCTCAGGCCCGATGAATTTCTCGCATTTCTCTCGCCCTGCGGCTGTGATGAAGGCCAATCTCCAGTGCCTAGGAATGTCTCACGTGGCCCCTCCGCACGGGAGCGGGACGAACGTCCGGCTCAAGAGCCAACCCTACAGCGGGAAGCCACCCGTCGACGCAAGCACGTCGACGGGGTCCTCCATTGCAGAGTCAACCACCACGAGGCAACGCAGCGGCGCTTTCCGCAAGGATACCGAATGCCAAGTCGAAGGTTCCGAAGCTCAACAGAGTCTTGGAACCGAATCGAGCTGGCCTTCGATGCAGAATTCGCTGTCGGGCAAGGACACCGACGCTGTCAATTCCTCCGTGGATGGTGTGGACTGCGATTCGAAGCCCGGTATAGCGGATGTGGACAATTGCAGGAATTCTAGCATCACAGGTAGTGGCGGTTTAGGAACTGAAAAGCATCAGTCTCAAGGAGCAGAAGTGCAGGAAGCTCCCGAACCCACCATTACCTCGTCTTCTGGTGGGTCCGGTAATAGTGCAGATAGAGGGAAAGAGGCCGCATCTAGTGGCAAGAGAAGAACCAGGGAAGGAGAGGAGTCCGAGTGCCAGAGCGAAGTGAGTAACTTGTTGCAACCCCAAGGGAGTCAAGTTGGTGCAGTAGCCCACAGGCAAGATGGCGAGGACGAGATGGCCCAGCAAAAGAAACCTCAACAGAGAGGCTCCACCACTAAGAGGAGCAGGGCCGCGGAAGTCCACAACCTTTCCGAGCGAAGGCGAAGAGATCGTATCAACGAGAAGATGAAAGCTCTGCAAGAGCTGATCCCCAATTCCAACAAGACGGACAAAGCATCGATGCTGGATGAAGCGATCGAGTACTTGAAGATGCTCCAGTTGCAACTGCAGATGATGTCCATGAGAAGTGGAATGAGCATCCCCTCTATGGTGATGCCGGCGGGAATGCAACACCTTCAAATCCCGCAATTGCCCCAAATGGGCCCAATGCCTCCCATGGGAATGGGAATGGGCATGGGTATGGGCATGGGCCCGATGGGAATGGGAATGAGTATGATGGACATGGGAGGCGGAGCTCCCGGTCGACCGATGATACCCCTTCCGTCTCACAGTGGGCCTTCTCACTCTCACAACGTATCTGCAACCTCACCAGCTGTTTCTATGGTAGACACTCATGACCACCGCCTGCAAAACCCGAGCGTCATGGAGTCACTGAACGTCTTCATGGCGCAACACCGGCAAATGCAAATGGCTCCTCAGCCGATGAGTATGGATGCATTCAGTGCATTCATGATTCATCAGCACCAGCAGCAACACCAGCAGCAGCATCAACAACATCAGCTCCAACACCAACACCAGCATTCGCTCCATCATCTTCCGAGCAGCATGGGCGGTGGAGCCCCCCAATGAAGAGCGGGCCAAATTCTCGGTGGATCTTGATTTCCACGCTTGCTTTCCATTTGTCATGCCATTTCGCATTGGAGGCCAGCGATCTGTCAACAACTATCTGCTGTTCCGCTCTCGGAGAGCGTAATATACTCAGCTGCAGGCGTGGCTGTGAGTCTGACAGCCATCGTCGGGCATCAGGACACGATACAGCTGAAGGTGAAGGCGAAGGCCGATGGAGGTGTGGTCCGGTGCATCATTGGTTTCCACCTCTTAGTTTTGTAGTCTAGTTGGGGGATATGTAAACATCATGATCTCAGGTTGGAAAGTATGATTCTACTAGGACCGGATCTTGTGTAGGTGCCTTCAACCAGGCCGCAGCAGTGTTGAAGGCGTGTATTAGAACGCAGAATTGGATGATATGTATCAAGAAGGTCCTCGCTGCCCTCGCATTAGCGGCGTGCTGCGGTGCCATGCGGGGCCAGGGTCAGGGCCAGGGCGTTTCGCCTCTGTACTTTTATCAGCAAGCATAATTGCATCTTCTAACTAGCCTTAGCGAGGCGAGGTTTTGAGGATTAGTAGTTTTAGAAGAAGGAAGTGTCCGTAGTGCTGTCATTCCAGGGCCGGACCTTCTTCAATTGTTGCGGATCGGGATACTATGGCGCCGAAGTTTGCGCTCCGGCTTACGCTGTTCTCGTTGTGGATTTGGAGGGAACTCGTGTTGCCGGAAGCAGATTTCTAGTCGAAAGCCTGCCGCCCGAAATGTGCCATGTTTAATTGTCGATAAGGTTCAAGTTAAATGTTGGATTACATTCATTGTTCTCCGTTGGCTCAAGGCGAGCCACTTGTAAAAAGAAATGCCAAGTTTACCAACTTGAGACTCCTTGCACG

CDS

>Mapoly0039s0059.5
ATGCAGAACCAAAGCGGGAAGGGCAACAAGGCTATGTGGCAGCAGATGAATTTCCAGAATGGGTGGTCGAGTGTGCCAGAGTCTGAGGATGCCGTTACTCCTGTGAAGCCCATCAGCTCGTCGTCTCCGGGGAAGGAGCCGGTTCTTGTCAATGAGCCCGCGGTCGACACGCACCACTCCAGTGCCCTCAACATGCAGGAAGACGAGATGGTGTGCTGGCTGCAGTATCCGTTGGACGAACACCTCGAAAGAGACTACTGTTCCGAGTTCTTCGGCGAGCTGCCCAACTCCAACATATCGAACATGCAGCTGATGAAGGATTCATTCGCAGGGCAAAATCAAGTAGCGGGGCGCAACAACAGGAATCCAGGTCCCGTTAACGTAGGGAGTAACAGCAGAATGTCTAGTGCGGATGCGGCGATGGCCATGGGAGCGGGGCGAGCTGCCGGTTTGTTGCCTCAGACAGGGGTGGAGGTTTTCACCAAAGTTCGGACCACTTTGCAACCCTACGGAGGAAAGTGGTCCCCAAATCAGAACAACGCCGGGAAAACGCTGGGAGCGATGACCTCGACCCTGGCTCCGAGCCCGTCAAGATCCCCGCCGATGTCTGGGAACTTGTCGACCCCCATGCTCCCCCCGAAGTCTCAGGGACTCAGCTTCCAGCCTCCCAGAACCTCAGGCCCGATGAATTTCTCGCATTTCTCTCGCCCTGCGGCTGTGATGAAGGCCAATCTCCAGTGCCTAGGAATGTCTCACGTGGCCCCTCCGCACGGGAGCGGGACGAACGTCCGGCTCAAGAGCCAACCCTACAGCGGGAAGCCACCCGTCGACGCAAGCACGTCGACGGGGTCCTCCATTGCAGAGTCAACCACCACGAGGCAACGCAGCGGCGCTTTCCGCAAGGATACCGAATGCCAAGTCGAAGGTTCCGAAGCTCAACAGAGTCTTGGAACCGAATCGAGCTGGCCTTCGATGCAGAATTCGCTGTCGGGCAAGGACACCGACGCTGTCAATTCCTCCGTGGATGGTGTGGACTGCGATTCGAAGCCCGGTATAGCGGATGTGGACAATTGCAGGAATTCTAGCATCACAGGTAGTGGCGGTTTAGGAACTGAAAAGCATCAGTCTCAAGGAGCAGAAGTGCAGGAAGCTCCCGAACCCACCATTACCTCGTCTTCTGGTGGGTCCGGTAATAGTGCAGATAGAGGGAAAGAGGCCGCATCTAGTGGCAAGAGAAGAACCAGGGAAGGAGAGGAGTCCGAGTGCCAGAGCGAAGTGAGTAACTTGTTGCAACCCCAAGGGAGTCAAGTTGGTGCAGTAGCCCACAGGCAAGATGGCGAGGACGAGATGGCCCAGCAAAAGAAACCTCAACAGAGAGGCTCCACCACTAAGAGGAGCAGGGCCGCGGAAGTCCACAACCTTTCCGAGCGAAGGCGAAGAGATCGTATCAACGAGAAGATGAAAGCTCTGCAAGAGCTGATCCCCAATTCCAACAAGACGGACAAAGCATCGATGCTGGATGAAGCGATCGAGTACTTGAAGATGCTCCAGTTGCAACTGCAGATGATGTCCATGAGAAGTGGAATGAGCATCCCCTCTATGGTGATGCCGGCGGGAATGCAACACCTTCAAATCCCGCAATTGCCCCAAATGGGCCCAATGCCTCCCATGGGAATGGGAATGGGCATGGGTATGGGCATGGGCCCGATGGGAATGGGAATGAGTATGATGGACATGGGAGGCGGAGCTCCCGGTCGACCGATGATACCCCTTCCGTCTCACAGTGGGCCTTCTCACTCTCACAACGTATCTGCAACCTCACCAGCTGTTTCTATGGTAGACACTCATGACCACCGCCTGCAAAACCCGAGCGTCATGGAGTCACTGAACGTCTTCATGGCGCAACACCGGCAAATGCAAATGGCTCCTCAGCCGATGAGTATGGATGCATTCAGTGCATTCATGATTCATCAGCACCAGCAGCAACACCAGCAGCAGCATCAACAACATCAGCTCCAACACCAACACCAGCATTCGCTCCATCATCTTCCGAGCAGCATGGGCGGTGGAGCCCCCCAATGA

Protein

>Mapoly0039s0059.5
MQNQSGKGNKAMWQQMNFQNGWSSVPESEDAVTPVKPISSSSPGKEPVLVNEPAVDTHHSSALNMQEDEMVCWLQYPLDEHLERDYCSEFFGELPNSNISNMQLMKDSFAGQNQVAGRNNRNPGPVNVGSNSRMSSADAAMAMGAGRAAGLLPQTGVEVFTKVRTTLQPYGGKWSPNQNNAGKTLGAMTSTLAPSPSRSPPMSGNLSTPMLPPKSQGLSFQPPRTSGPMNFSHFSRPAAVMKANLQCLGMSHVAPPHGSGTNVRLKSQPYSGKPPVDASTSTGSSIAESTTTRQRSGAFRKDTECQVEGSEAQQSLGTESSWPSMQNSLSGKDTDAVNSSVDGVDCDSKPGIADVDNCRNSSITGSGGLGTEKHQSQGAEVQEAPEPTITSSSGGSGNSADRGKEAASSGKRRTREGEESECQSEVSNLLQPQGSQVGAVAHRQDGEDEMAQQKKPQQRGSTTKRSRAAEVHNLSERRRRDRINEKMKALQELIPNSNKTDKASMLDEAIEYLKMLQLQLQMMSMRSGMSIPSMVMPAGMQHLQIPQLPQMGPMPPMGMGMGMGMGMGPMGMGMSMMDMGGGAPGRPMIPLPSHSGPSHSHNVSATSPAVSMVDTHDHRLQNPSVMESLNVFMAQHRQMQMAPQPMSMDAFSAFMIHQHQQQHQQQHQQHQLQHQHQHSLHHLPSSMGGGAPQ

Mapoly0039s0059.6  

Gene structure:

mRNA scaffold_39:781195..786893  ( - strand )
three_prime_UTR scaffold_39:781195..782061  ( - strand )
CDS scaffold_39:782062..782211  ( - strand )
CDS scaffold_39:782354..782722  ( - strand )
CDS scaffold_39:782835..782900  ( - strand )
CDS scaffold_39:783016..783081  ( - strand )
CDS scaffold_39:783274..783375  ( - strand )
CDS scaffold_39:783497..784825  ( - strand )
five_prime_UTR scaffold_39:784826..784880  ( - strand )
five_prime_UTR scaffold_39:785613..785687  ( - strand )
five_prime_UTR scaffold_39:786286..786893  ( - strand )

Sequences:

Gene

>Mapoly0039s0059.6
GCGAGTCGACGGACGGAAAGAAGGAAGGAAGGAAGGAAAGTGGGGCGGGGCGATGAGGGAGGCGAGGAGTACAAGAATGTGGAGTAGTAAGGATATCATTTTGCTGGATGTTGCTGAAGACGATCAAGAGTCGAATTCGAGTGCGAGTCTTTGGTGCTAGAGCGGGAGGGTGGGCGATCCGAGTGCCAGATGTGGACGAGAGAAGCAGCGGAATCGATGGCTGCAGATTCGGGGCCAGTGGGCAGAGGCGGCTCGAGTCTTCCGACGGGAGGATTGAGGAGGGACACGAAGAGCTCTGAGTGATGTGATGCCATTCTGGTAGAGAAAAAGAAGGGATTCTGCTCTTGGGATCGCGCGAGGTCCCTGGGGCCAGCAAGCGCCCAGCTTGCCGAGCGGGCTCTCTGACGTCGAAGGTGCTGCCGCCTCTGTGTGTTTATCCCTGTGTCTCTGTGTTCTAGGCGGTTGTTGGCGGAGGGACGAGGGAGAGGAGTGGCGTTATGTCTGTCTGCTTGACAAGTTGGTACTCCTTGTGGGTCATAAGTTGGGATTTCCTTCCGCCCGTGGCACTGTTTCTGTCGGCGTGAGAAGAGCAAGTTTTCCAGCTCAAGGTTCAGTCCTATCGTTTTTATCTTCGCCTTCCCTCTCCCGCGTGTCTCCATGCATTTGATGACCTTGTCTGTCGGCGACGCTAGCCTCGAGCATCCATGTCAGGCCCACGCCGCTCTAGTGTGTATGTTTGAGTAGACAGCTCTTGTTCTCCCACATAATGAAATGTCCGCGATCACTGAGCCTTGGTAATTTTGATCTCCTTTCTCGCTCACTCTGCCGCAGGAGAGTGTGCAGCTACTTCGTTAAGTGTGCTTGTCCGCACGGTTGACATAACCTCTATGAGATCTTTAGATTCTGAGCGAGATCCTTCTCTTGTGACAGAGCCGTGAGAAAGAGCCGGGGTGGCCTGTTGTATTTCCCGAGGAGATGAATGTACAAACTGCATAAAAACTGCATCTCCTTGATGCTCCGGAATGATGAGGACATGTAAGGAAGCGTTGAGTACACCGACCCAGAAGAATCGTAAATGCATCTGCACTCTGTGTTGTAGAGTTGGGCCCATTTAGTCGACGGCGATAAGTAGCAGATTGACCCGCTTAGCGGCAAGAACCCGTTGTGCCTCTGTTTAAACTGACTGGGTTCGAATTGCTCCTACAGGGACTGGATTTCGAATCGGGAACGGACTGAACACCGGAAGAATCCTCTCCGGTTGTCACTACATCCCCATCAGAGGTGAGTTCAGTGTGGGAAGCCTGTCGAGAGATCGGCGAGCTGGTGATTCTTACTTGCTTTCTGTCTGTGTTTGGAGCGTCTACCTTTCTCGTAATCTACCCATACCTTTCCCGTCACTGAGAAATGAAGAGGCTTTAAAAGTAGGTGAACTTCGAGACTTGGGTGCCATGAGAGTAGATTAGAAGTAGGACGAGCAGGAGACGACTGCAAACTGTCGAAGTCTTCACCTCTCATCTTCTCATTCCCACTGCCATGCCTTACTCACGACCATCCACTACCTCTATGTATGTGGGAGCGCTTCTGGCGAAGCGCTGGGCATTGACAGTGACAGGCCGAGAAGTCGATGCCGTAGCAGTCTAGGTAGGCATTTGATTTACCTCCTCCTGTTTGACTCGCAGACCATGAGTCACCTCGTTCCCGACTGGGATGGTAACGGTGGAGACTTAGAAGCTGTTTTACCCACAAGCGATTTCTCACTGCCGGTTAAGGGAAAGTGGGACTCATTGCCCCATAAAAGGTCGCACTTGTCTGGTTTGGCCTTCGTGTAAGCGCTTGCTCCGGCTTTTCAATCCCCATAGTTTTTTGTGTTCTTGATACCATTGTATGTAAGGTCAATTTCTTGATTGTGGATCTTTGAGAATGCCACTTCGTGATGCCGGCTCGTTGACATGCTGCTCTTCGTCACATGAGCTTCGAAGAGATGTTAAAGGTCGCGTTCTTCTTCTTCTACAGGCCAACCCACGATGCTGGCGAAACTGAGTGGGCAGAGGAAAGTCATATTGTAGCTATGCAGAACCAAAGCGGGAAGGGCAACAAGGCTATGTGGCAGCAGATGAATTTCCAGAATGGGTGGTCGAGTGTGCCAGAGTCTGAGGATGCCGTTACTCCTGTGAAGCCCATCAGCTCGTCGTCTCCGGGGAAGGAGCCGGTTCTTGTCAATGAGCCCGCGGTCGACACGCACCACTCCAGTGCCCTCAACATGCAGGAAGACGAGATGGTGTGCTGGCTGCAGTATCCGTTGGACGAACACCTCGAAAGAGACTACTGTTCCGAGTTCTTCGGCGAGCTGCCCAACTCCAACATATCGAACATGCAGCTGATGAAGGATTCATTCGCAGGGCAAAATCAAGTAGCGGGGCGCAACAACAGGAATCCAGGTCCCGTTAACGTAGGGAGTAACAGCAGAATGTCTAGTGCGGATGCGGCGATGGCCATGGGAGCGGGGCGAGCTGCCGGTTTGTTGCCTCAGACAGGGGTGGAGGTTTTCACCAAAGTTCGGACCACTTTGCAACCCTACGGAGGAAAGTGGTCCCCAAATCAGAACAACGCCGGGAAAACGCTGGGAGCGATGACCTCGACCCTGGCTCCGAGCCCGTCAAGATCCCCGCCGATGTCTGGGAACTTGTCGACCCCCATGCTCCCCCCGAAGTCTCAGGGACTCAGCTTCCAGCCTCCCAGAACCTCAGGCCCGATGAATTTCTCGCATTTCTCTCGCCCTGCGGCTGTGATGAAGGCCAATCTCCAGTGCCTAGGAATGTCTCACGTGGCCCCTCCGCACGGGAGCGGGACGAACGTCCGGCTCAAGAGCCAACCCTACAGCGGGAAGCCACCCGTCGACGCAAGCACGTCGACGGGGTCCTCCATTGCAGAGTCAACCACCACGAGGCAACGCAGCGGCGCTTTCCGCAAGGATACCGAATGCCAAGTCGAAGGTTCCGAAGCTCAACAGAGTCTTGGAACCGAATCGAGCTGGCCTTCGATGCAGAATTCGCTGTCGGGCAAGGACACCGACGCTGTCAATTCCTCCGTGGATGGTGTGGACTGCGATTCGAAGCCCGGTATAGCGGATGTGGACAATTGCAGGAATTCTAGCATCACAGGTAGTGGCGGTTTAGGAACTGAAAAGCATCAGTCTCAAGGAGCAGAAGTGCAGGAAGCTCCCGAACCCACCATTACCTCGTCTTCTGGTGGGTCCGGTAATAGTGCAGATAGAGGGAAAGAGGCCGCATCTAGTGGCAAGAGAAGAACCAGGGAAGGAGAGGAGTCCGAGTGCCAGAGCGAAGTGAGTAACTTGTTGCAACCCCAAGGGAGTCAAGTTGGTGCAGTAGCCCACAGGGTATGTTTTATCTAGTGATGCTAACTTTTTCCTGAATAACATCCCACTGACTGCTCTTTTTATGCGAGGATGTGTGAGAAGTGTACTTGCGTTTAATAAAAGCCAATGTTGTTTCTGGCAGCAAGATGGCGAGGACGAGATGGCCCAGCAAAAGAAACCTCAACAGAGAGGCTCCACCACTAAGAGGAGCAGGGCCGCGGAAGTCCACAACCTTTCCGAGCGAGTGAGAGTCCACCACTAACTGAGAAATTGAGCTCTGCGCCAATTGTACAGGATGGTCCAAGCCGTGAGCATATGACGGCAGTGGACAATCTAGGTCTCAAATCTTGTTTGGGTCGTCAATTTTGTGACTGATGTTAGTTTTGAAGCTCTTGGCTTCCGCAGCTTTACTGATAGAATTTCCTGCCCATTTCAGAGGCGAAGAGATCGTATCAACGAGAAGATGAAAGCTCTGCAAGAGCTGATCCCCAATTCCAACAAGGTTTGTTACAGCTTTCAGCCTTGTTCTTCGTACCTTGCCTCTTCTTTTGGATCACCGTGCGGTAACTTGCCCTTGAAATACAGTCAATGATGCAGACTTTTGATTCATATTGCAGACGGACAAAGCATCGATGCTGGATGAAGCGATCGAGTACTTGAAGATGCTCCAGTTGCAACTGCAGGTAACTATCCCAGCCTTTGACCTTCGCAGTAGTTCTCTGCTCCTCCTTGCGATGCAGGTGCTGTAGAGACGCCCGAGCACAAATACTGAATTCAATTTGCCCTCTTTAGCAGATGATGTCCATGAGAAGTGGAATGAGCATCCCCTCTATGGTGATGCCGGCGGGAATGCAACACCTTCAAATCCCGCAATTGCCCCAAATGGGCCCAATGCCTCCCATGGGAATGGGAATGGGCATGGGTATGGGCATGGGCCCGATGGGAATGGGAATGAGTATGATGGACATGGGAGGCGGAGCTCCCGGTCGACCGATGATACCCCTTCCGTCTCACAGTGGGCCTTCTCACTCTCACAACGTATCTGCAACCTCACCAGCTGTTTCTATGGTAGACACTCATGACCACCGCCTGCAAAACCCGAGCGTCATGGAGTCACTGAACGTCTTCATGGCGCAACACCGGCAAATGCAAATGGCTCCTCAGGTGATCCTTCTCTTTGAATGCCGGCTGGTTCTGTCCGATCTTCTGTCAGCTTTGTTTTTTGTGCAAATTTCCTAGGAGGAAGGAGCATGTGGTTGGGAGACGATGAAGTCTTGATTCTTACTCACTGTGCCTGTTCTTGCAGCCGATGAGTATGGATGCATTCAGTGCATTCATGATTCATCAGCACCAGCAGCAACACCAGCAGCAGCATCAACAACATCAGCTCCAACACCAACACCAGCATTCGCTCCATCATCTTCCGAGCAGCATGGGCGGTGGAGCCCCCCAATGAAGAGCGGGCCAAATTCTCGGTGGATCTTGATTTCCACGCTTGCTTTCCATTTGTCATGCCATTTCGCATTGGAGGCCAGCGATCTGTCAACAACTATCTGCTGTTCCGCTCTCGGAGAGCGTAATATACTCAGCTGCAGGCGTGGCTGTGAGTCTGACAGCCATCGTCGGGCATCAGGACACGATACAGCTGAAGGTGAAGGCGAAGGCCGATGGAGGTGTGGTCCGGTGCATCATTGGTTTCCACCTCTTAGTTTTGTAGTCTAGTTGGGGGATATGTAAACATCATGATCTCAGGTTGGAAAGTATGATTCTACTAGGACCGGATCTTGTGTAGGTGCCTTCAACCAGGCCGCAGCAGTGTTGAAGGCGTGTATTAGAACGCAGAATTGGATGATATGTATCAAGAAGGTCCTCGCTGCCCTCGCATTAGCGGCGTGCTGCGGTGCCATGCGGGGCCAGGGTCAGGGCCAGGGCGTTTCGCCTCTGTACTTTTATCAGCAAGCATAATTGCATCTTCTAACTAGCCTTAGCGAGGCGAGGTTTTGAGGATTAGTAGTTTTAGAAGAAGGAAGTGTCCGTAGTGCTGTCATTCCAGGGCCGGACCTTCTTCAATTGTTGCGGATCGGGATACTATGGCGCCGAAGTTTGCGCTCCGGCTTACGCTGTTCTCGTTGTGGATTTGGAGGGAACTCGTGTTGCCGGAAGCAGATTTCTAGTCGAAAGCCTGCCGCCCGAAATGTGCCATGTTTAATTGTCGATAAGGTTCAAGTTAAATGTTGGATTACATTCATTGTTCTCCGTTGGCTCAAGGCGAGCCACTTGTAAAAAGAAATGCCAAGTTTACCAACTTGAGACTCCTTGCACG

mRNA

>Mapoly0039s0059.6
GCGAGTCGACGGACGGAAAGAAGGAAGGAAGGAAGGAAAGTGGGGCGGGGCGATGAGGGAGGCGAGGAGTACAAGAATGTGGAGTAGTAAGGATATCATTTTGCTGGATGTTGCTGAAGACGATCAAGAGTCGAATTCGAGTGCGAGTCTTTGGTGCTAGAGCGGGAGGGTGGGCGATCCGAGTGCCAGATGTGGACGAGAGAAGCAGCGGAATCGATGGCTGCAGATTCGGGGCCAGTGGGCAGAGGCGGCTCGAGTCTTCCGACGGGAGGATTGAGGAGGGACACGAAGAGCTCTGAGTGATGTGATGCCATTCTGGTAGAGAAAAAGAAGGGATTCTGCTCTTGGGATCGCGCGAGGTCCCTGGGGCCAGCAAGCGCCCAGCTTGCCGAGCGGGCTCTCTGACGTCGAAGGTGCTGCCGCCTCTGTGTGTTTATCCCTGTGTCTCTGTGTTCTAGGCGGTTGTTGGCGGAGGGACGAGGGAGAGGAGTGGCGTTATGTCTGTCTGCTTGACAAGTTGGTACTCCTTGTGGGTCATAAGTTGGGATTTCCTTCCGCCCGTGGCACTGTTTCTGTCGGCGTGAGAAGAGCAAGTTTTCCAGCTCAAGGGACTGGATTTCGAATCGGGAACGGACTGAACACCGGAAGAATCCTCTCCGGTTGTCACTACATCCCCATCAGAGGCCAACCCACGATGCTGGCGAAACTGAGTGGGCAGAGGAAAGTCATATTGTAGCTATGCAGAACCAAAGCGGGAAGGGCAACAAGGCTATGTGGCAGCAGATGAATTTCCAGAATGGGTGGTCGAGTGTGCCAGAGTCTGAGGATGCCGTTACTCCTGTGAAGCCCATCAGCTCGTCGTCTCCGGGGAAGGAGCCGGTTCTTGTCAATGAGCCCGCGGTCGACACGCACCACTCCAGTGCCCTCAACATGCAGGAAGACGAGATGGTGTGCTGGCTGCAGTATCCGTTGGACGAACACCTCGAAAGAGACTACTGTTCCGAGTTCTTCGGCGAGCTGCCCAACTCCAACATATCGAACATGCAGCTGATGAAGGATTCATTCGCAGGGCAAAATCAAGTAGCGGGGCGCAACAACAGGAATCCAGGTCCCGTTAACGTAGGGAGTAACAGCAGAATGTCTAGTGCGGATGCGGCGATGGCCATGGGAGCGGGGCGAGCTGCCGGTTTGTTGCCTCAGACAGGGGTGGAGGTTTTCACCAAAGTTCGGACCACTTTGCAACCCTACGGAGGAAAGTGGTCCCCAAATCAGAACAACGCCGGGAAAACGCTGGGAGCGATGACCTCGACCCTGGCTCCGAGCCCGTCAAGATCCCCGCCGATGTCTGGGAACTTGTCGACCCCCATGCTCCCCCCGAAGTCTCAGGGACTCAGCTTCCAGCCTCCCAGAACCTCAGGCCCGATGAATTTCTCGCATTTCTCTCGCCCTGCGGCTGTGATGAAGGCCAATCTCCAGTGCCTAGGAATGTCTCACGTGGCCCCTCCGCACGGGAGCGGGACGAACGTCCGGCTCAAGAGCCAACCCTACAGCGGGAAGCCACCCGTCGACGCAAGCACGTCGACGGGGTCCTCCATTGCAGAGTCAACCACCACGAGGCAACGCAGCGGCGCTTTCCGCAAGGATACCGAATGCCAAGTCGAAGGTTCCGAAGCTCAACAGAGTCTTGGAACCGAATCGAGCTGGCCTTCGATGCAGAATTCGCTGTCGGGCAAGGACACCGACGCTGTCAATTCCTCCGTGGATGGTGTGGACTGCGATTCGAAGCCCGGTATAGCGGATGTGGACAATTGCAGGAATTCTAGCATCACAGGTAGTGGCGGTTTAGGAACTGAAAAGCATCAGTCTCAAGGAGCAGAAGTGCAGGAAGCTCCCGAACCCACCATTACCTCGTCTTCTGGTGGGTCCGGTAATAGTGCAGATAGAGGGAAAGAGGCCGCATCTAGTGGCAAGAGAAGAACCAGGGAAGGAGAGGAGTCCGAGTGCCAGAGCGAAGTGAGTAACTTGTTGCAACCCCAAGGGAGTCAAGTTGGTGCAGTAGCCCACAGGCAAGATGGCGAGGACGAGATGGCCCAGCAAAAGAAACCTCAACAGAGAGGCTCCACCACTAAGAGGAGCAGGGCCGCGGAAGTCCACAACCTTTCCGAGCGAAGGCGAAGAGATCGTATCAACGAGAAGATGAAAGCTCTGCAAGAGCTGATCCCCAATTCCAACAAGACGGACAAAGCATCGATGCTGGATGAAGCGATCGAGTACTTGAAGATGCTCCAGTTGCAACTGCAGATGATGTCCATGAGAAGTGGAATGAGCATCCCCTCTATGGTGATGCCGGCGGGAATGCAACACCTTCAAATCCCGCAATTGCCCCAAATGGGCCCAATGCCTCCCATGGGAATGGGAATGGGCATGGGTATGGGCATGGGCCCGATGGGAATGGGAATGAGTATGATGGACATGGGAGGCGGAGCTCCCGGTCGACCGATGATACCCCTTCCGTCTCACAGTGGGCCTTCTCACTCTCACAACGTATCTGCAACCTCACCAGCTGTTTCTATGGTAGACACTCATGACCACCGCCTGCAAAACCCGAGCGTCATGGAGTCACTGAACGTCTTCATGGCGCAACACCGGCAAATGCAAATGGCTCCTCAGCCGATGAGTATGGATGCATTCAGTGCATTCATGATTCATCAGCACCAGCAGCAACACCAGCAGCAGCATCAACAACATCAGCTCCAACACCAACACCAGCATTCGCTCCATCATCTTCCGAGCAGCATGGGCGGTGGAGCCCCCCAATGAAGAGCGGGCCAAATTCTCGGTGGATCTTGATTTCCACGCTTGCTTTCCATTTGTCATGCCATTTCGCATTGGAGGCCAGCGATCTGTCAACAACTATCTGCTGTTCCGCTCTCGGAGAGCGTAATATACTCAGCTGCAGGCGTGGCTGTGAGTCTGACAGCCATCGTCGGGCATCAGGACACGATACAGCTGAAGGTGAAGGCGAAGGCCGATGGAGGTGTGGTCCGGTGCATCATTGGTTTCCACCTCTTAGTTTTGTAGTCTAGTTGGGGGATATGTAAACATCATGATCTCAGGTTGGAAAGTATGATTCTACTAGGACCGGATCTTGTGTAGGTGCCTTCAACCAGGCCGCAGCAGTGTTGAAGGCGTGTATTAGAACGCAGAATTGGATGATATGTATCAAGAAGGTCCTCGCTGCCCTCGCATTAGCGGCGTGCTGCGGTGCCATGCGGGGCCAGGGTCAGGGCCAGGGCGTTTCGCCTCTGTACTTTTATCAGCAAGCATAATTGCATCTTCTAACTAGCCTTAGCGAGGCGAGGTTTTGAGGATTAGTAGTTTTAGAAGAAGGAAGTGTCCGTAGTGCTGTCATTCCAGGGCCGGACCTTCTTCAATTGTTGCGGATCGGGATACTATGGCGCCGAAGTTTGCGCTCCGGCTTACGCTGTTCTCGTTGTGGATTTGGAGGGAACTCGTGTTGCCGGAAGCAGATTTCTAGTCGAAAGCCTGCCGCCCGAAATGTGCCATGTTTAATTGTCGATAAGGTTCAAGTTAAATGTTGGATTACATTCATTGTTCTCCGTTGGCTCAAGGCGAGCCACTTGTAAAAAGAAATGCCAAGTTTACCAACTTGAGACTCCTTGCACG

CDS

>Mapoly0039s0059.6
ATGCAGAACCAAAGCGGGAAGGGCAACAAGGCTATGTGGCAGCAGATGAATTTCCAGAATGGGTGGTCGAGTGTGCCAGAGTCTGAGGATGCCGTTACTCCTGTGAAGCCCATCAGCTCGTCGTCTCCGGGGAAGGAGCCGGTTCTTGTCAATGAGCCCGCGGTCGACACGCACCACTCCAGTGCCCTCAACATGCAGGAAGACGAGATGGTGTGCTGGCTGCAGTATCCGTTGGACGAACACCTCGAAAGAGACTACTGTTCCGAGTTCTTCGGCGAGCTGCCCAACTCCAACATATCGAACATGCAGCTGATGAAGGATTCATTCGCAGGGCAAAATCAAGTAGCGGGGCGCAACAACAGGAATCCAGGTCCCGTTAACGTAGGGAGTAACAGCAGAATGTCTAGTGCGGATGCGGCGATGGCCATGGGAGCGGGGCGAGCTGCCGGTTTGTTGCCTCAGACAGGGGTGGAGGTTTTCACCAAAGTTCGGACCACTTTGCAACCCTACGGAGGAAAGTGGTCCCCAAATCAGAACAACGCCGGGAAAACGCTGGGAGCGATGACCTCGACCCTGGCTCCGAGCCCGTCAAGATCCCCGCCGATGTCTGGGAACTTGTCGACCCCCATGCTCCCCCCGAAGTCTCAGGGACTCAGCTTCCAGCCTCCCAGAACCTCAGGCCCGATGAATTTCTCGCATTTCTCTCGCCCTGCGGCTGTGATGAAGGCCAATCTCCAGTGCCTAGGAATGTCTCACGTGGCCCCTCCGCACGGGAGCGGGACGAACGTCCGGCTCAAGAGCCAACCCTACAGCGGGAAGCCACCCGTCGACGCAAGCACGTCGACGGGGTCCTCCATTGCAGAGTCAACCACCACGAGGCAACGCAGCGGCGCTTTCCGCAAGGATACCGAATGCCAAGTCGAAGGTTCCGAAGCTCAACAGAGTCTTGGAACCGAATCGAGCTGGCCTTCGATGCAGAATTCGCTGTCGGGCAAGGACACCGACGCTGTCAATTCCTCCGTGGATGGTGTGGACTGCGATTCGAAGCCCGGTATAGCGGATGTGGACAATTGCAGGAATTCTAGCATCACAGGTAGTGGCGGTTTAGGAACTGAAAAGCATCAGTCTCAAGGAGCAGAAGTGCAGGAAGCTCCCGAACCCACCATTACCTCGTCTTCTGGTGGGTCCGGTAATAGTGCAGATAGAGGGAAAGAGGCCGCATCTAGTGGCAAGAGAAGAACCAGGGAAGGAGAGGAGTCCGAGTGCCAGAGCGAAGTGAGTAACTTGTTGCAACCCCAAGGGAGTCAAGTTGGTGCAGTAGCCCACAGGCAAGATGGCGAGGACGAGATGGCCCAGCAAAAGAAACCTCAACAGAGAGGCTCCACCACTAAGAGGAGCAGGGCCGCGGAAGTCCACAACCTTTCCGAGCGAAGGCGAAGAGATCGTATCAACGAGAAGATGAAAGCTCTGCAAGAGCTGATCCCCAATTCCAACAAGACGGACAAAGCATCGATGCTGGATGAAGCGATCGAGTACTTGAAGATGCTCCAGTTGCAACTGCAGATGATGTCCATGAGAAGTGGAATGAGCATCCCCTCTATGGTGATGCCGGCGGGAATGCAACACCTTCAAATCCCGCAATTGCCCCAAATGGGCCCAATGCCTCCCATGGGAATGGGAATGGGCATGGGTATGGGCATGGGCCCGATGGGAATGGGAATGAGTATGATGGACATGGGAGGCGGAGCTCCCGGTCGACCGATGATACCCCTTCCGTCTCACAGTGGGCCTTCTCACTCTCACAACGTATCTGCAACCTCACCAGCTGTTTCTATGGTAGACACTCATGACCACCGCCTGCAAAACCCGAGCGTCATGGAGTCACTGAACGTCTTCATGGCGCAACACCGGCAAATGCAAATGGCTCCTCAGCCGATGAGTATGGATGCATTCAGTGCATTCATGATTCATCAGCACCAGCAGCAACACCAGCAGCAGCATCAACAACATCAGCTCCAACACCAACACCAGCATTCGCTCCATCATCTTCCGAGCAGCATGGGCGGTGGAGCCCCCCAATGA

Protein

>Mapoly0039s0059.6
MQNQSGKGNKAMWQQMNFQNGWSSVPESEDAVTPVKPISSSSPGKEPVLVNEPAVDTHHSSALNMQEDEMVCWLQYPLDEHLERDYCSEFFGELPNSNISNMQLMKDSFAGQNQVAGRNNRNPGPVNVGSNSRMSSADAAMAMGAGRAAGLLPQTGVEVFTKVRTTLQPYGGKWSPNQNNAGKTLGAMTSTLAPSPSRSPPMSGNLSTPMLPPKSQGLSFQPPRTSGPMNFSHFSRPAAVMKANLQCLGMSHVAPPHGSGTNVRLKSQPYSGKPPVDASTSTGSSIAESTTTRQRSGAFRKDTECQVEGSEAQQSLGTESSWPSMQNSLSGKDTDAVNSSVDGVDCDSKPGIADVDNCRNSSITGSGGLGTEKHQSQGAEVQEAPEPTITSSSGGSGNSADRGKEAASSGKRRTREGEESECQSEVSNLLQPQGSQVGAVAHRQDGEDEMAQQKKPQQRGSTTKRSRAAEVHNLSERRRRDRINEKMKALQELIPNSNKTDKASMLDEAIEYLKMLQLQLQMMSMRSGMSIPSMVMPAGMQHLQIPQLPQMGPMPPMGMGMGMGMGMGPMGMGMSMMDMGGGAPGRPMIPLPSHSGPSHSHNVSATSPAVSMVDTHDHRLQNPSVMESLNVFMAQHRQMQMAPQPMSMDAFSAFMIHQHQQQHQQQHQQHQLQHQHQHSLHHLPSSMGGGAPQ

Mapoly0039s0059.7  

Gene structure:

mRNA scaffold_39:781195..786893  ( - strand )
three_prime_UTR scaffold_39:781195..782061  ( - strand )
CDS scaffold_39:782062..782211  ( - strand )
CDS scaffold_39:782354..782725  ( - strand )
CDS scaffold_39:782835..782900  ( - strand )
CDS scaffold_39:783016..783081  ( - strand )
CDS scaffold_39:783274..783375  ( - strand )
CDS scaffold_39:783497..784825  ( - strand )
five_prime_UTR scaffold_39:784826..784880  ( - strand )
five_prime_UTR scaffold_39:785613..785687  ( - strand )
five_prime_UTR scaffold_39:786481..786893  ( - strand )

Sequences:

Gene

>Mapoly0039s0059.7
GCGAGTCGACGGACGGAAAGAAGGAAGGAAGGAAGGAAAGTGGGGCGGGGCGATGAGGGAGGCGAGGAGTACAAGAATGTGGAGTAGTAAGGATATCATTTTGCTGGATGTTGCTGAAGACGATCAAGAGTCGAATTCGAGTGCGAGTCTTTGGTGCTAGAGCGGGAGGGTGGGCGATCCGAGTGCCAGATGTGGACGAGAGAAGCAGCGGAATCGATGGCTGCAGATTCGGGGCCAGTGGGCAGAGGCGGCTCGAGTCTTCCGACGGGAGGATTGAGGAGGGACACGAAGAGCTCTGAGTGATGTGATGCCATTCTGGTAGAGAAAAAGAAGGGATTCTGCTCTTGGGATCGCGCGAGGTCCCTGGGGCCAGCAAGCGCCCAGCTTGCCGAGCGGGCTCTCTGACGTCGAAGGTGCTGCCGCCTCTGTGTGTTTATCCCTGTGTCTCTGTGTTCTAGGCGGTTGTTGGCGGAGGGACGAGGGAGAGGAGTGGCGTTATGTCTGTCTGCTTGACAAGTTGGTACTCCTTGTGGGTCATAAGTTGGGATTTCCTTCCGCCCGTGGCACTGTTTCTGTCGGCGTGAGAAGAGCAAGTTTTCCAGCTCAAGGTTCAGTCCTATCGTTTTTATCTTCGCCTTCCCTCTCCCGCGTGTCTCCATGCATTTGATGACCTTGTCTGTCGGCGACGCTAGCCTCGAGCATCCATGTCAGGCCCACGCCGCTCTAGTGTGTATGTTTGAGTAGACAGCTCTTGTTCTCCCACATAATGAAATGTCCGCGATCACTGAGCCTTGGTAATTTTGATCTCCTTTCTCGCTCACTCTGCCGCAGGAGAGTGTGCAGCTACTTCGTTAAGTGTGCTTGTCCGCACGGTTGACATAACCTCTATGAGATCTTTAGATTCTGAGCGAGATCCTTCTCTTGTGACAGAGCCGTGAGAAAGAGCCGGGGTGGCCTGTTGTATTTCCCGAGGAGATGAATGTACAAACTGCATAAAAACTGCATCTCCTTGATGCTCCGGAATGATGAGGACATGTAAGGAAGCGTTGAGTACACCGACCCAGAAGAATCGTAAATGCATCTGCACTCTGTGTTGTAGAGTTGGGCCCATTTAGTCGACGGCGATAAGTAGCAGATTGACCCGCTTAGCGGCAAGAACCCGTTGTGCCTCTGTTTAAACTGACTGGGTTCGAATTGCTCCTACAGGGACTGGATTTCGAATCGGGAACGGACTGAACACCGGAAGAATCCTCTCCGGTTGTCACTACATCCCCATCAGAGGTGAGTTCAGTGTGGGAAGCCTGTCGAGAGATCGGCGAGCTGGTGATTCTTACTTGCTTTCTGTCTGTGTTTGGAGCGTCTACCTTTCTCGTAATCTACCCATACCTTTCCCGTCACTGAGAAATGAAGAGGCTTTAAAAGTAGGTGAACTTCGAGACTTGGGTGCCATGAGAGTAGATTAGAAGTAGGACGAGCAGGAGACGACTGCAAACTGTCGAAGTCTTCACCTCTCATCTTCTCATTCCCACTGCCATGCCTTACTCACGACCATCCACTACCTCTATGTATGTGGGAGCGCTTCTGGCGAAGCGCTGGGCATTGACAGTGACAGGCCGAGAAGTCGATGCCGTAGCAGTCTAGGTAGGCATTTGATTTACCTCCTCCTGTTTGACTCGCAGACCATGAGTCACCTCGTTCCCGACTGGGATGGTAACGGTGGAGACTTAGAAGCTGTTTTACCCACAAGCGATTTCTCACTGCCGGTTAAGGGAAAGTGGGACTCATTGCCCCATAAAAGGTCGCACTTGTCTGGTTTGGCCTTCGTGTAAGCGCTTGCTCCGGCTTTTCAATCCCCATAGTTTTTTGTGTTCTTGATACCATTGTATGTAAGGTCAATTTCTTGATTGTGGATCTTTGAGAATGCCACTTCGTGATGCCGGCTCGTTGACATGCTGCTCTTCGTCACATGAGCTTCGAAGAGATGTTAAAGGTCGCGTTCTTCTTCTTCTACAGGCCAACCCACGATGCTGGCGAAACTGAGTGGGCAGAGGAAAGTCATATTGTAGCTATGCAGAACCAAAGCGGGAAGGGCAACAAGGCTATGTGGCAGCAGATGAATTTCCAGAATGGGTGGTCGAGTGTGCCAGAGTCTGAGGATGCCGTTACTCCTGTGAAGCCCATCAGCTCGTCGTCTCCGGGGAAGGAGCCGGTTCTTGTCAATGAGCCCGCGGTCGACACGCACCACTCCAGTGCCCTCAACATGCAGGAAGACGAGATGGTGTGCTGGCTGCAGTATCCGTTGGACGAACACCTCGAAAGAGACTACTGTTCCGAGTTCTTCGGCGAGCTGCCCAACTCCAACATATCGAACATGCAGCTGATGAAGGATTCATTCGCAGGGCAAAATCAAGTAGCGGGGCGCAACAACAGGAATCCAGGTCCCGTTAACGTAGGGAGTAACAGCAGAATGTCTAGTGCGGATGCGGCGATGGCCATGGGAGCGGGGCGAGCTGCCGGTTTGTTGCCTCAGACAGGGGTGGAGGTTTTCACCAAAGTTCGGACCACTTTGCAACCCTACGGAGGAAAGTGGTCCCCAAATCAGAACAACGCCGGGAAAACGCTGGGAGCGATGACCTCGACCCTGGCTCCGAGCCCGTCAAGATCCCCGCCGATGTCTGGGAACTTGTCGACCCCCATGCTCCCCCCGAAGTCTCAGGGACTCAGCTTCCAGCCTCCCAGAACCTCAGGCCCGATGAATTTCTCGCATTTCTCTCGCCCTGCGGCTGTGATGAAGGCCAATCTCCAGTGCCTAGGAATGTCTCACGTGGCCCCTCCGCACGGGAGCGGGACGAACGTCCGGCTCAAGAGCCAACCCTACAGCGGGAAGCCACCCGTCGACGCAAGCACGTCGACGGGGTCCTCCATTGCAGAGTCAACCACCACGAGGCAACGCAGCGGCGCTTTCCGCAAGGATACCGAATGCCAAGTCGAAGGTTCCGAAGCTCAACAGAGTCTTGGAACCGAATCGAGCTGGCCTTCGATGCAGAATTCGCTGTCGGGCAAGGACACCGACGCTGTCAATTCCTCCGTGGATGGTGTGGACTGCGATTCGAAGCCCGGTATAGCGGATGTGGACAATTGCAGGAATTCTAGCATCACAGGTAGTGGCGGTTTAGGAACTGAAAAGCATCAGTCTCAAGGAGCAGAAGTGCAGGAAGCTCCCGAACCCACCATTACCTCGTCTTCTGGTGGGTCCGGTAATAGTGCAGATAGAGGGAAAGAGGCCGCATCTAGTGGCAAGAGAAGAACCAGGGAAGGAGAGGAGTCCGAGTGCCAGAGCGAAGTGAGTAACTTGTTGCAACCCCAAGGGAGTCAAGTTGGTGCAGTAGCCCACAGGGTATGTTTTATCTAGTGATGCTAACTTTTTCCTGAATAACATCCCACTGACTGCTCTTTTTATGCGAGGATGTGTGAGAAGTGTACTTGCGTTTAATAAAAGCCAATGTTGTTTCTGGCAGCAAGATGGCGAGGACGAGATGGCCCAGCAAAAGAAACCTCAACAGAGAGGCTCCACCACTAAGAGGAGCAGGGCCGCGGAAGTCCACAACCTTTCCGAGCGAGTGAGAGTCCACCACTAACTGAGAAATTGAGCTCTGCGCCAATTGTACAGGATGGTCCAAGCCGTGAGCATATGACGGCAGTGGACAATCTAGGTCTCAAATCTTGTTTGGGTCGTCAATTTTGTGACTGATGTTAGTTTTGAAGCTCTTGGCTTCCGCAGCTTTACTGATAGAATTTCCTGCCCATTTCAGAGGCGAAGAGATCGTATCAACGAGAAGATGAAAGCTCTGCAAGAGCTGATCCCCAATTCCAACAAGGTTTGTTACAGCTTTCAGCCTTGTTCTTCGTACCTTGCCTCTTCTTTTGGATCACCGTGCGGTAACTTGCCCTTGAAATACAGTCAATGATGCAGACTTTTGATTCATATTGCAGACGGACAAAGCATCGATGCTGGATGAAGCGATCGAGTACTTGAAGATGCTCCAGTTGCAACTGCAGGTAACTATCCCAGCCTTTGACCTTCGCAGTAGTTCTCTGCTCCTCCTTGCGATGCAGGTGCTGTAGAGACGCCCGAGCACAAATACTGAATTCAATTTGCCCTCTTTAGCAGATGATGTCCATGAGAAGTGGAATGAGCATCCCCTCTATGGTGATGCCGGCGGGAATGCAACACCTTCAAATCCCGCAATTGCCCCAAATGGGCCCAATGCCTCCCATGGGAATGGGAATGGGCATGGGTATGGGCATGGGCCCGATGGGAATGGGAATGAGTATGATGGACATGGGAGGCGGAGCTCCCGGTCGACCGATGATACCCCTTCCGTCTCACAGTGGGCCTTCTCACTCTCACAACGTATCTGCAACCTCACCAGCTGTTTCTATGGTAGACACTCATGACCACCGCCTGCAAAACCCGAGCGTCATGGAGTCACTGAACGTCTTCATGGCGCAACACCGGCAAATGCAAATGGCTCCTCAGGTGATCCTTCTCTTTGAATGCCGGCTGGTTCTGTCCGATCTTCTGTCAGCTTTGTTTTTTGTGCAAATTTCCTAGGAGGAAGGAGCATGTGGTTGGGAGACGATGAAGTCTTGATTCTTACTCACTGTGCCTGTTCTTGCAGCCGATGAGTATGGATGCATTCAGTGCATTCATGATTCATCAGCACCAGCAGCAACACCAGCAGCAGCATCAACAACATCAGCTCCAACACCAACACCAGCATTCGCTCCATCATCTTCCGAGCAGCATGGGCGGTGGAGCCCCCCAATGAAGAGCGGGCCAAATTCTCGGTGGATCTTGATTTCCACGCTTGCTTTCCATTTGTCATGCCATTTCGCATTGGAGGCCAGCGATCTGTCAACAACTATCTGCTGTTCCGCTCTCGGAGAGCGTAATATACTCAGCTGCAGGCGTGGCTGTGAGTCTGACAGCCATCGTCGGGCATCAGGACACGATACAGCTGAAGGTGAAGGCGAAGGCCGATGGAGGTGTGGTCCGGTGCATCATTGGTTTCCACCTCTTAGTTTTGTAGTCTAGTTGGGGGATATGTAAACATCATGATCTCAGGTTGGAAAGTATGATTCTACTAGGACCGGATCTTGTGTAGGTGCCTTCAACCAGGCCGCAGCAGTGTTGAAGGCGTGTATTAGAACGCAGAATTGGATGATATGTATCAAGAAGGTCCTCGCTGCCCTCGCATTAGCGGCGTGCTGCGGTGCCATGCGGGGCCAGGGTCAGGGCCAGGGCGTTTCGCCTCTGTACTTTTATCAGCAAGCATAATTGCATCTTCTAACTAGCCTTAGCGAGGCGAGGTTTTGAGGATTAGTAGTTTTAGAAGAAGGAAGTGTCCGTAGTGCTGTCATTCCAGGGCCGGACCTTCTTCAATTGTTGCGGATCGGGATACTATGGCGCCGAAGTTTGCGCTCCGGCTTACGCTGTTCTCGTTGTGGATTTGGAGGGAACTCGTGTTGCCGGAAGCAGATTTCTAGTCGAAAGCCTGCCGCCCGAAATGTGCCATGTTTAATTGTCGATAAGGTTCAAGTTAAATGTTGGATTACATTCATTGTTCTCCGTTGGCTCAAGGCGAGCCACTTGTAAAAAGAAATGCCAAGTTTACCAACTTGAGACTCCTTGCACG

mRNA

>Mapoly0039s0059.7
GCGAGTCGACGGACGGAAAGAAGGAAGGAAGGAAGGAAAGTGGGGCGGGGCGATGAGGGAGGCGAGGAGTACAAGAATGTGGAGTAGTAAGGATATCATTTTGCTGGATGTTGCTGAAGACGATCAAGAGTCGAATTCGAGTGCGAGTCTTTGGTGCTAGAGCGGGAGGGTGGGCGATCCGAGTGCCAGATGTGGACGAGAGAAGCAGCGGAATCGATGGCTGCAGATTCGGGGCCAGTGGGCAGAGGCGGCTCGAGTCTTCCGACGGGAGGATTGAGGAGGGACACGAAGAGCTCTGAGTGATGTGATGCCATTCTGGTAGAGAAAAAGAAGGGATTCTGCTCTTGGGATCGCGCGAGGTCCCTGGGGCCAGCAAGCGCCCAGCTTGCCGAGCGGGCTCTCTGACGTCGAAGGGACTGGATTTCGAATCGGGAACGGACTGAACACCGGAAGAATCCTCTCCGGTTGTCACTACATCCCCATCAGAGGCCAACCCACGATGCTGGCGAAACTGAGTGGGCAGAGGAAAGTCATATTGTAGCTATGCAGAACCAAAGCGGGAAGGGCAACAAGGCTATGTGGCAGCAGATGAATTTCCAGAATGGGTGGTCGAGTGTGCCAGAGTCTGAGGATGCCGTTACTCCTGTGAAGCCCATCAGCTCGTCGTCTCCGGGGAAGGAGCCGGTTCTTGTCAATGAGCCCGCGGTCGACACGCACCACTCCAGTGCCCTCAACATGCAGGAAGACGAGATGGTGTGCTGGCTGCAGTATCCGTTGGACGAACACCTCGAAAGAGACTACTGTTCCGAGTTCTTCGGCGAGCTGCCCAACTCCAACATATCGAACATGCAGCTGATGAAGGATTCATTCGCAGGGCAAAATCAAGTAGCGGGGCGCAACAACAGGAATCCAGGTCCCGTTAACGTAGGGAGTAACAGCAGAATGTCTAGTGCGGATGCGGCGATGGCCATGGGAGCGGGGCGAGCTGCCGGTTTGTTGCCTCAGACAGGGGTGGAGGTTTTCACCAAAGTTCGGACCACTTTGCAACCCTACGGAGGAAAGTGGTCCCCAAATCAGAACAACGCCGGGAAAACGCTGGGAGCGATGACCTCGACCCTGGCTCCGAGCCCGTCAAGATCCCCGCCGATGTCTGGGAACTTGTCGACCCCCATGCTCCCCCCGAAGTCTCAGGGACTCAGCTTCCAGCCTCCCAGAACCTCAGGCCCGATGAATTTCTCGCATTTCTCTCGCCCTGCGGCTGTGATGAAGGCCAATCTCCAGTGCCTAGGAATGTCTCACGTGGCCCCTCCGCACGGGAGCGGGACGAACGTCCGGCTCAAGAGCCAACCCTACAGCGGGAAGCCACCCGTCGACGCAAGCACGTCGACGGGGTCCTCCATTGCAGAGTCAACCACCACGAGGCAACGCAGCGGCGCTTTCCGCAAGGATACCGAATGCCAAGTCGAAGGTTCCGAAGCTCAACAGAGTCTTGGAACCGAATCGAGCTGGCCTTCGATGCAGAATTCGCTGTCGGGCAAGGACACCGACGCTGTCAATTCCTCCGTGGATGGTGTGGACTGCGATTCGAAGCCCGGTATAGCGGATGTGGACAATTGCAGGAATTCTAGCATCACAGGTAGTGGCGGTTTAGGAACTGAAAAGCATCAGTCTCAAGGAGCAGAAGTGCAGGAAGCTCCCGAACCCACCATTACCTCGTCTTCTGGTGGGTCCGGTAATAGTGCAGATAGAGGGAAAGAGGCCGCATCTAGTGGCAAGAGAAGAACCAGGGAAGGAGAGGAGTCCGAGTGCCAGAGCGAAGTGAGTAACTTGTTGCAACCCCAAGGGAGTCAAGTTGGTGCAGTAGCCCACAGGCAAGATGGCGAGGACGAGATGGCCCAGCAAAAGAAACCTCAACAGAGAGGCTCCACCACTAAGAGGAGCAGGGCCGCGGAAGTCCACAACCTTTCCGAGCGAAGGCGAAGAGATCGTATCAACGAGAAGATGAAAGCTCTGCAAGAGCTGATCCCCAATTCCAACAAGACGGACAAAGCATCGATGCTGGATGAAGCGATCGAGTACTTGAAGATGCTCCAGTTGCAACTGCAGCAGATGATGTCCATGAGAAGTGGAATGAGCATCCCCTCTATGGTGATGCCGGCGGGAATGCAACACCTTCAAATCCCGCAATTGCCCCAAATGGGCCCAATGCCTCCCATGGGAATGGGAATGGGCATGGGTATGGGCATGGGCCCGATGGGAATGGGAATGAGTATGATGGACATGGGAGGCGGAGCTCCCGGTCGACCGATGATACCCCTTCCGTCTCACAGTGGGCCTTCTCACTCTCACAACGTATCTGCAACCTCACCAGCTGTTTCTATGGTAGACACTCATGACCACCGCCTGCAAAACCCGAGCGTCATGGAGTCACTGAACGTCTTCATGGCGCAACACCGGCAAATGCAAATGGCTCCTCAGCCGATGAGTATGGATGCATTCAGTGCATTCATGATTCATCAGCACCAGCAGCAACACCAGCAGCAGCATCAACAACATCAGCTCCAACACCAACACCAGCATTCGCTCCATCATCTTCCGAGCAGCATGGGCGGTGGAGCCCCCCAATGAAGAGCGGGCCAAATTCTCGGTGGATCTTGATTTCCACGCTTGCTTTCCATTTGTCATGCCATTTCGCATTGGAGGCCAGCGATCTGTCAACAACTATCTGCTGTTCCGCTCTCGGAGAGCGTAATATACTCAGCTGCAGGCGTGGCTGTGAGTCTGACAGCCATCGTCGGGCATCAGGACACGATACAGCTGAAGGTGAAGGCGAAGGCCGATGGAGGTGTGGTCCGGTGCATCATTGGTTTCCACCTCTTAGTTTTGTAGTCTAGTTGGGGGATATGTAAACATCATGATCTCAGGTTGGAAAGTATGATTCTACTAGGACCGGATCTTGTGTAGGTGCCTTCAACCAGGCCGCAGCAGTGTTGAAGGCGTGTATTAGAACGCAGAATTGGATGATATGTATCAAGAAGGTCCTCGCTGCCCTCGCATTAGCGGCGTGCTGCGGTGCCATGCGGGGCCAGGGTCAGGGCCAGGGCGTTTCGCCTCTGTACTTTTATCAGCAAGCATAATTGCATCTTCTAACTAGCCTTAGCGAGGCGAGGTTTTGAGGATTAGTAGTTTTAGAAGAAGGAAGTGTCCGTAGTGCTGTCATTCCAGGGCCGGACCTTCTTCAATTGTTGCGGATCGGGATACTATGGCGCCGAAGTTTGCGCTCCGGCTTACGCTGTTCTCGTTGTGGATTTGGAGGGAACTCGTGTTGCCGGAAGCAGATTTCTAGTCGAAAGCCTGCCGCCCGAAATGTGCCATGTTTAATTGTCGATAAGGTTCAAGTTAAATGTTGGATTACATTCATTGTTCTCCGTTGGCTCAAGGCGAGCCACTTGTAAAAAGAAATGCCAAGTTTACCAACTTGAGACTCCTTGCACG

CDS

>Mapoly0039s0059.7
ATGCAGAACCAAAGCGGGAAGGGCAACAAGGCTATGTGGCAGCAGATGAATTTCCAGAATGGGTGGTCGAGTGTGCCAGAGTCTGAGGATGCCGTTACTCCTGTGAAGCCCATCAGCTCGTCGTCTCCGGGGAAGGAGCCGGTTCTTGTCAATGAGCCCGCGGTCGACACGCACCACTCCAGTGCCCTCAACATGCAGGAAGACGAGATGGTGTGCTGGCTGCAGTATCCGTTGGACGAACACCTCGAAAGAGACTACTGTTCCGAGTTCTTCGGCGAGCTGCCCAACTCCAACATATCGAACATGCAGCTGATGAAGGATTCATTCGCAGGGCAAAATCAAGTAGCGGGGCGCAACAACAGGAATCCAGGTCCCGTTAACGTAGGGAGTAACAGCAGAATGTCTAGTGCGGATGCGGCGATGGCCATGGGAGCGGGGCGAGCTGCCGGTTTGTTGCCTCAGACAGGGGTGGAGGTTTTCACCAAAGTTCGGACCACTTTGCAACCCTACGGAGGAAAGTGGTCCCCAAATCAGAACAACGCCGGGAAAACGCTGGGAGCGATGACCTCGACCCTGGCTCCGAGCCCGTCAAGATCCCCGCCGATGTCTGGGAACTTGTCGACCCCCATGCTCCCCCCGAAGTCTCAGGGACTCAGCTTCCAGCCTCCCAGAACCTCAGGCCCGATGAATTTCTCGCATTTCTCTCGCCCTGCGGCTGTGATGAAGGCCAATCTCCAGTGCCTAGGAATGTCTCACGTGGCCCCTCCGCACGGGAGCGGGACGAACGTCCGGCTCAAGAGCCAACCCTACAGCGGGAAGCCACCCGTCGACGCAAGCACGTCGACGGGGTCCTCCATTGCAGAGTCAACCACCACGAGGCAACGCAGCGGCGCTTTCCGCAAGGATACCGAATGCCAAGTCGAAGGTTCCGAAGCTCAACAGAGTCTTGGAACCGAATCGAGCTGGCCTTCGATGCAGAATTCGCTGTCGGGCAAGGACACCGACGCTGTCAATTCCTCCGTGGATGGTGTGGACTGCGATTCGAAGCCCGGTATAGCGGATGTGGACAATTGCAGGAATTCTAGCATCACAGGTAGTGGCGGTTTAGGAACTGAAAAGCATCAGTCTCAAGGAGCAGAAGTGCAGGAAGCTCCCGAACCCACCATTACCTCGTCTTCTGGTGGGTCCGGTAATAGTGCAGATAGAGGGAAAGAGGCCGCATCTAGTGGCAAGAGAAGAACCAGGGAAGGAGAGGAGTCCGAGTGCCAGAGCGAAGTGAGTAACTTGTTGCAACCCCAAGGGAGTCAAGTTGGTGCAGTAGCCCACAGGCAAGATGGCGAGGACGAGATGGCCCAGCAAAAGAAACCTCAACAGAGAGGCTCCACCACTAAGAGGAGCAGGGCCGCGGAAGTCCACAACCTTTCCGAGCGAAGGCGAAGAGATCGTATCAACGAGAAGATGAAAGCTCTGCAAGAGCTGATCCCCAATTCCAACAAGACGGACAAAGCATCGATGCTGGATGAAGCGATCGAGTACTTGAAGATGCTCCAGTTGCAACTGCAGCAGATGATGTCCATGAGAAGTGGAATGAGCATCCCCTCTATGGTGATGCCGGCGGGAATGCAACACCTTCAAATCCCGCAATTGCCCCAAATGGGCCCAATGCCTCCCATGGGAATGGGAATGGGCATGGGTATGGGCATGGGCCCGATGGGAATGGGAATGAGTATGATGGACATGGGAGGCGGAGCTCCCGGTCGACCGATGATACCCCTTCCGTCTCACAGTGGGCCTTCTCACTCTCACAACGTATCTGCAACCTCACCAGCTGTTTCTATGGTAGACACTCATGACCACCGCCTGCAAAACCCGAGCGTCATGGAGTCACTGAACGTCTTCATGGCGCAACACCGGCAAATGCAAATGGCTCCTCAGCCGATGAGTATGGATGCATTCAGTGCATTCATGATTCATCAGCACCAGCAGCAACACCAGCAGCAGCATCAACAACATCAGCTCCAACACCAACACCAGCATTCGCTCCATCATCTTCCGAGCAGCATGGGCGGTGGAGCCCCCCAATGA

Protein

>Mapoly0039s0059.7
MQNQSGKGNKAMWQQMNFQNGWSSVPESEDAVTPVKPISSSSPGKEPVLVNEPAVDTHHSSALNMQEDEMVCWLQYPLDEHLERDYCSEFFGELPNSNISNMQLMKDSFAGQNQVAGRNNRNPGPVNVGSNSRMSSADAAMAMGAGRAAGLLPQTGVEVFTKVRTTLQPYGGKWSPNQNNAGKTLGAMTSTLAPSPSRSPPMSGNLSTPMLPPKSQGLSFQPPRTSGPMNFSHFSRPAAVMKANLQCLGMSHVAPPHGSGTNVRLKSQPYSGKPPVDASTSTGSSIAESTTTRQRSGAFRKDTECQVEGSEAQQSLGTESSWPSMQNSLSGKDTDAVNSSVDGVDCDSKPGIADVDNCRNSSITGSGGLGTEKHQSQGAEVQEAPEPTITSSSGGSGNSADRGKEAASSGKRRTREGEESECQSEVSNLLQPQGSQVGAVAHRQDGEDEMAQQKKPQQRGSTTKRSRAAEVHNLSERRRRDRINEKMKALQELIPNSNKTDKASMLDEAIEYLKMLQLQLQQMMSMRSGMSIPSMVMPAGMQHLQIPQLPQMGPMPPMGMGMGMGMGMGPMGMGMSMMDMGGGAPGRPMIPLPSHSGPSHSHNVSATSPAVSMVDTHDHRLQNPSVMESLNVFMAQHRQMQMAPQPMSMDAFSAFMIHQHQQQHQQQHQQHQLQHQHQHSLHHLPSSMGGGAPQ

Mapoly0039s0059.8  

Gene structure:

mRNA scaffold_39:781195..786893  ( - strand )
three_prime_UTR scaffold_39:781195..782061  ( - strand )
CDS scaffold_39:782062..782211  ( - strand )
CDS scaffold_39:782354..782725  ( - strand )
CDS scaffold_39:782835..782900  ( - strand )
CDS scaffold_39:783016..783081  ( - strand )
CDS scaffold_39:783274..783375  ( - strand )
CDS scaffold_39:783497..784825  ( - strand )
five_prime_UTR scaffold_39:784826..784880  ( - strand )
five_prime_UTR scaffold_39:785613..785687  ( - strand )
five_prime_UTR scaffold_39:786286..786893  ( - strand )

Sequences:

Gene

>Mapoly0039s0059.8
GCGAGTCGACGGACGGAAAGAAGGAAGGAAGGAAGGAAAGTGGGGCGGGGCGATGAGGGAGGCGAGGAGTACAAGAATGTGGAGTAGTAAGGATATCATTTTGCTGGATGTTGCTGAAGACGATCAAGAGTCGAATTCGAGTGCGAGTCTTTGGTGCTAGAGCGGGAGGGTGGGCGATCCGAGTGCCAGATGTGGACGAGAGAAGCAGCGGAATCGATGGCTGCAGATTCGGGGCCAGTGGGCAGAGGCGGCTCGAGTCTTCCGACGGGAGGATTGAGGAGGGACACGAAGAGCTCTGAGTGATGTGATGCCATTCTGGTAGAGAAAAAGAAGGGATTCTGCTCTTGGGATCGCGCGAGGTCCCTGGGGCCAGCAAGCGCCCAGCTTGCCGAGCGGGCTCTCTGACGTCGAAGGTGCTGCCGCCTCTGTGTGTTTATCCCTGTGTCTCTGTGTTCTAGGCGGTTGTTGGCGGAGGGACGAGGGAGAGGAGTGGCGTTATGTCTGTCTGCTTGACAAGTTGGTACTCCTTGTGGGTCATAAGTTGGGATTTCCTTCCGCCCGTGGCACTGTTTCTGTCGGCGTGAGAAGAGCAAGTTTTCCAGCTCAAGGTTCAGTCCTATCGTTTTTATCTTCGCCTTCCCTCTCCCGCGTGTCTCCATGCATTTGATGACCTTGTCTGTCGGCGACGCTAGCCTCGAGCATCCATGTCAGGCCCACGCCGCTCTAGTGTGTATGTTTGAGTAGACAGCTCTTGTTCTCCCACATAATGAAATGTCCGCGATCACTGAGCCTTGGTAATTTTGATCTCCTTTCTCGCTCACTCTGCCGCAGGAGAGTGTGCAGCTACTTCGTTAAGTGTGCTTGTCCGCACGGTTGACATAACCTCTATGAGATCTTTAGATTCTGAGCGAGATCCTTCTCTTGTGACAGAGCCGTGAGAAAGAGCCGGGGTGGCCTGTTGTATTTCCCGAGGAGATGAATGTACAAACTGCATAAAAACTGCATCTCCTTGATGCTCCGGAATGATGAGGACATGTAAGGAAGCGTTGAGTACACCGACCCAGAAGAATCGTAAATGCATCTGCACTCTGTGTTGTAGAGTTGGGCCCATTTAGTCGACGGCGATAAGTAGCAGATTGACCCGCTTAGCGGCAAGAACCCGTTGTGCCTCTGTTTAAACTGACTGGGTTCGAATTGCTCCTACAGGGACTGGATTTCGAATCGGGAACGGACTGAACACCGGAAGAATCCTCTCCGGTTGTCACTACATCCCCATCAGAGGTGAGTTCAGTGTGGGAAGCCTGTCGAGAGATCGGCGAGCTGGTGATTCTTACTTGCTTTCTGTCTGTGTTTGGAGCGTCTACCTTTCTCGTAATCTACCCATACCTTTCCCGTCACTGAGAAATGAAGAGGCTTTAAAAGTAGGTGAACTTCGAGACTTGGGTGCCATGAGAGTAGATTAGAAGTAGGACGAGCAGGAGACGACTGCAAACTGTCGAAGTCTTCACCTCTCATCTTCTCATTCCCACTGCCATGCCTTACTCACGACCATCCACTACCTCTATGTATGTGGGAGCGCTTCTGGCGAAGCGCTGGGCATTGACAGTGACAGGCCGAGAAGTCGATGCCGTAGCAGTCTAGGTAGGCATTTGATTTACCTCCTCCTGTTTGACTCGCAGACCATGAGTCACCTCGTTCCCGACTGGGATGGTAACGGTGGAGACTTAGAAGCTGTTTTACCCACAAGCGATTTCTCACTGCCGGTTAAGGGAAAGTGGGACTCATTGCCCCATAAAAGGTCGCACTTGTCTGGTTTGGCCTTCGTGTAAGCGCTTGCTCCGGCTTTTCAATCCCCATAGTTTTTTGTGTTCTTGATACCATTGTATGTAAGGTCAATTTCTTGATTGTGGATCTTTGAGAATGCCACTTCGTGATGCCGGCTCGTTGACATGCTGCTCTTCGTCACATGAGCTTCGAAGAGATGTTAAAGGTCGCGTTCTTCTTCTTCTACAGGCCAACCCACGATGCTGGCGAAACTGAGTGGGCAGAGGAAAGTCATATTGTAGCTATGCAGAACCAAAGCGGGAAGGGCAACAAGGCTATGTGGCAGCAGATGAATTTCCAGAATGGGTGGTCGAGTGTGCCAGAGTCTGAGGATGCCGTTACTCCTGTGAAGCCCATCAGCTCGTCGTCTCCGGGGAAGGAGCCGGTTCTTGTCAATGAGCCCGCGGTCGACACGCACCACTCCAGTGCCCTCAACATGCAGGAAGACGAGATGGTGTGCTGGCTGCAGTATCCGTTGGACGAACACCTCGAAAGAGACTACTGTTCCGAGTTCTTCGGCGAGCTGCCCAACTCCAACATATCGAACATGCAGCTGATGAAGGATTCATTCGCAGGGCAAAATCAAGTAGCGGGGCGCAACAACAGGAATCCAGGTCCCGTTAACGTAGGGAGTAACAGCAGAATGTCTAGTGCGGATGCGGCGATGGCCATGGGAGCGGGGCGAGCTGCCGGTTTGTTGCCTCAGACAGGGGTGGAGGTTTTCACCAAAGTTCGGACCACTTTGCAACCCTACGGAGGAAAGTGGTCCCCAAATCAGAACAACGCCGGGAAAACGCTGGGAGCGATGACCTCGACCCTGGCTCCGAGCCCGTCAAGATCCCCGCCGATGTCTGGGAACTTGTCGACCCCCATGCTCCCCCCGAAGTCTCAGGGACTCAGCTTCCAGCCTCCCAGAACCTCAGGCCCGATGAATTTCTCGCATTTCTCTCGCCCTGCGGCTGTGATGAAGGCCAATCTCCAGTGCCTAGGAATGTCTCACGTGGCCCCTCCGCACGGGAGCGGGACGAACGTCCGGCTCAAGAGCCAACCCTACAGCGGGAAGCCACCCGTCGACGCAAGCACGTCGACGGGGTCCTCCATTGCAGAGTCAACCACCACGAGGCAACGCAGCGGCGCTTTCCGCAAGGATACCGAATGCCAAGTCGAAGGTTCCGAAGCTCAACAGAGTCTTGGAACCGAATCGAGCTGGCCTTCGATGCAGAATTCGCTGTCGGGCAAGGACACCGACGCTGTCAATTCCTCCGTGGATGGTGTGGACTGCGATTCGAAGCCCGGTATAGCGGATGTGGACAATTGCAGGAATTCTAGCATCACAGGTAGTGGCGGTTTAGGAACTGAAAAGCATCAGTCTCAAGGAGCAGAAGTGCAGGAAGCTCCCGAACCCACCATTACCTCGTCTTCTGGTGGGTCCGGTAATAGTGCAGATAGAGGGAAAGAGGCCGCATCTAGTGGCAAGAGAAGAACCAGGGAAGGAGAGGAGTCCGAGTGCCAGAGCGAAGTGAGTAACTTGTTGCAACCCCAAGGGAGTCAAGTTGGTGCAGTAGCCCACAGGGTATGTTTTATCTAGTGATGCTAACTTTTTCCTGAATAACATCCCACTGACTGCTCTTTTTATGCGAGGATGTGTGAGAAGTGTACTTGCGTTTAATAAAAGCCAATGTTGTTTCTGGCAGCAAGATGGCGAGGACGAGATGGCCCAGCAAAAGAAACCTCAACAGAGAGGCTCCACCACTAAGAGGAGCAGGGCCGCGGAAGTCCACAACCTTTCCGAGCGAGTGAGAGTCCACCACTAACTGAGAAATTGAGCTCTGCGCCAATTGTACAGGATGGTCCAAGCCGTGAGCATATGACGGCAGTGGACAATCTAGGTCTCAAATCTTGTTTGGGTCGTCAATTTTGTGACTGATGTTAGTTTTGAAGCTCTTGGCTTCCGCAGCTTTACTGATAGAATTTCCTGCCCATTTCAGAGGCGAAGAGATCGTATCAACGAGAAGATGAAAGCTCTGCAAGAGCTGATCCCCAATTCCAACAAGGTTTGTTACAGCTTTCAGCCTTGTTCTTCGTACCTTGCCTCTTCTTTTGGATCACCGTGCGGTAACTTGCCCTTGAAATACAGTCAATGATGCAGACTTTTGATTCATATTGCAGACGGACAAAGCATCGATGCTGGATGAAGCGATCGAGTACTTGAAGATGCTCCAGTTGCAACTGCAGGTAACTATCCCAGCCTTTGACCTTCGCAGTAGTTCTCTGCTCCTCCTTGCGATGCAGGTGCTGTAGAGACGCCCGAGCACAAATACTGAATTCAATTTGCCCTCTTTAGCAGATGATGTCCATGAGAAGTGGAATGAGCATCCCCTCTATGGTGATGCCGGCGGGAATGCAACACCTTCAAATCCCGCAATTGCCCCAAATGGGCCCAATGCCTCCCATGGGAATGGGAATGGGCATGGGTATGGGCATGGGCCCGATGGGAATGGGAATGAGTATGATGGACATGGGAGGCGGAGCTCCCGGTCGACCGATGATACCCCTTCCGTCTCACAGTGGGCCTTCTCACTCTCACAACGTATCTGCAACCTCACCAGCTGTTTCTATGGTAGACACTCATGACCACCGCCTGCAAAACCCGAGCGTCATGGAGTCACTGAACGTCTTCATGGCGCAACACCGGCAAATGCAAATGGCTCCTCAGGTGATCCTTCTCTTTGAATGCCGGCTGGTTCTGTCCGATCTTCTGTCAGCTTTGTTTTTTGTGCAAATTTCCTAGGAGGAAGGAGCATGTGGTTGGGAGACGATGAAGTCTTGATTCTTACTCACTGTGCCTGTTCTTGCAGCCGATGAGTATGGATGCATTCAGTGCATTCATGATTCATCAGCACCAGCAGCAACACCAGCAGCAGCATCAACAACATCAGCTCCAACACCAACACCAGCATTCGCTCCATCATCTTCCGAGCAGCATGGGCGGTGGAGCCCCCCAATGAAGAGCGGGCCAAATTCTCGGTGGATCTTGATTTCCACGCTTGCTTTCCATTTGTCATGCCATTTCGCATTGGAGGCCAGCGATCTGTCAACAACTATCTGCTGTTCCGCTCTCGGAGAGCGTAATATACTCAGCTGCAGGCGTGGCTGTGAGTCTGACAGCCATCGTCGGGCATCAGGACACGATACAGCTGAAGGTGAAGGCGAAGGCCGATGGAGGTGTGGTCCGGTGCATCATTGGTTTCCACCTCTTAGTTTTGTAGTCTAGTTGGGGGATATGTAAACATCATGATCTCAGGTTGGAAAGTATGATTCTACTAGGACCGGATCTTGTGTAGGTGCCTTCAACCAGGCCGCAGCAGTGTTGAAGGCGTGTATTAGAACGCAGAATTGGATGATATGTATCAAGAAGGTCCTCGCTGCCCTCGCATTAGCGGCGTGCTGCGGTGCCATGCGGGGCCAGGGTCAGGGCCAGGGCGTTTCGCCTCTGTACTTTTATCAGCAAGCATAATTGCATCTTCTAACTAGCCTTAGCGAGGCGAGGTTTTGAGGATTAGTAGTTTTAGAAGAAGGAAGTGTCCGTAGTGCTGTCATTCCAGGGCCGGACCTTCTTCAATTGTTGCGGATCGGGATACTATGGCGCCGAAGTTTGCGCTCCGGCTTACGCTGTTCTCGTTGTGGATTTGGAGGGAACTCGTGTTGCCGGAAGCAGATTTCTAGTCGAAAGCCTGCCGCCCGAAATGTGCCATGTTTAATTGTCGATAAGGTTCAAGTTAAATGTTGGATTACATTCATTGTTCTCCGTTGGCTCAAGGCGAGCCACTTGTAAAAAGAAATGCCAAGTTTACCAACTTGAGACTCCTTGCACG

mRNA

>Mapoly0039s0059.8
GCGAGTCGACGGACGGAAAGAAGGAAGGAAGGAAGGAAAGTGGGGCGGGGCGATGAGGGAGGCGAGGAGTACAAGAATGTGGAGTAGTAAGGATATCATTTTGCTGGATGTTGCTGAAGACGATCAAGAGTCGAATTCGAGTGCGAGTCTTTGGTGCTAGAGCGGGAGGGTGGGCGATCCGAGTGCCAGATGTGGACGAGAGAAGCAGCGGAATCGATGGCTGCAGATTCGGGGCCAGTGGGCAGAGGCGGCTCGAGTCTTCCGACGGGAGGATTGAGGAGGGACACGAAGAGCTCTGAGTGATGTGATGCCATTCTGGTAGAGAAAAAGAAGGGATTCTGCTCTTGGGATCGCGCGAGGTCCCTGGGGCCAGCAAGCGCCCAGCTTGCCGAGCGGGCTCTCTGACGTCGAAGGTGCTGCCGCCTCTGTGTGTTTATCCCTGTGTCTCTGTGTTCTAGGCGGTTGTTGGCGGAGGGACGAGGGAGAGGAGTGGCGTTATGTCTGTCTGCTTGACAAGTTGGTACTCCTTGTGGGTCATAAGTTGGGATTTCCTTCCGCCCGTGGCACTGTTTCTGTCGGCGTGAGAAGAGCAAGTTTTCCAGCTCAAGGGACTGGATTTCGAATCGGGAACGGACTGAACACCGGAAGAATCCTCTCCGGTTGTCACTACATCCCCATCAGAGGCCAACCCACGATGCTGGCGAAACTGAGTGGGCAGAGGAAAGTCATATTGTAGCTATGCAGAACCAAAGCGGGAAGGGCAACAAGGCTATGTGGCAGCAGATGAATTTCCAGAATGGGTGGTCGAGTGTGCCAGAGTCTGAGGATGCCGTTACTCCTGTGAAGCCCATCAGCTCGTCGTCTCCGGGGAAGGAGCCGGTTCTTGTCAATGAGCCCGCGGTCGACACGCACCACTCCAGTGCCCTCAACATGCAGGAAGACGAGATGGTGTGCTGGCTGCAGTATCCGTTGGACGAACACCTCGAAAGAGACTACTGTTCCGAGTTCTTCGGCGAGCTGCCCAACTCCAACATATCGAACATGCAGCTGATGAAGGATTCATTCGCAGGGCAAAATCAAGTAGCGGGGCGCAACAACAGGAATCCAGGTCCCGTTAACGTAGGGAGTAACAGCAGAATGTCTAGTGCGGATGCGGCGATGGCCATGGGAGCGGGGCGAGCTGCCGGTTTGTTGCCTCAGACAGGGGTGGAGGTTTTCACCAAAGTTCGGACCACTTTGCAACCCTACGGAGGAAAGTGGTCCCCAAATCAGAACAACGCCGGGAAAACGCTGGGAGCGATGACCTCGACCCTGGCTCCGAGCCCGTCAAGATCCCCGCCGATGTCTGGGAACTTGTCGACCCCCATGCTCCCCCCGAAGTCTCAGGGACTCAGCTTCCAGCCTCCCAGAACCTCAGGCCCGATGAATTTCTCGCATTTCTCTCGCCCTGCGGCTGTGATGAAGGCCAATCTCCAGTGCCTAGGAATGTCTCACGTGGCCCCTCCGCACGGGAGCGGGACGAACGTCCGGCTCAAGAGCCAACCCTACAGCGGGAAGCCACCCGTCGACGCAAGCACGTCGACGGGGTCCTCCATTGCAGAGTCAACCACCACGAGGCAACGCAGCGGCGCTTTCCGCAAGGATACCGAATGCCAAGTCGAAGGTTCCGAAGCTCAACAGAGTCTTGGAACCGAATCGAGCTGGCCTTCGATGCAGAATTCGCTGTCGGGCAAGGACACCGACGCTGTCAATTCCTCCGTGGATGGTGTGGACTGCGATTCGAAGCCCGGTATAGCGGATGTGGACAATTGCAGGAATTCTAGCATCACAGGTAGTGGCGGTTTAGGAACTGAAAAGCATCAGTCTCAAGGAGCAGAAGTGCAGGAAGCTCCCGAACCCACCATTACCTCGTCTTCTGGTGGGTCCGGTAATAGTGCAGATAGAGGGAAAGAGGCCGCATCTAGTGGCAAGAGAAGAACCAGGGAAGGAGAGGAGTCCGAGTGCCAGAGCGAAGTGAGTAACTTGTTGCAACCCCAAGGGAGTCAAGTTGGTGCAGTAGCCCACAGGCAAGATGGCGAGGACGAGATGGCCCAGCAAAAGAAACCTCAACAGAGAGGCTCCACCACTAAGAGGAGCAGGGCCGCGGAAGTCCACAACCTTTCCGAGCGAAGGCGAAGAGATCGTATCAACGAGAAGATGAAAGCTCTGCAAGAGCTGATCCCCAATTCCAACAAGACGGACAAAGCATCGATGCTGGATGAAGCGATCGAGTACTTGAAGATGCTCCAGTTGCAACTGCAGCAGATGATGTCCATGAGAAGTGGAATGAGCATCCCCTCTATGGTGATGCCGGCGGGAATGCAACACCTTCAAATCCCGCAATTGCCCCAAATGGGCCCAATGCCTCCCATGGGAATGGGAATGGGCATGGGTATGGGCATGGGCCCGATGGGAATGGGAATGAGTATGATGGACATGGGAGGCGGAGCTCCCGGTCGACCGATGATACCCCTTCCGTCTCACAGTGGGCCTTCTCACTCTCACAACGTATCTGCAACCTCACCAGCTGTTTCTATGGTAGACACTCATGACCACCGCCTGCAAAACCCGAGCGTCATGGAGTCACTGAACGTCTTCATGGCGCAACACCGGCAAATGCAAATGGCTCCTCAGCCGATGAGTATGGATGCATTCAGTGCATTCATGATTCATCAGCACCAGCAGCAACACCAGCAGCAGCATCAACAACATCAGCTCCAACACCAACACCAGCATTCGCTCCATCATCTTCCGAGCAGCATGGGCGGTGGAGCCCCCCAATGAAGAGCGGGCCAAATTCTCGGTGGATCTTGATTTCCACGCTTGCTTTCCATTTGTCATGCCATTTCGCATTGGAGGCCAGCGATCTGTCAACAACTATCTGCTGTTCCGCTCTCGGAGAGCGTAATATACTCAGCTGCAGGCGTGGCTGTGAGTCTGACAGCCATCGTCGGGCATCAGGACACGATACAGCTGAAGGTGAAGGCGAAGGCCGATGGAGGTGTGGTCCGGTGCATCATTGGTTTCCACCTCTTAGTTTTGTAGTCTAGTTGGGGGATATGTAAACATCATGATCTCAGGTTGGAAAGTATGATTCTACTAGGACCGGATCTTGTGTAGGTGCCTTCAACCAGGCCGCAGCAGTGTTGAAGGCGTGTATTAGAACGCAGAATTGGATGATATGTATCAAGAAGGTCCTCGCTGCCCTCGCATTAGCGGCGTGCTGCGGTGCCATGCGGGGCCAGGGTCAGGGCCAGGGCGTTTCGCCTCTGTACTTTTATCAGCAAGCATAATTGCATCTTCTAACTAGCCTTAGCGAGGCGAGGTTTTGAGGATTAGTAGTTTTAGAAGAAGGAAGTGTCCGTAGTGCTGTCATTCCAGGGCCGGACCTTCTTCAATTGTTGCGGATCGGGATACTATGGCGCCGAAGTTTGCGCTCCGGCTTACGCTGTTCTCGTTGTGGATTTGGAGGGAACTCGTGTTGCCGGAAGCAGATTTCTAGTCGAAAGCCTGCCGCCCGAAATGTGCCATGTTTAATTGTCGATAAGGTTCAAGTTAAATGTTGGATTACATTCATTGTTCTCCGTTGGCTCAAGGCGAGCCACTTGTAAAAAGAAATGCCAAGTTTACCAACTTGAGACTCCTTGCACG

CDS

>Mapoly0039s0059.8
ATGCAGAACCAAAGCGGGAAGGGCAACAAGGCTATGTGGCAGCAGATGAATTTCCAGAATGGGTGGTCGAGTGTGCCAGAGTCTGAGGATGCCGTTACTCCTGTGAAGCCCATCAGCTCGTCGTCTCCGGGGAAGGAGCCGGTTCTTGTCAATGAGCCCGCGGTCGACACGCACCACTCCAGTGCCCTCAACATGCAGGAAGACGAGATGGTGTGCTGGCTGCAGTATCCGTTGGACGAACACCTCGAAAGAGACTACTGTTCCGAGTTCTTCGGCGAGCTGCCCAACTCCAACATATCGAACATGCAGCTGATGAAGGATTCATTCGCAGGGCAAAATCAAGTAGCGGGGCGCAACAACAGGAATCCAGGTCCCGTTAACGTAGGGAGTAACAGCAGAATGTCTAGTGCGGATGCGGCGATGGCCATGGGAGCGGGGCGAGCTGCCGGTTTGTTGCCTCAGACAGGGGTGGAGGTTTTCACCAAAGTTCGGACCACTTTGCAACCCTACGGAGGAAAGTGGTCCCCAAATCAGAACAACGCCGGGAAAACGCTGGGAGCGATGACCTCGACCCTGGCTCCGAGCCCGTCAAGATCCCCGCCGATGTCTGGGAACTTGTCGACCCCCATGCTCCCCCCGAAGTCTCAGGGACTCAGCTTCCAGCCTCCCAGAACCTCAGGCCCGATGAATTTCTCGCATTTCTCTCGCCCTGCGGCTGTGATGAAGGCCAATCTCCAGTGCCTAGGAATGTCTCACGTGGCCCCTCCGCACGGGAGCGGGACGAACGTCCGGCTCAAGAGCCAACCCTACAGCGGGAAGCCACCCGTCGACGCAAGCACGTCGACGGGGTCCTCCATTGCAGAGTCAACCACCACGAGGCAACGCAGCGGCGCTTTCCGCAAGGATACCGAATGCCAAGTCGAAGGTTCCGAAGCTCAACAGAGTCTTGGAACCGAATCGAGCTGGCCTTCGATGCAGAATTCGCTGTCGGGCAAGGACACCGACGCTGTCAATTCCTCCGTGGATGGTGTGGACTGCGATTCGAAGCCCGGTATAGCGGATGTGGACAATTGCAGGAATTCTAGCATCACAGGTAGTGGCGGTTTAGGAACTGAAAAGCATCAGTCTCAAGGAGCAGAAGTGCAGGAAGCTCCCGAACCCACCATTACCTCGTCTTCTGGTGGGTCCGGTAATAGTGCAGATAGAGGGAAAGAGGCCGCATCTAGTGGCAAGAGAAGAACCAGGGAAGGAGAGGAGTCCGAGTGCCAGAGCGAAGTGAGTAACTTGTTGCAACCCCAAGGGAGTCAAGTTGGTGCAGTAGCCCACAGGCAAGATGGCGAGGACGAGATGGCCCAGCAAAAGAAACCTCAACAGAGAGGCTCCACCACTAAGAGGAGCAGGGCCGCGGAAGTCCACAACCTTTCCGAGCGAAGGCGAAGAGATCGTATCAACGAGAAGATGAAAGCTCTGCAAGAGCTGATCCCCAATTCCAACAAGACGGACAAAGCATCGATGCTGGATGAAGCGATCGAGTACTTGAAGATGCTCCAGTTGCAACTGCAGCAGATGATGTCCATGAGAAGTGGAATGAGCATCCCCTCTATGGTGATGCCGGCGGGAATGCAACACCTTCAAATCCCGCAATTGCCCCAAATGGGCCCAATGCCTCCCATGGGAATGGGAATGGGCATGGGTATGGGCATGGGCCCGATGGGAATGGGAATGAGTATGATGGACATGGGAGGCGGAGCTCCCGGTCGACCGATGATACCCCTTCCGTCTCACAGTGGGCCTTCTCACTCTCACAACGTATCTGCAACCTCACCAGCTGTTTCTATGGTAGACACTCATGACCACCGCCTGCAAAACCCGAGCGTCATGGAGTCACTGAACGTCTTCATGGCGCAACACCGGCAAATGCAAATGGCTCCTCAGCCGATGAGTATGGATGCATTCAGTGCATTCATGATTCATCAGCACCAGCAGCAACACCAGCAGCAGCATCAACAACATCAGCTCCAACACCAACACCAGCATTCGCTCCATCATCTTCCGAGCAGCATGGGCGGTGGAGCCCCCCAATGA

Protein

>Mapoly0039s0059.8
MQNQSGKGNKAMWQQMNFQNGWSSVPESEDAVTPVKPISSSSPGKEPVLVNEPAVDTHHSSALNMQEDEMVCWLQYPLDEHLERDYCSEFFGELPNSNISNMQLMKDSFAGQNQVAGRNNRNPGPVNVGSNSRMSSADAAMAMGAGRAAGLLPQTGVEVFTKVRTTLQPYGGKWSPNQNNAGKTLGAMTSTLAPSPSRSPPMSGNLSTPMLPPKSQGLSFQPPRTSGPMNFSHFSRPAAVMKANLQCLGMSHVAPPHGSGTNVRLKSQPYSGKPPVDASTSTGSSIAESTTTRQRSGAFRKDTECQVEGSEAQQSLGTESSWPSMQNSLSGKDTDAVNSSVDGVDCDSKPGIADVDNCRNSSITGSGGLGTEKHQSQGAEVQEAPEPTITSSSGGSGNSADRGKEAASSGKRRTREGEESECQSEVSNLLQPQGSQVGAVAHRQDGEDEMAQQKKPQQRGSTTKRSRAAEVHNLSERRRRDRINEKMKALQELIPNSNKTDKASMLDEAIEYLKMLQLQLQQMMSMRSGMSIPSMVMPAGMQHLQIPQLPQMGPMPPMGMGMGMGMGMGPMGMGMSMMDMGGGAPGRPMIPLPSHSGPSHSHNVSATSPAVSMVDTHDHRLQNPSVMESLNVFMAQHRQMQMAPQPMSMDAFSAFMIHQHQQQHQQQHQQHQLQHQHQHSLHHLPSSMGGGAPQ

Mapoly0039s0059.9  

Gene structure:

mRNA scaffold_39:781195..786893  ( - strand )
three_prime_UTR scaffold_39:781195..782061  ( - strand )
CDS scaffold_39:782062..782211  ( - strand )
CDS scaffold_39:782354..782722  ( - strand )
CDS scaffold_39:782835..782900  ( - strand )
CDS scaffold_39:783016..783081  ( - strand )
CDS scaffold_39:783274..783375  ( - strand )
CDS scaffold_39:783551..784880  ( - strand )
CDS scaffold_39:785069..785211  ( - strand )
five_prime_UTR scaffold_39:785212..785214  ( - strand )
five_prime_UTR scaffold_39:785613..785687  ( - strand )
five_prime_UTR scaffold_39:786286..786893  ( - strand )

Sequences:

Gene

>Mapoly0039s0059.9
GCGAGTCGACGGACGGAAAGAAGGAAGGAAGGAAGGAAAGTGGGGCGGGGCGATGAGGGAGGCGAGGAGTACAAGAATGTGGAGTAGTAAGGATATCATTTTGCTGGATGTTGCTGAAGACGATCAAGAGTCGAATTCGAGTGCGAGTCTTTGGTGCTAGAGCGGGAGGGTGGGCGATCCGAGTGCCAGATGTGGACGAGAGAAGCAGCGGAATCGATGGCTGCAGATTCGGGGCCAGTGGGCAGAGGCGGCTCGAGTCTTCCGACGGGAGGATTGAGGAGGGACACGAAGAGCTCTGAGTGATGTGATGCCATTCTGGTAGAGAAAAAGAAGGGATTCTGCTCTTGGGATCGCGCGAGGTCCCTGGGGCCAGCAAGCGCCCAGCTTGCCGAGCGGGCTCTCTGACGTCGAAGGTGCTGCCGCCTCTGTGTGTTTATCCCTGTGTCTCTGTGTTCTAGGCGGTTGTTGGCGGAGGGACGAGGGAGAGGAGTGGCGTTATGTCTGTCTGCTTGACAAGTTGGTACTCCTTGTGGGTCATAAGTTGGGATTTCCTTCCGCCCGTGGCACTGTTTCTGTCGGCGTGAGAAGAGCAAGTTTTCCAGCTCAAGGTTCAGTCCTATCGTTTTTATCTTCGCCTTCCCTCTCCCGCGTGTCTCCATGCATTTGATGACCTTGTCTGTCGGCGACGCTAGCCTCGAGCATCCATGTCAGGCCCACGCCGCTCTAGTGTGTATGTTTGAGTAGACAGCTCTTGTTCTCCCACATAATGAAATGTCCGCGATCACTGAGCCTTGGTAATTTTGATCTCCTTTCTCGCTCACTCTGCCGCAGGAGAGTGTGCAGCTACTTCGTTAAGTGTGCTTGTCCGCACGGTTGACATAACCTCTATGAGATCTTTAGATTCTGAGCGAGATCCTTCTCTTGTGACAGAGCCGTGAGAAAGAGCCGGGGTGGCCTGTTGTATTTCCCGAGGAGATGAATGTACAAACTGCATAAAAACTGCATCTCCTTGATGCTCCGGAATGATGAGGACATGTAAGGAAGCGTTGAGTACACCGACCCAGAAGAATCGTAAATGCATCTGCACTCTGTGTTGTAGAGTTGGGCCCATTTAGTCGACGGCGATAAGTAGCAGATTGACCCGCTTAGCGGCAAGAACCCGTTGTGCCTCTGTTTAAACTGACTGGGTTCGAATTGCTCCTACAGGGACTGGATTTCGAATCGGGAACGGACTGAACACCGGAAGAATCCTCTCCGGTTGTCACTACATCCCCATCAGAGGTGAGTTCAGTGTGGGAAGCCTGTCGAGAGATCGGCGAGCTGGTGATTCTTACTTGCTTTCTGTCTGTGTTTGGAGCGTCTACCTTTCTCGTAATCTACCCATACCTTTCCCGTCACTGAGAAATGAAGAGGCTTTAAAAGTAGGTGAACTTCGAGACTTGGGTGCCATGAGAGTAGATTAGAAGTAGGACGAGCAGGAGACGACTGCAAACTGTCGAAGTCTTCACCTCTCATCTTCTCATTCCCACTGCCATGCCTTACTCACGACCATCCACTACCTCTATGTATGTGGGAGCGCTTCTGGCGAAGCGCTGGGCATTGACAGTGACAGGCCGAGAAGTCGATGCCGTAGCAGTCTAGGTAGGCATTTGATTTACCTCCTCCTGTTTGACTCGCAGACCATGAGTCACCTCGTTCCCGACTGGGATGGTAACGGTGGAGACTTAGAAGCTGTTTTACCCACAAGCGATTTCTCACTGCCGGTTAAGGGAAAGTGGGACTCATTGCCCCATAAAAGGTCGCACTTGTCTGGTTTGGCCTTCGTGTAAGCGCTTGCTCCGGCTTTTCAATCCCCATAGTTTTTTGTGTTCTTGATACCATTGTATGTAAGGTCAATTTCTTGATTGTGGATCTTTGAGAATGCCACTTCGTGATGCCGGCTCGTTGACATGCTGCTCTTCGTCACATGAGCTTCGAAGAGATGTTAAAGGTCGCGTTCTTCTTCTTCTACAGGCCAACCCACGATGCTGGCGAAACTGAGTGGGCAGAGGAAAGTCATATTGTAGCTATGCAGAACCAAAGCGGGAAGGGCAACAAGGCTATGTGGCAGCAGATGAATTTCCAGAATGGGTGGTCGAGTGTGCCAGAGTCTGAGGATGCCGTTACTCCTGTGAAGCCCATCAGCTCGTCGTCTCCGGGGAAGGAGCCGGTTCTTGTCAATGAGCCCGCGGTCGACACGCACCACTCCAGTGCCCTCAACATGCAGGAAGACGAGATGGTGTGCTGGCTGCAGTATCCGTTGGACGAACACCTCGAAAGAGACTACTGTTCCGAGTTCTTCGGCGAGCTGCCCAACTCCAACATATCGAACATGCAGCTGATGAAGGATTCATTCGCAGGGCAAAATCAAGTAGCGGGGCGCAACAACAGGAATCCAGGTCCCGTTAACGTAGGGAGTAACAGCAGAATGTCTAGTGCGGATGCGGCGATGGCCATGGGAGCGGGGCGAGCTGCCGGTTTGTTGCCTCAGACAGGGGTGGAGGTTTTCACCAAAGTTCGGACCACTTTGCAACCCTACGGAGGAAAGTGGTCCCCAAATCAGAACAACGCCGGGAAAACGCTGGGAGCGATGACCTCGACCCTGGCTCCGAGCCCGTCAAGATCCCCGCCGATGTCTGGGAACTTGTCGACCCCCATGCTCCCCCCGAAGTCTCAGGGACTCAGCTTCCAGCCTCCCAGAACCTCAGGCCCGATGAATTTCTCGCATTTCTCTCGCCCTGCGGCTGTGATGAAGGCCAATCTCCAGTGCCTAGGAATGTCTCACGTGGCCCCTCCGCACGGGAGCGGGACGAACGTCCGGCTCAAGAGCCAACCCTACAGCGGGAAGCCACCCGTCGACGCAAGCACGTCGACGGGGTCCTCCATTGCAGAGTCAACCACCACGAGGCAACGCAGCGGCGCTTTCCGCAAGGATACCGAATGCCAAGTCGAAGGTTCCGAAGCTCAACAGAGTCTTGGAACCGAATCGAGCTGGCCTTCGATGCAGAATTCGCTGTCGGGCAAGGACACCGACGCTGTCAATTCCTCCGTGGATGGTGTGGACTGCGATTCGAAGCCCGGTATAGCGGATGTGGACAATTGCAGGAATTCTAGCATCACAGGTAGTGGCGGTTTAGGAACTGAAAAGCATCAGTCTCAAGGAGCAGAAGTGCAGGAAGCTCCCGAACCCACCATTACCTCGTCTTCTGGTGGGTCCGGTAATAGTGCAGATAGAGGGAAAGAGGCCGCATCTAGTGGCAAGAGAAGAACCAGGGAAGGAGAGGAGTCCGAGTGCCAGAGCGAAGTGAGTAACTTGTTGCAACCCCAAGGGAGTCAAGTTGGTGCAGTAGCCCACAGGGTATGTTTTATCTAGTGATGCTAACTTTTTCCTGAATAACATCCCACTGACTGCTCTTTTTATGCGAGGATGTGTGAGAAGTGTACTTGCGTTTAATAAAAGCCAATGTTGTTTCTGGCAGCAAGATGGCGAGGACGAGATGGCCCAGCAAAAGAAACCTCAACAGAGAGGCTCCACCACTAAGAGGAGCAGGGCCGCGGAAGTCCACAACCTTTCCGAGCGAGTGAGAGTCCACCACTAACTGAGAAATTGAGCTCTGCGCCAATTGTACAGGATGGTCCAAGCCGTGAGCATATGACGGCAGTGGACAATCTAGGTCTCAAATCTTGTTTGGGTCGTCAATTTTGTGACTGATGTTAGTTTTGAAGCTCTTGGCTTCCGCAGCTTTACTGATAGAATTTCCTGCCCATTTCAGAGGCGAAGAGATCGTATCAACGAGAAGATGAAAGCTCTGCAAGAGCTGATCCCCAATTCCAACAAGGTTTGTTACAGCTTTCAGCCTTGTTCTTCGTACCTTGCCTCTTCTTTTGGATCACCGTGCGGTAACTTGCCCTTGAAATACAGTCAATGATGCAGACTTTTGATTCATATTGCAGACGGACAAAGCATCGATGCTGGATGAAGCGATCGAGTACTTGAAGATGCTCCAGTTGCAACTGCAGGTAACTATCCCAGCCTTTGACCTTCGCAGTAGTTCTCTGCTCCTCCTTGCGATGCAGGTGCTGTAGAGACGCCCGAGCACAAATACTGAATTCAATTTGCCCTCTTTAGCAGATGATGTCCATGAGAAGTGGAATGAGCATCCCCTCTATGGTGATGCCGGCGGGAATGCAACACCTTCAAATCCCGCAATTGCCCCAAATGGGCCCAATGCCTCCCATGGGAATGGGAATGGGCATGGGTATGGGCATGGGCCCGATGGGAATGGGAATGAGTATGATGGACATGGGAGGCGGAGCTCCCGGTCGACCGATGATACCCCTTCCGTCTCACAGTGGGCCTTCTCACTCTCACAACGTATCTGCAACCTCACCAGCTGTTTCTATGGTAGACACTCATGACCACCGCCTGCAAAACCCGAGCGTCATGGAGTCACTGAACGTCTTCATGGCGCAACACCGGCAAATGCAAATGGCTCCTCAGGTGATCCTTCTCTTTGAATGCCGGCTGGTTCTGTCCGATCTTCTGTCAGCTTTGTTTTTTGTGCAAATTTCCTAGGAGGAAGGAGCATGTGGTTGGGAGACGATGAAGTCTTGATTCTTACTCACTGTGCCTGTTCTTGCAGCCGATGAGTATGGATGCATTCAGTGCATTCATGATTCATCAGCACCAGCAGCAACACCAGCAGCAGCATCAACAACATCAGCTCCAACACCAACACCAGCATTCGCTCCATCATCTTCCGAGCAGCATGGGCGGTGGAGCCCCCCAATGAAGAGCGGGCCAAATTCTCGGTGGATCTTGATTTCCACGCTTGCTTTCCATTTGTCATGCCATTTCGCATTGGAGGCCAGCGATCTGTCAACAACTATCTGCTGTTCCGCTCTCGGAGAGCGTAATATACTCAGCTGCAGGCGTGGCTGTGAGTCTGACAGCCATCGTCGGGCATCAGGACACGATACAGCTGAAGGTGAAGGCGAAGGCCGATGGAGGTGTGGTCCGGTGCATCATTGGTTTCCACCTCTTAGTTTTGTAGTCTAGTTGGGGGATATGTAAACATCATGATCTCAGGTTGGAAAGTATGATTCTACTAGGACCGGATCTTGTGTAGGTGCCTTCAACCAGGCCGCAGCAGTGTTGAAGGCGTGTATTAGAACGCAGAATTGGATGATATGTATCAAGAAGGTCCTCGCTGCCCTCGCATTAGCGGCGTGCTGCGGTGCCATGCGGGGCCAGGGTCAGGGCCAGGGCGTTTCGCCTCTGTACTTTTATCAGCAAGCATAATTGCATCTTCTAACTAGCCTTAGCGAGGCGAGGTTTTGAGGATTAGTAGTTTTAGAAGAAGGAAGTGTCCGTAGTGCTGTCATTCCAGGGCCGGACCTTCTTCAATTGTTGCGGATCGGGATACTATGGCGCCGAAGTTTGCGCTCCGGCTTACGCTGTTCTCGTTGTGGATTTGGAGGGAACTCGTGTTGCCGGAAGCAGATTTCTAGTCGAAAGCCTGCCGCCCGAAATGTGCCATGTTTAATTGTCGATAAGGTTCAAGTTAAATGTTGGATTACATTCATTGTTCTCCGTTGGCTCAAGGCGAGCCACTTGTAAAAAGAAATGCCAAGTTTACCAACTTGAGACTCCTTGCACG

mRNA

>Mapoly0039s0059.9
GCGAGTCGACGGACGGAAAGAAGGAAGGAAGGAAGGAAAGTGGGGCGGGGCGATGAGGGAGGCGAGGAGTACAAGAATGTGGAGTAGTAAGGATATCATTTTGCTGGATGTTGCTGAAGACGATCAAGAGTCGAATTCGAGTGCGAGTCTTTGGTGCTAGAGCGGGAGGGTGGGCGATCCGAGTGCCAGATGTGGACGAGAGAAGCAGCGGAATCGATGGCTGCAGATTCGGGGCCAGTGGGCAGAGGCGGCTCGAGTCTTCCGACGGGAGGATTGAGGAGGGACACGAAGAGCTCTGAGTGATGTGATGCCATTCTGGTAGAGAAAAAGAAGGGATTCTGCTCTTGGGATCGCGCGAGGTCCCTGGGGCCAGCAAGCGCCCAGCTTGCCGAGCGGGCTCTCTGACGTCGAAGGTGCTGCCGCCTCTGTGTGTTTATCCCTGTGTCTCTGTGTTCTAGGCGGTTGTTGGCGGAGGGACGAGGGAGAGGAGTGGCGTTATGTCTGTCTGCTTGACAAGTTGGTACTCCTTGTGGGTCATAAGTTGGGATTTCCTTCCGCCCGTGGCACTGTTTCTGTCGGCGTGAGAAGAGCAAGTTTTCCAGCTCAAGGGACTGGATTTCGAATCGGGAACGGACTGAACACCGGAAGAATCCTCTCCGGTTGTCACTACATCCCCATCAGAGACCATGAGTCACCTCGTTCCCGACTGGGATGGTAACGGTGGAGACTTAGAAGCTGTTTTACCCACAAGCGATTTCTCACTGCCGGTTAAGGGAAAGTGGGACTCATTGCCCCATAAAAGGTCGCACTTGTCTGGTTTGGCCTTCGTGCCAACCCACGATGCTGGCGAAACTGAGTGGGCAGAGGAAAGTCATATTGTAGCTATGCAGAACCAAAGCGGGAAGGGCAACAAGGCTATGTGGCAGCAGATGAATTTCCAGAATGGGTGGTCGAGTGTGCCAGAGTCTGAGGATGCCGTTACTCCTGTGAAGCCCATCAGCTCGTCGTCTCCGGGGAAGGAGCCGGTTCTTGTCAATGAGCCCGCGGTCGACACGCACCACTCCAGTGCCCTCAACATGCAGGAAGACGAGATGGTGTGCTGGCTGCAGTATCCGTTGGACGAACACCTCGAAAGAGACTACTGTTCCGAGTTCTTCGGCGAGCTGCCCAACTCCAACATATCGAACATGCAGCTGATGAAGGATTCATTCGCAGGGCAAAATCAAGTAGCGGGGCGCAACAACAGGAATCCAGGTCCCGTTAACGTAGGGAGTAACAGCAGAATGTCTAGTGCGGATGCGGCGATGGCCATGGGAGCGGGGCGAGCTGCCGGTTTGTTGCCTCAGACAGGGGTGGAGGTTTTCACCAAAGTTCGGACCACTTTGCAACCCTACGGAGGAAAGTGGTCCCCAAATCAGAACAACGCCGGGAAAACGCTGGGAGCGATGACCTCGACCCTGGCTCCGAGCCCGTCAAGATCCCCGCCGATGTCTGGGAACTTGTCGACCCCCATGCTCCCCCCGAAGTCTCAGGGACTCAGCTTCCAGCCTCCCAGAACCTCAGGCCCGATGAATTTCTCGCATTTCTCTCGCCCTGCGGCTGTGATGAAGGCCAATCTCCAGTGCCTAGGAATGTCTCACGTGGCCCCTCCGCACGGGAGCGGGACGAACGTCCGGCTCAAGAGCCAACCCTACAGCGGGAAGCCACCCGTCGACGCAAGCACGTCGACGGGGTCCTCCATTGCAGAGTCAACCACCACGAGGCAACGCAGCGGCGCTTTCCGCAAGGATACCGAATGCCAAGTCGAAGGTTCCGAAGCTCAACAGAGTCTTGGAACCGAATCGAGCTGGCCTTCGATGCAGAATTCGCTGTCGGGCAAGGACACCGACGCTGTCAATTCCTCCGTGGATGGTGTGGACTGCGATTCGAAGCCCGGTATAGCGGATGTGGACAATTGCAGGAATTCTAGCATCACAGGTAGTGGCGGTTTAGGAACTGAAAAGCATCAGTCTCAAGGAGCAGAAGTGCAGGAAGCTCCCGAACCCACCATTACCTCGTCTTCTGGTGGGTCCGGTAATAGTGCAGATAGAGGGAAAGAGGCCGCATCTAGTGGCAAGAGAAGAACCAGGGAAGGAGAGGAGTCCGAGTGCCAGAGCGAACAAGATGGCGAGGACGAGATGGCCCAGCAAAAGAAACCTCAACAGAGAGGCTCCACCACTAAGAGGAGCAGGGCCGCGGAAGTCCACAACCTTTCCGAGCGAAGGCGAAGAGATCGTATCAACGAGAAGATGAAAGCTCTGCAAGAGCTGATCCCCAATTCCAACAAGACGGACAAAGCATCGATGCTGGATGAAGCGATCGAGTACTTGAAGATGCTCCAGTTGCAACTGCAGATGATGTCCATGAGAAGTGGAATGAGCATCCCCTCTATGGTGATGCCGGCGGGAATGCAACACCTTCAAATCCCGCAATTGCCCCAAATGGGCCCAATGCCTCCCATGGGAATGGGAATGGGCATGGGTATGGGCATGGGCCCGATGGGAATGGGAATGAGTATGATGGACATGGGAGGCGGAGCTCCCGGTCGACCGATGATACCCCTTCCGTCTCACAGTGGGCCTTCTCACTCTCACAACGTATCTGCAACCTCACCAGCTGTTTCTATGGTAGACACTCATGACCACCGCCTGCAAAACCCGAGCGTCATGGAGTCACTGAACGTCTTCATGGCGCAACACCGGCAAATGCAAATGGCTCCTCAGCCGATGAGTATGGATGCATTCAGTGCATTCATGATTCATCAGCACCAGCAGCAACACCAGCAGCAGCATCAACAACATCAGCTCCAACACCAACACCAGCATTCGCTCCATCATCTTCCGAGCAGCATGGGCGGTGGAGCCCCCCAATGAAGAGCGGGCCAAATTCTCGGTGGATCTTGATTTCCACGCTTGCTTTCCATTTGTCATGCCATTTCGCATTGGAGGCCAGCGATCTGTCAACAACTATCTGCTGTTCCGCTCTCGGAGAGCGTAATATACTCAGCTGCAGGCGTGGCTGTGAGTCTGACAGCCATCGTCGGGCATCAGGACACGATACAGCTGAAGGTGAAGGCGAAGGCCGATGGAGGTGTGGTCCGGTGCATCATTGGTTTCCACCTCTTAGTTTTGTAGTCTAGTTGGGGGATATGTAAACATCATGATCTCAGGTTGGAAAGTATGATTCTACTAGGACCGGATCTTGTGTAGGTGCCTTCAACCAGGCCGCAGCAGTGTTGAAGGCGTGTATTAGAACGCAGAATTGGATGATATGTATCAAGAAGGTCCTCGCTGCCCTCGCATTAGCGGCGTGCTGCGGTGCCATGCGGGGCCAGGGTCAGGGCCAGGGCGTTTCGCCTCTGTACTTTTATCAGCAAGCATAATTGCATCTTCTAACTAGCCTTAGCGAGGCGAGGTTTTGAGGATTAGTAGTTTTAGAAGAAGGAAGTGTCCGTAGTGCTGTCATTCCAGGGCCGGACCTTCTTCAATTGTTGCGGATCGGGATACTATGGCGCCGAAGTTTGCGCTCCGGCTTACGCTGTTCTCGTTGTGGATTTGGAGGGAACTCGTGTTGCCGGAAGCAGATTTCTAGTCGAAAGCCTGCCGCCCGAAATGTGCCATGTTTAATTGTCGATAAGGTTCAAGTTAAATGTTGGATTACATTCATTGTTCTCCGTTGGCTCAAGGCGAGCCACTTGTAAAAAGAAATGCCAAGTTTACCAACTTGAGACTCCTTGCACG

CDS

>Mapoly0039s0059.9
ATGAGTCACCTCGTTCCCGACTGGGATGGTAACGGTGGAGACTTAGAAGCTGTTTTACCCACAAGCGATTTCTCACTGCCGGTTAAGGGAAAGTGGGACTCATTGCCCCATAAAAGGTCGCACTTGTCTGGTTTGGCCTTCGTGCCAACCCACGATGCTGGCGAAACTGAGTGGGCAGAGGAAAGTCATATTGTAGCTATGCAGAACCAAAGCGGGAAGGGCAACAAGGCTATGTGGCAGCAGATGAATTTCCAGAATGGGTGGTCGAGTGTGCCAGAGTCTGAGGATGCCGTTACTCCTGTGAAGCCCATCAGCTCGTCGTCTCCGGGGAAGGAGCCGGTTCTTGTCAATGAGCCCGCGGTCGACACGCACCACTCCAGTGCCCTCAACATGCAGGAAGACGAGATGGTGTGCTGGCTGCAGTATCCGTTGGACGAACACCTCGAAAGAGACTACTGTTCCGAGTTCTTCGGCGAGCTGCCCAACTCCAACATATCGAACATGCAGCTGATGAAGGATTCATTCGCAGGGCAAAATCAAGTAGCGGGGCGCAACAACAGGAATCCAGGTCCCGTTAACGTAGGGAGTAACAGCAGAATGTCTAGTGCGGATGCGGCGATGGCCATGGGAGCGGGGCGAGCTGCCGGTTTGTTGCCTCAGACAGGGGTGGAGGTTTTCACCAAAGTTCGGACCACTTTGCAACCCTACGGAGGAAAGTGGTCCCCAAATCAGAACAACGCCGGGAAAACGCTGGGAGCGATGACCTCGACCCTGGCTCCGAGCCCGTCAAGATCCCCGCCGATGTCTGGGAACTTGTCGACCCCCATGCTCCCCCCGAAGTCTCAGGGACTCAGCTTCCAGCCTCCCAGAACCTCAGGCCCGATGAATTTCTCGCATTTCTCTCGCCCTGCGGCTGTGATGAAGGCCAATCTCCAGTGCCTAGGAATGTCTCACGTGGCCCCTCCGCACGGGAGCGGGACGAACGTCCGGCTCAAGAGCCAACCCTACAGCGGGAAGCCACCCGTCGACGCAAGCACGTCGACGGGGTCCTCCATTGCAGAGTCAACCACCACGAGGCAACGCAGCGGCGCTTTCCGCAAGGATACCGAATGCCAAGTCGAAGGTTCCGAAGCTCAACAGAGTCTTGGAACCGAATCGAGCTGGCCTTCGATGCAGAATTCGCTGTCGGGCAAGGACACCGACGCTGTCAATTCCTCCGTGGATGGTGTGGACTGCGATTCGAAGCCCGGTATAGCGGATGTGGACAATTGCAGGAATTCTAGCATCACAGGTAGTGGCGGTTTAGGAACTGAAAAGCATCAGTCTCAAGGAGCAGAAGTGCAGGAAGCTCCCGAACCCACCATTACCTCGTCTTCTGGTGGGTCCGGTAATAGTGCAGATAGAGGGAAAGAGGCCGCATCTAGTGGCAAGAGAAGAACCAGGGAAGGAGAGGAGTCCGAGTGCCAGAGCGAACAAGATGGCGAGGACGAGATGGCCCAGCAAAAGAAACCTCAACAGAGAGGCTCCACCACTAAGAGGAGCAGGGCCGCGGAAGTCCACAACCTTTCCGAGCGAAGGCGAAGAGATCGTATCAACGAGAAGATGAAAGCTCTGCAAGAGCTGATCCCCAATTCCAACAAGACGGACAAAGCATCGATGCTGGATGAAGCGATCGAGTACTTGAAGATGCTCCAGTTGCAACTGCAGATGATGTCCATGAGAAGTGGAATGAGCATCCCCTCTATGGTGATGCCGGCGGGAATGCAACACCTTCAAATCCCGCAATTGCCCCAAATGGGCCCAATGCCTCCCATGGGAATGGGAATGGGCATGGGTATGGGCATGGGCCCGATGGGAATGGGAATGAGTATGATGGACATGGGAGGCGGAGCTCCCGGTCGACCGATGATACCCCTTCCGTCTCACAGTGGGCCTTCTCACTCTCACAACGTATCTGCAACCTCACCAGCTGTTTCTATGGTAGACACTCATGACCACCGCCTGCAAAACCCGAGCGTCATGGAGTCACTGAACGTCTTCATGGCGCAACACCGGCAAATGCAAATGGCTCCTCAGCCGATGAGTATGGATGCATTCAGTGCATTCATGATTCATCAGCACCAGCAGCAACACCAGCAGCAGCATCAACAACATCAGCTCCAACACCAACACCAGCATTCGCTCCATCATCTTCCGAGCAGCATGGGCGGTGGAGCCCCCCAATGA

Protein

>Mapoly0039s0059.9
MSHLVPDWDGNGGDLEAVLPTSDFSLPVKGKWDSLPHKRSHLSGLAFVPTHDAGETEWAEESHIVAMQNQSGKGNKAMWQQMNFQNGWSSVPESEDAVTPVKPISSSSPGKEPVLVNEPAVDTHHSSALNMQEDEMVCWLQYPLDEHLERDYCSEFFGELPNSNISNMQLMKDSFAGQNQVAGRNNRNPGPVNVGSNSRMSSADAAMAMGAGRAAGLLPQTGVEVFTKVRTTLQPYGGKWSPNQNNAGKTLGAMTSTLAPSPSRSPPMSGNLSTPMLPPKSQGLSFQPPRTSGPMNFSHFSRPAAVMKANLQCLGMSHVAPPHGSGTNVRLKSQPYSGKPPVDASTSTGSSIAESTTTRQRSGAFRKDTECQVEGSEAQQSLGTESSWPSMQNSLSGKDTDAVNSSVDGVDCDSKPGIADVDNCRNSSITGSGGLGTEKHQSQGAEVQEAPEPTITSSSGGSGNSADRGKEAASSGKRRTREGEESECQSEQDGEDEMAQQKKPQQRGSTTKRSRAAEVHNLSERRRRDRINEKMKALQELIPNSNKTDKASMLDEAIEYLKMLQLQLQMMSMRSGMSIPSMVMPAGMQHLQIPQLPQMGPMPPMGMGMGMGMGMGPMGMGMSMMDMGGGAPGRPMIPLPSHSGPSHSHNVSATSPAVSMVDTHDHRLQNPSVMESLNVFMAQHRQMQMAPQPMSMDAFSAFMIHQHQQQHQQQHQQHQLQHQHQHSLHHLPSSMGGGAPQ

Mapoly0039s0059.10  

Gene structure:

mRNA scaffold_39:781195..786893  ( - strand )
three_prime_UTR scaffold_39:781195..782061  ( - strand )
CDS scaffold_39:782062..782211  ( - strand )
CDS scaffold_39:782354..782722  ( - strand )
CDS scaffold_39:782835..782900  ( - strand )
CDS scaffold_39:783016..783081  ( - strand )
CDS scaffold_39:783274..783375  ( - strand )
CDS scaffold_39:783551..784880  ( - strand )
CDS scaffold_39:785069..785211  ( - strand )
five_prime_UTR scaffold_39:785212..785214  ( - strand )
five_prime_UTR scaffold_39:785613..785687  ( - strand )
five_prime_UTR scaffold_39:785859..785963  ( - strand )
five_prime_UTR scaffold_39:786286..786893  ( - strand )

Sequences:

Gene

>Mapoly0039s0059.10
GCGAGTCGACGGACGGAAAGAAGGAAGGAAGGAAGGAAAGTGGGGCGGGGCGATGAGGGAGGCGAGGAGTACAAGAATGTGGAGTAGTAAGGATATCATTTTGCTGGATGTTGCTGAAGACGATCAAGAGTCGAATTCGAGTGCGAGTCTTTGGTGCTAGAGCGGGAGGGTGGGCGATCCGAGTGCCAGATGTGGACGAGAGAAGCAGCGGAATCGATGGCTGCAGATTCGGGGCCAGTGGGCAGAGGCGGCTCGAGTCTTCCGACGGGAGGATTGAGGAGGGACACGAAGAGCTCTGAGTGATGTGATGCCATTCTGGTAGAGAAAAAGAAGGGATTCTGCTCTTGGGATCGCGCGAGGTCCCTGGGGCCAGCAAGCGCCCAGCTTGCCGAGCGGGCTCTCTGACGTCGAAGGTGCTGCCGCCTCTGTGTGTTTATCCCTGTGTCTCTGTGTTCTAGGCGGTTGTTGGCGGAGGGACGAGGGAGAGGAGTGGCGTTATGTCTGTCTGCTTGACAAGTTGGTACTCCTTGTGGGTCATAAGTTGGGATTTCCTTCCGCCCGTGGCACTGTTTCTGTCGGCGTGAGAAGAGCAAGTTTTCCAGCTCAAGGTTCAGTCCTATCGTTTTTATCTTCGCCTTCCCTCTCCCGCGTGTCTCCATGCATTTGATGACCTTGTCTGTCGGCGACGCTAGCCTCGAGCATCCATGTCAGGCCCACGCCGCTCTAGTGTGTATGTTTGAGTAGACAGCTCTTGTTCTCCCACATAATGAAATGTCCGCGATCACTGAGCCTTGGTAATTTTGATCTCCTTTCTCGCTCACTCTGCCGCAGGAGAGTGTGCAGCTACTTCGTTAAGTGTGCTTGTCCGCACGGTTGACATAACCTCTATGAGATCTTTAGATTCTGAGCGAGATCCTTCTCTTGTGACAGAGCCGTGAGAAAGAGCCGGGGTGGCCTGTTGTATTTCCCGAGGAGATGAATGTACAAACTGCATAAAAACTGCATCTCCTTGATGCTCCGGAATGATGAGGACATGTAAGGAAGCGTTGAGTACACCGACCCAGAAGAATCGTAAATGCATCTGCACTCTGTGTTGTAGAGTTGGGCCCATTTAGTCGACGGCGATAAGTAGCAGATTGACCCGCTTAGCGGCAAGAACCCGTTGTGCCTCTGTTTAAACTGACTGGGTTCGAATTGCTCCTACAGGGACTGGATTTCGAATCGGGAACGGACTGAACACCGGAAGAATCCTCTCCGGTTGTCACTACATCCCCATCAGAGGTGAGTTCAGTGTGGGAAGCCTGTCGAGAGATCGGCGAGCTGGTGATTCTTACTTGCTTTCTGTCTGTGTTTGGAGCGTCTACCTTTCTCGTAATCTACCCATACCTTTCCCGTCACTGAGAAATGAAGAGGCTTTAAAAGTAGGTGAACTTCGAGACTTGGGTGCCATGAGAGTAGATTAGAAGTAGGACGAGCAGGAGACGACTGCAAACTGTCGAAGTCTTCACCTCTCATCTTCTCATTCCCACTGCCATGCCTTACTCACGACCATCCACTACCTCTATGTATGTGGGAGCGCTTCTGGCGAAGCGCTGGGCATTGACAGTGACAGGCCGAGAAGTCGATGCCGTAGCAGTCTAGGTAGGCATTTGATTTACCTCCTCCTGTTTGACTCGCAGACCATGAGTCACCTCGTTCCCGACTGGGATGGTAACGGTGGAGACTTAGAAGCTGTTTTACCCACAAGCGATTTCTCACTGCCGGTTAAGGGAAAGTGGGACTCATTGCCCCATAAAAGGTCGCACTTGTCTGGTTTGGCCTTCGTGTAAGCGCTTGCTCCGGCTTTTCAATCCCCATAGTTTTTTGTGTTCTTGATACCATTGTATGTAAGGTCAATTTCTTGATTGTGGATCTTTGAGAATGCCACTTCGTGATGCCGGCTCGTTGACATGCTGCTCTTCGTCACATGAGCTTCGAAGAGATGTTAAAGGTCGCGTTCTTCTTCTTCTACAGGCCAACCCACGATGCTGGCGAAACTGAGTGGGCAGAGGAAAGTCATATTGTAGCTATGCAGAACCAAAGCGGGAAGGGCAACAAGGCTATGTGGCAGCAGATGAATTTCCAGAATGGGTGGTCGAGTGTGCCAGAGTCTGAGGATGCCGTTACTCCTGTGAAGCCCATCAGCTCGTCGTCTCCGGGGAAGGAGCCGGTTCTTGTCAATGAGCCCGCGGTCGACACGCACCACTCCAGTGCCCTCAACATGCAGGAAGACGAGATGGTGTGCTGGCTGCAGTATCCGTTGGACGAACACCTCGAAAGAGACTACTGTTCCGAGTTCTTCGGCGAGCTGCCCAACTCCAACATATCGAACATGCAGCTGATGAAGGATTCATTCGCAGGGCAAAATCAAGTAGCGGGGCGCAACAACAGGAATCCAGGTCCCGTTAACGTAGGGAGTAACAGCAGAATGTCTAGTGCGGATGCGGCGATGGCCATGGGAGCGGGGCGAGCTGCCGGTTTGTTGCCTCAGACAGGGGTGGAGGTTTTCACCAAAGTTCGGACCACTTTGCAACCCTACGGAGGAAAGTGGTCCCCAAATCAGAACAACGCCGGGAAAACGCTGGGAGCGATGACCTCGACCCTGGCTCCGAGCCCGTCAAGATCCCCGCCGATGTCTGGGAACTTGTCGACCCCCATGCTCCCCCCGAAGTCTCAGGGACTCAGCTTCCAGCCTCCCAGAACCTCAGGCCCGATGAATTTCTCGCATTTCTCTCGCCCTGCGGCTGTGATGAAGGCCAATCTCCAGTGCCTAGGAATGTCTCACGTGGCCCCTCCGCACGGGAGCGGGACGAACGTCCGGCTCAAGAGCCAACCCTACAGCGGGAAGCCACCCGTCGACGCAAGCACGTCGACGGGGTCCTCCATTGCAGAGTCAACCACCACGAGGCAACGCAGCGGCGCTTTCCGCAAGGATACCGAATGCCAAGTCGAAGGTTCCGAAGCTCAACAGAGTCTTGGAACCGAATCGAGCTGGCCTTCGATGCAGAATTCGCTGTCGGGCAAGGACACCGACGCTGTCAATTCCTCCGTGGATGGTGTGGACTGCGATTCGAAGCCCGGTATAGCGGATGTGGACAATTGCAGGAATTCTAGCATCACAGGTAGTGGCGGTTTAGGAACTGAAAAGCATCAGTCTCAAGGAGCAGAAGTGCAGGAAGCTCCCGAACCCACCATTACCTCGTCTTCTGGTGGGTCCGGTAATAGTGCAGATAGAGGGAAAGAGGCCGCATCTAGTGGCAAGAGAAGAACCAGGGAAGGAGAGGAGTCCGAGTGCCAGAGCGAAGTGAGTAACTTGTTGCAACCCCAAGGGAGTCAAGTTGGTGCAGTAGCCCACAGGGTATGTTTTATCTAGTGATGCTAACTTTTTCCTGAATAACATCCCACTGACTGCTCTTTTTATGCGAGGATGTGTGAGAAGTGTACTTGCGTTTAATAAAAGCCAATGTTGTTTCTGGCAGCAAGATGGCGAGGACGAGATGGCCCAGCAAAAGAAACCTCAACAGAGAGGCTCCACCACTAAGAGGAGCAGGGCCGCGGAAGTCCACAACCTTTCCGAGCGAGTGAGAGTCCACCACTAACTGAGAAATTGAGCTCTGCGCCAATTGTACAGGATGGTCCAAGCCGTGAGCATATGACGGCAGTGGACAATCTAGGTCTCAAATCTTGTTTGGGTCGTCAATTTTGTGACTGATGTTAGTTTTGAAGCTCTTGGCTTCCGCAGCTTTACTGATAGAATTTCCTGCCCATTTCAGAGGCGAAGAGATCGTATCAACGAGAAGATGAAAGCTCTGCAAGAGCTGATCCCCAATTCCAACAAGGTTTGTTACAGCTTTCAGCCTTGTTCTTCGTACCTTGCCTCTTCTTTTGGATCACCGTGCGGTAACTTGCCCTTGAAATACAGTCAATGATGCAGACTTTTGATTCATATTGCAGACGGACAAAGCATCGATGCTGGATGAAGCGATCGAGTACTTGAAGATGCTCCAGTTGCAACTGCAGGTAACTATCCCAGCCTTTGACCTTCGCAGTAGTTCTCTGCTCCTCCTTGCGATGCAGGTGCTGTAGAGACGCCCGAGCACAAATACTGAATTCAATTTGCCCTCTTTAGCAGATGATGTCCATGAGAAGTGGAATGAGCATCCCCTCTATGGTGATGCCGGCGGGAATGCAACACCTTCAAATCCCGCAATTGCCCCAAATGGGCCCAATGCCTCCCATGGGAATGGGAATGGGCATGGGTATGGGCATGGGCCCGATGGGAATGGGAATGAGTATGATGGACATGGGAGGCGGAGCTCCCGGTCGACCGATGATACCCCTTCCGTCTCACAGTGGGCCTTCTCACTCTCACAACGTATCTGCAACCTCACCAGCTGTTTCTATGGTAGACACTCATGACCACCGCCTGCAAAACCCGAGCGTCATGGAGTCACTGAACGTCTTCATGGCGCAACACCGGCAAATGCAAATGGCTCCTCAGGTGATCCTTCTCTTTGAATGCCGGCTGGTTCTGTCCGATCTTCTGTCAGCTTTGTTTTTTGTGCAAATTTCCTAGGAGGAAGGAGCATGTGGTTGGGAGACGATGAAGTCTTGATTCTTACTCACTGTGCCTGTTCTTGCAGCCGATGAGTATGGATGCATTCAGTGCATTCATGATTCATCAGCACCAGCAGCAACACCAGCAGCAGCATCAACAACATCAGCTCCAACACCAACACCAGCATTCGCTCCATCATCTTCCGAGCAGCATGGGCGGTGGAGCCCCCCAATGAAGAGCGGGCCAAATTCTCGGTGGATCTTGATTTCCACGCTTGCTTTCCATTTGTCATGCCATTTCGCATTGGAGGCCAGCGATCTGTCAACAACTATCTGCTGTTCCGCTCTCGGAGAGCGTAATATACTCAGCTGCAGGCGTGGCTGTGAGTCTGACAGCCATCGTCGGGCATCAGGACACGATACAGCTGAAGGTGAAGGCGAAGGCCGATGGAGGTGTGGTCCGGTGCATCATTGGTTTCCACCTCTTAGTTTTGTAGTCTAGTTGGGGGATATGTAAACATCATGATCTCAGGTTGGAAAGTATGATTCTACTAGGACCGGATCTTGTGTAGGTGCCTTCAACCAGGCCGCAGCAGTGTTGAAGGCGTGTATTAGAACGCAGAATTGGATGATATGTATCAAGAAGGTCCTCGCTGCCCTCGCATTAGCGGCGTGCTGCGGTGCCATGCGGGGCCAGGGTCAGGGCCAGGGCGTTTCGCCTCTGTACTTTTATCAGCAAGCATAATTGCATCTTCTAACTAGCCTTAGCGAGGCGAGGTTTTGAGGATTAGTAGTTTTAGAAGAAGGAAGTGTCCGTAGTGCTGTCATTCCAGGGCCGGACCTTCTTCAATTGTTGCGGATCGGGATACTATGGCGCCGAAGTTTGCGCTCCGGCTTACGCTGTTCTCGTTGTGGATTTGGAGGGAACTCGTGTTGCCGGAAGCAGATTTCTAGTCGAAAGCCTGCCGCCCGAAATGTGCCATGTTTAATTGTCGATAAGGTTCAAGTTAAATGTTGGATTACATTCATTGTTCTCCGTTGGCTCAAGGCGAGCCACTTGTAAAAAGAAATGCCAAGTTTACCAACTTGAGACTCCTTGCACG

mRNA

>Mapoly0039s0059.10
GCGAGTCGACGGACGGAAAGAAGGAAGGAAGGAAGGAAAGTGGGGCGGGGCGATGAGGGAGGCGAGGAGTACAAGAATGTGGAGTAGTAAGGATATCATTTTGCTGGATGTTGCTGAAGACGATCAAGAGTCGAATTCGAGTGCGAGTCTTTGGTGCTAGAGCGGGAGGGTGGGCGATCCGAGTGCCAGATGTGGACGAGAGAAGCAGCGGAATCGATGGCTGCAGATTCGGGGCCAGTGGGCAGAGGCGGCTCGAGTCTTCCGACGGGAGGATTGAGGAGGGACACGAAGAGCTCTGAGTGATGTGATGCCATTCTGGTAGAGAAAAAGAAGGGATTCTGCTCTTGGGATCGCGCGAGGTCCCTGGGGCCAGCAAGCGCCCAGCTTGCCGAGCGGGCTCTCTGACGTCGAAGGTGCTGCCGCCTCTGTGTGTTTATCCCTGTGTCTCTGTGTTCTAGGCGGTTGTTGGCGGAGGGACGAGGGAGAGGAGTGGCGTTATGTCTGTCTGCTTGACAAGTTGGTACTCCTTGTGGGTCATAAGTTGGGATTTCCTTCCGCCCGTGGCACTGTTTCTGTCGGCGTGAGAAGAGCAAGTTTTCCAGCTCAAGAGCCGTGAGAAAGAGCCGGGGTGGCCTGTTGTATTTCCCGAGGAGATGAATGTACAAACTGCATAAAAACTGCATCTCCTTGATGCTCCGGAATGATGAGGACATGGACTGGATTTCGAATCGGGAACGGACTGAACACCGGAAGAATCCTCTCCGGTTGTCACTACATCCCCATCAGAGACCATGAGTCACCTCGTTCCCGACTGGGATGGTAACGGTGGAGACTTAGAAGCTGTTTTACCCACAAGCGATTTCTCACTGCCGGTTAAGGGAAAGTGGGACTCATTGCCCCATAAAAGGTCGCACTTGTCTGGTTTGGCCTTCGTGCCAACCCACGATGCTGGCGAAACTGAGTGGGCAGAGGAAAGTCATATTGTAGCTATGCAGAACCAAAGCGGGAAGGGCAACAAGGCTATGTGGCAGCAGATGAATTTCCAGAATGGGTGGTCGAGTGTGCCAGAGTCTGAGGATGCCGTTACTCCTGTGAAGCCCATCAGCTCGTCGTCTCCGGGGAAGGAGCCGGTTCTTGTCAATGAGCCCGCGGTCGACACGCACCACTCCAGTGCCCTCAACATGCAGGAAGACGAGATGGTGTGCTGGCTGCAGTATCCGTTGGACGAACACCTCGAAAGAGACTACTGTTCCGAGTTCTTCGGCGAGCTGCCCAACTCCAACATATCGAACATGCAGCTGATGAAGGATTCATTCGCAGGGCAAAATCAAGTAGCGGGGCGCAACAACAGGAATCCAGGTCCCGTTAACGTAGGGAGTAACAGCAGAATGTCTAGTGCGGATGCGGCGATGGCCATGGGAGCGGGGCGAGCTGCCGGTTTGTTGCCTCAGACAGGGGTGGAGGTTTTCACCAAAGTTCGGACCACTTTGCAACCCTACGGAGGAAAGTGGTCCCCAAATCAGAACAACGCCGGGAAAACGCTGGGAGCGATGACCTCGACCCTGGCTCCGAGCCCGTCAAGATCCCCGCCGATGTCTGGGAACTTGTCGACCCCCATGCTCCCCCCGAAGTCTCAGGGACTCAGCTTCCAGCCTCCCAGAACCTCAGGCCCGATGAATTTCTCGCATTTCTCTCGCCCTGCGGCTGTGATGAAGGCCAATCTCCAGTGCCTAGGAATGTCTCACGTGGCCCCTCCGCACGGGAGCGGGACGAACGTCCGGCTCAAGAGCCAACCCTACAGCGGGAAGCCACCCGTCGACGCAAGCACGTCGACGGGGTCCTCCATTGCAGAGTCAACCACCACGAGGCAACGCAGCGGCGCTTTCCGCAAGGATACCGAATGCCAAGTCGAAGGTTCCGAAGCTCAACAGAGTCTTGGAACCGAATCGAGCTGGCCTTCGATGCAGAATTCGCTGTCGGGCAAGGACACCGACGCTGTCAATTCCTCCGTGGATGGTGTGGACTGCGATTCGAAGCCCGGTATAGCGGATGTGGACAATTGCAGGAATTCTAGCATCACAGGTAGTGGCGGTTTAGGAACTGAAAAGCATCAGTCTCAAGGAGCAGAAGTGCAGGAAGCTCCCGAACCCACCATTACCTCGTCTTCTGGTGGGTCCGGTAATAGTGCAGATAGAGGGAAAGAGGCCGCATCTAGTGGCAAGAGAAGAACCAGGGAAGGAGAGGAGTCCGAGTGCCAGAGCGAACAAGATGGCGAGGACGAGATGGCCCAGCAAAAGAAACCTCAACAGAGAGGCTCCACCACTAAGAGGAGCAGGGCCGCGGAAGTCCACAACCTTTCCGAGCGAAGGCGAAGAGATCGTATCAACGAGAAGATGAAAGCTCTGCAAGAGCTGATCCCCAATTCCAACAAGACGGACAAAGCATCGATGCTGGATGAAGCGATCGAGTACTTGAAGATGCTCCAGTTGCAACTGCAGATGATGTCCATGAGAAGTGGAATGAGCATCCCCTCTATGGTGATGCCGGCGGGAATGCAACACCTTCAAATCCCGCAATTGCCCCAAATGGGCCCAATGCCTCCCATGGGAATGGGAATGGGCATGGGTATGGGCATGGGCCCGATGGGAATGGGAATGAGTATGATGGACATGGGAGGCGGAGCTCCCGGTCGACCGATGATACCCCTTCCGTCTCACAGTGGGCCTTCTCACTCTCACAACGTATCTGCAACCTCACCAGCTGTTTCTATGGTAGACACTCATGACCACCGCCTGCAAAACCCGAGCGTCATGGAGTCACTGAACGTCTTCATGGCGCAACACCGGCAAATGCAAATGGCTCCTCAGCCGATGAGTATGGATGCATTCAGTGCATTCATGATTCATCAGCACCAGCAGCAACACCAGCAGCAGCATCAACAACATCAGCTCCAACACCAACACCAGCATTCGCTCCATCATCTTCCGAGCAGCATGGGCGGTGGAGCCCCCCAATGAAGAGCGGGCCAAATTCTCGGTGGATCTTGATTTCCACGCTTGCTTTCCATTTGTCATGCCATTTCGCATTGGAGGCCAGCGATCTGTCAACAACTATCTGCTGTTCCGCTCTCGGAGAGCGTAATATACTCAGCTGCAGGCGTGGCTGTGAGTCTGACAGCCATCGTCGGGCATCAGGACACGATACAGCTGAAGGTGAAGGCGAAGGCCGATGGAGGTGTGGTCCGGTGCATCATTGGTTTCCACCTCTTAGTTTTGTAGTCTAGTTGGGGGATATGTAAACATCATGATCTCAGGTTGGAAAGTATGATTCTACTAGGACCGGATCTTGTGTAGGTGCCTTCAACCAGGCCGCAGCAGTGTTGAAGGCGTGTATTAGAACGCAGAATTGGATGATATGTATCAAGAAGGTCCTCGCTGCCCTCGCATTAGCGGCGTGCTGCGGTGCCATGCGGGGCCAGGGTCAGGGCCAGGGCGTTTCGCCTCTGTACTTTTATCAGCAAGCATAATTGCATCTTCTAACTAGCCTTAGCGAGGCGAGGTTTTGAGGATTAGTAGTTTTAGAAGAAGGAAGTGTCCGTAGTGCTGTCATTCCAGGGCCGGACCTTCTTCAATTGTTGCGGATCGGGATACTATGGCGCCGAAGTTTGCGCTCCGGCTTACGCTGTTCTCGTTGTGGATTTGGAGGGAACTCGTGTTGCCGGAAGCAGATTTCTAGTCGAAAGCCTGCCGCCCGAAATGTGCCATGTTTAATTGTCGATAAGGTTCAAGTTAAATGTTGGATTACATTCATTGTTCTCCGTTGGCTCAAGGCGAGCCACTTGTAAAAAGAAATGCCAAGTTTACCAACTTGAGACTCCTTGCACG

CDS

>Mapoly0039s0059.10
ATGAGTCACCTCGTTCCCGACTGGGATGGTAACGGTGGAGACTTAGAAGCTGTTTTACCCACAAGCGATTTCTCACTGCCGGTTAAGGGAAAGTGGGACTCATTGCCCCATAAAAGGTCGCACTTGTCTGGTTTGGCCTTCGTGCCAACCCACGATGCTGGCGAAACTGAGTGGGCAGAGGAAAGTCATATTGTAGCTATGCAGAACCAAAGCGGGAAGGGCAACAAGGCTATGTGGCAGCAGATGAATTTCCAGAATGGGTGGTCGAGTGTGCCAGAGTCTGAGGATGCCGTTACTCCTGTGAAGCCCATCAGCTCGTCGTCTCCGGGGAAGGAGCCGGTTCTTGTCAATGAGCCCGCGGTCGACACGCACCACTCCAGTGCCCTCAACATGCAGGAAGACGAGATGGTGTGCTGGCTGCAGTATCCGTTGGACGAACACCTCGAAAGAGACTACTGTTCCGAGTTCTTCGGCGAGCTGCCCAACTCCAACATATCGAACATGCAGCTGATGAAGGATTCATTCGCAGGGCAAAATCAAGTAGCGGGGCGCAACAACAGGAATCCAGGTCCCGTTAACGTAGGGAGTAACAGCAGAATGTCTAGTGCGGATGCGGCGATGGCCATGGGAGCGGGGCGAGCTGCCGGTTTGTTGCCTCAGACAGGGGTGGAGGTTTTCACCAAAGTTCGGACCACTTTGCAACCCTACGGAGGAAAGTGGTCCCCAAATCAGAACAACGCCGGGAAAACGCTGGGAGCGATGACCTCGACCCTGGCTCCGAGCCCGTCAAGATCCCCGCCGATGTCTGGGAACTTGTCGACCCCCATGCTCCCCCCGAAGTCTCAGGGACTCAGCTTCCAGCCTCCCAGAACCTCAGGCCCGATGAATTTCTCGCATTTCTCTCGCCCTGCGGCTGTGATGAAGGCCAATCTCCAGTGCCTAGGAATGTCTCACGTGGCCCCTCCGCACGGGAGCGGGACGAACGTCCGGCTCAAGAGCCAACCCTACAGCGGGAAGCCACCCGTCGACGCAAGCACGTCGACGGGGTCCTCCATTGCAGAGTCAACCACCACGAGGCAACGCAGCGGCGCTTTCCGCAAGGATACCGAATGCCAAGTCGAAGGTTCCGAAGCTCAACAGAGTCTTGGAACCGAATCGAGCTGGCCTTCGATGCAGAATTCGCTGTCGGGCAAGGACACCGACGCTGTCAATTCCTCCGTGGATGGTGTGGACTGCGATTCGAAGCCCGGTATAGCGGATGTGGACAATTGCAGGAATTCTAGCATCACAGGTAGTGGCGGTTTAGGAACTGAAAAGCATCAGTCTCAAGGAGCAGAAGTGCAGGAAGCTCCCGAACCCACCATTACCTCGTCTTCTGGTGGGTCCGGTAATAGTGCAGATAGAGGGAAAGAGGCCGCATCTAGTGGCAAGAGAAGAACCAGGGAAGGAGAGGAGTCCGAGTGCCAGAGCGAACAAGATGGCGAGGACGAGATGGCCCAGCAAAAGAAACCTCAACAGAGAGGCTCCACCACTAAGAGGAGCAGGGCCGCGGAAGTCCACAACCTTTCCGAGCGAAGGCGAAGAGATCGTATCAACGAGAAGATGAAAGCTCTGCAAGAGCTGATCCCCAATTCCAACAAGACGGACAAAGCATCGATGCTGGATGAAGCGATCGAGTACTTGAAGATGCTCCAGTTGCAACTGCAGATGATGTCCATGAGAAGTGGAATGAGCATCCCCTCTATGGTGATGCCGGCGGGAATGCAACACCTTCAAATCCCGCAATTGCCCCAAATGGGCCCAATGCCTCCCATGGGAATGGGAATGGGCATGGGTATGGGCATGGGCCCGATGGGAATGGGAATGAGTATGATGGACATGGGAGGCGGAGCTCCCGGTCGACCGATGATACCCCTTCCGTCTCACAGTGGGCCTTCTCACTCTCACAACGTATCTGCAACCTCACCAGCTGTTTCTATGGTAGACACTCATGACCACCGCCTGCAAAACCCGAGCGTCATGGAGTCACTGAACGTCTTCATGGCGCAACACCGGCAAATGCAAATGGCTCCTCAGCCGATGAGTATGGATGCATTCAGTGCATTCATGATTCATCAGCACCAGCAGCAACACCAGCAGCAGCATCAACAACATCAGCTCCAACACCAACACCAGCATTCGCTCCATCATCTTCCGAGCAGCATGGGCGGTGGAGCCCCCCAATGA

Protein

>Mapoly0039s0059.10
MSHLVPDWDGNGGDLEAVLPTSDFSLPVKGKWDSLPHKRSHLSGLAFVPTHDAGETEWAEESHIVAMQNQSGKGNKAMWQQMNFQNGWSSVPESEDAVTPVKPISSSSPGKEPVLVNEPAVDTHHSSALNMQEDEMVCWLQYPLDEHLERDYCSEFFGELPNSNISNMQLMKDSFAGQNQVAGRNNRNPGPVNVGSNSRMSSADAAMAMGAGRAAGLLPQTGVEVFTKVRTTLQPYGGKWSPNQNNAGKTLGAMTSTLAPSPSRSPPMSGNLSTPMLPPKSQGLSFQPPRTSGPMNFSHFSRPAAVMKANLQCLGMSHVAPPHGSGTNVRLKSQPYSGKPPVDASTSTGSSIAESTTTRQRSGAFRKDTECQVEGSEAQQSLGTESSWPSMQNSLSGKDTDAVNSSVDGVDCDSKPGIADVDNCRNSSITGSGGLGTEKHQSQGAEVQEAPEPTITSSSGGSGNSADRGKEAASSGKRRTREGEESECQSEQDGEDEMAQQKKPQQRGSTTKRSRAAEVHNLSERRRRDRINEKMKALQELIPNSNKTDKASMLDEAIEYLKMLQLQLQMMSMRSGMSIPSMVMPAGMQHLQIPQLPQMGPMPPMGMGMGMGMGMGPMGMGMSMMDMGGGAPGRPMIPLPSHSGPSHSHNVSATSPAVSMVDTHDHRLQNPSVMESLNVFMAQHRQMQMAPQPMSMDAFSAFMIHQHQQQHQQQHQQHQLQHQHQHSLHHLPSSMGGGAPQ

Mapoly0039s0059.11  

Gene structure:

mRNA scaffold_39:781195..786893  ( - strand )
three_prime_UTR scaffold_39:781195..782061  ( - strand )
CDS scaffold_39:782062..782211  ( - strand )
CDS scaffold_39:782354..782725  ( - strand )
CDS scaffold_39:782835..782900  ( - strand )
CDS scaffold_39:783016..783081  ( - strand )
CDS scaffold_39:783274..783375  ( - strand )
CDS scaffold_39:783551..784880  ( - strand )
CDS scaffold_39:785069..785211  ( - strand )
five_prime_UTR scaffold_39:785212..785214  ( - strand )
five_prime_UTR scaffold_39:785613..785687  ( - strand )
five_prime_UTR scaffold_39:786286..786893  ( - strand )

Sequences:

Gene

>Mapoly0039s0059.11
GCGAGTCGACGGACGGAAAGAAGGAAGGAAGGAAGGAAAGTGGGGCGGGGCGATGAGGGAGGCGAGGAGTACAAGAATGTGGAGTAGTAAGGATATCATTTTGCTGGATGTTGCTGAAGACGATCAAGAGTCGAATTCGAGTGCGAGTCTTTGGTGCTAGAGCGGGAGGGTGGGCGATCCGAGTGCCAGATGTGGACGAGAGAAGCAGCGGAATCGATGGCTGCAGATTCGGGGCCAGTGGGCAGAGGCGGCTCGAGTCTTCCGACGGGAGGATTGAGGAGGGACACGAAGAGCTCTGAGTGATGTGATGCCATTCTGGTAGAGAAAAAGAAGGGATTCTGCTCTTGGGATCGCGCGAGGTCCCTGGGGCCAGCAAGCGCCCAGCTTGCCGAGCGGGCTCTCTGACGTCGAAGGTGCTGCCGCCTCTGTGTGTTTATCCCTGTGTCTCTGTGTTCTAGGCGGTTGTTGGCGGAGGGACGAGGGAGAGGAGTGGCGTTATGTCTGTCTGCTTGACAAGTTGGTACTCCTTGTGGGTCATAAGTTGGGATTTCCTTCCGCCCGTGGCACTGTTTCTGTCGGCGTGAGAAGAGCAAGTTTTCCAGCTCAAGGTTCAGTCCTATCGTTTTTATCTTCGCCTTCCCTCTCCCGCGTGTCTCCATGCATTTGATGACCTTGTCTGTCGGCGACGCTAGCCTCGAGCATCCATGTCAGGCCCACGCCGCTCTAGTGTGTATGTTTGAGTAGACAGCTCTTGTTCTCCCACATAATGAAATGTCCGCGATCACTGAGCCTTGGTAATTTTGATCTCCTTTCTCGCTCACTCTGCCGCAGGAGAGTGTGCAGCTACTTCGTTAAGTGTGCTTGTCCGCACGGTTGACATAACCTCTATGAGATCTTTAGATTCTGAGCGAGATCCTTCTCTTGTGACAGAGCCGTGAGAAAGAGCCGGGGTGGCCTGTTGTATTTCCCGAGGAGATGAATGTACAAACTGCATAAAAACTGCATCTCCTTGATGCTCCGGAATGATGAGGACATGTAAGGAAGCGTTGAGTACACCGACCCAGAAGAATCGTAAATGCATCTGCACTCTGTGTTGTAGAGTTGGGCCCATTTAGTCGACGGCGATAAGTAGCAGATTGACCCGCTTAGCGGCAAGAACCCGTTGTGCCTCTGTTTAAACTGACTGGGTTCGAATTGCTCCTACAGGGACTGGATTTCGAATCGGGAACGGACTGAACACCGGAAGAATCCTCTCCGGTTGTCACTACATCCCCATCAGAGGTGAGTTCAGTGTGGGAAGCCTGTCGAGAGATCGGCGAGCTGGTGATTCTTACTTGCTTTCTGTCTGTGTTTGGAGCGTCTACCTTTCTCGTAATCTACCCATACCTTTCCCGTCACTGAGAAATGAAGAGGCTTTAAAAGTAGGTGAACTTCGAGACTTGGGTGCCATGAGAGTAGATTAGAAGTAGGACGAGCAGGAGACGACTGCAAACTGTCGAAGTCTTCACCTCTCATCTTCTCATTCCCACTGCCATGCCTTACTCACGACCATCCACTACCTCTATGTATGTGGGAGCGCTTCTGGCGAAGCGCTGGGCATTGACAGTGACAGGCCGAGAAGTCGATGCCGTAGCAGTCTAGGTAGGCATTTGATTTACCTCCTCCTGTTTGACTCGCAGACCATGAGTCACCTCGTTCCCGACTGGGATGGTAACGGTGGAGACTTAGAAGCTGTTTTACCCACAAGCGATTTCTCACTGCCGGTTAAGGGAAAGTGGGACTCATTGCCCCATAAAAGGTCGCACTTGTCTGGTTTGGCCTTCGTGTAAGCGCTTGCTCCGGCTTTTCAATCCCCATAGTTTTTTGTGTTCTTGATACCATTGTATGTAAGGTCAATTTCTTGATTGTGGATCTTTGAGAATGCCACTTCGTGATGCCGGCTCGTTGACATGCTGCTCTTCGTCACATGAGCTTCGAAGAGATGTTAAAGGTCGCGTTCTTCTTCTTCTACAGGCCAACCCACGATGCTGGCGAAACTGAGTGGGCAGAGGAAAGTCATATTGTAGCTATGCAGAACCAAAGCGGGAAGGGCAACAAGGCTATGTGGCAGCAGATGAATTTCCAGAATGGGTGGTCGAGTGTGCCAGAGTCTGAGGATGCCGTTACTCCTGTGAAGCCCATCAGCTCGTCGTCTCCGGGGAAGGAGCCGGTTCTTGTCAATGAGCCCGCGGTCGACACGCACCACTCCAGTGCCCTCAACATGCAGGAAGACGAGATGGTGTGCTGGCTGCAGTATCCGTTGGACGAACACCTCGAAAGAGACTACTGTTCCGAGTTCTTCGGCGAGCTGCCCAACTCCAACATATCGAACATGCAGCTGATGAAGGATTCATTCGCAGGGCAAAATCAAGTAGCGGGGCGCAACAACAGGAATCCAGGTCCCGTTAACGTAGGGAGTAACAGCAGAATGTCTAGTGCGGATGCGGCGATGGCCATGGGAGCGGGGCGAGCTGCCGGTTTGTTGCCTCAGACAGGGGTGGAGGTTTTCACCAAAGTTCGGACCACTTTGCAACCCTACGGAGGAAAGTGGTCCCCAAATCAGAACAACGCCGGGAAAACGCTGGGAGCGATGACCTCGACCCTGGCTCCGAGCCCGTCAAGATCCCCGCCGATGTCTGGGAACTTGTCGACCCCCATGCTCCCCCCGAAGTCTCAGGGACTCAGCTTCCAGCCTCCCAGAACCTCAGGCCCGATGAATTTCTCGCATTTCTCTCGCCCTGCGGCTGTGATGAAGGCCAATCTCCAGTGCCTAGGAATGTCTCACGTGGCCCCTCCGCACGGGAGCGGGACGAACGTCCGGCTCAAGAGCCAACCCTACAGCGGGAAGCCACCCGTCGACGCAAGCACGTCGACGGGGTCCTCCATTGCAGAGTCAACCACCACGAGGCAACGCAGCGGCGCTTTCCGCAAGGATACCGAATGCCAAGTCGAAGGTTCCGAAGCTCAACAGAGTCTTGGAACCGAATCGAGCTGGCCTTCGATGCAGAATTCGCTGTCGGGCAAGGACACCGACGCTGTCAATTCCTCCGTGGATGGTGTGGACTGCGATTCGAAGCCCGGTATAGCGGATGTGGACAATTGCAGGAATTCTAGCATCACAGGTAGTGGCGGTTTAGGAACTGAAAAGCATCAGTCTCAAGGAGCAGAAGTGCAGGAAGCTCCCGAACCCACCATTACCTCGTCTTCTGGTGGGTCCGGTAATAGTGCAGATAGAGGGAAAGAGGCCGCATCTAGTGGCAAGAGAAGAACCAGGGAAGGAGAGGAGTCCGAGTGCCAGAGCGAAGTGAGTAACTTGTTGCAACCCCAAGGGAGTCAAGTTGGTGCAGTAGCCCACAGGGTATGTTTTATCTAGTGATGCTAACTTTTTCCTGAATAACATCCCACTGACTGCTCTTTTTATGCGAGGATGTGTGAGAAGTGTACTTGCGTTTAATAAAAGCCAATGTTGTTTCTGGCAGCAAGATGGCGAGGACGAGATGGCCCAGCAAAAGAAACCTCAACAGAGAGGCTCCACCACTAAGAGGAGCAGGGCCGCGGAAGTCCACAACCTTTCCGAGCGAGTGAGAGTCCACCACTAACTGAGAAATTGAGCTCTGCGCCAATTGTACAGGATGGTCCAAGCCGTGAGCATATGACGGCAGTGGACAATCTAGGTCTCAAATCTTGTTTGGGTCGTCAATTTTGTGACTGATGTTAGTTTTGAAGCTCTTGGCTTCCGCAGCTTTACTGATAGAATTTCCTGCCCATTTCAGAGGCGAAGAGATCGTATCAACGAGAAGATGAAAGCTCTGCAAGAGCTGATCCCCAATTCCAACAAGGTTTGTTACAGCTTTCAGCCTTGTTCTTCGTACCTTGCCTCTTCTTTTGGATCACCGTGCGGTAACTTGCCCTTGAAATACAGTCAATGATGCAGACTTTTGATTCATATTGCAGACGGACAAAGCATCGATGCTGGATGAAGCGATCGAGTACTTGAAGATGCTCCAGTTGCAACTGCAGGTAACTATCCCAGCCTTTGACCTTCGCAGTAGTTCTCTGCTCCTCCTTGCGATGCAGGTGCTGTAGAGACGCCCGAGCACAAATACTGAATTCAATTTGCCCTCTTTAGCAGATGATGTCCATGAGAAGTGGAATGAGCATCCCCTCTATGGTGATGCCGGCGGGAATGCAACACCTTCAAATCCCGCAATTGCCCCAAATGGGCCCAATGCCTCCCATGGGAATGGGAATGGGCATGGGTATGGGCATGGGCCCGATGGGAATGGGAATGAGTATGATGGACATGGGAGGCGGAGCTCCCGGTCGACCGATGATACCCCTTCCGTCTCACAGTGGGCCTTCTCACTCTCACAACGTATCTGCAACCTCACCAGCTGTTTCTATGGTAGACACTCATGACCACCGCCTGCAAAACCCGAGCGTCATGGAGTCACTGAACGTCTTCATGGCGCAACACCGGCAAATGCAAATGGCTCCTCAGGTGATCCTTCTCTTTGAATGCCGGCTGGTTCTGTCCGATCTTCTGTCAGCTTTGTTTTTTGTGCAAATTTCCTAGGAGGAAGGAGCATGTGGTTGGGAGACGATGAAGTCTTGATTCTTACTCACTGTGCCTGTTCTTGCAGCCGATGAGTATGGATGCATTCAGTGCATTCATGATTCATCAGCACCAGCAGCAACACCAGCAGCAGCATCAACAACATCAGCTCCAACACCAACACCAGCATTCGCTCCATCATCTTCCGAGCAGCATGGGCGGTGGAGCCCCCCAATGAAGAGCGGGCCAAATTCTCGGTGGATCTTGATTTCCACGCTTGCTTTCCATTTGTCATGCCATTTCGCATTGGAGGCCAGCGATCTGTCAACAACTATCTGCTGTTCCGCTCTCGGAGAGCGTAATATACTCAGCTGCAGGCGTGGCTGTGAGTCTGACAGCCATCGTCGGGCATCAGGACACGATACAGCTGAAGGTGAAGGCGAAGGCCGATGGAGGTGTGGTCCGGTGCATCATTGGTTTCCACCTCTTAGTTTTGTAGTCTAGTTGGGGGATATGTAAACATCATGATCTCAGGTTGGAAAGTATGATTCTACTAGGACCGGATCTTGTGTAGGTGCCTTCAACCAGGCCGCAGCAGTGTTGAAGGCGTGTATTAGAACGCAGAATTGGATGATATGTATCAAGAAGGTCCTCGCTGCCCTCGCATTAGCGGCGTGCTGCGGTGCCATGCGGGGCCAGGGTCAGGGCCAGGGCGTTTCGCCTCTGTACTTTTATCAGCAAGCATAATTGCATCTTCTAACTAGCCTTAGCGAGGCGAGGTTTTGAGGATTAGTAGTTTTAGAAGAAGGAAGTGTCCGTAGTGCTGTCATTCCAGGGCCGGACCTTCTTCAATTGTTGCGGATCGGGATACTATGGCGCCGAAGTTTGCGCTCCGGCTTACGCTGTTCTCGTTGTGGATTTGGAGGGAACTCGTGTTGCCGGAAGCAGATTTCTAGTCGAAAGCCTGCCGCCCGAAATGTGCCATGTTTAATTGTCGATAAGGTTCAAGTTAAATGTTGGATTACATTCATTGTTCTCCGTTGGCTCAAGGCGAGCCACTTGTAAAAAGAAATGCCAAGTTTACCAACTTGAGACTCCTTGCACG

mRNA

>Mapoly0039s0059.11
GCGAGTCGACGGACGGAAAGAAGGAAGGAAGGAAGGAAAGTGGGGCGGGGCGATGAGGGAGGCGAGGAGTACAAGAATGTGGAGTAGTAAGGATATCATTTTGCTGGATGTTGCTGAAGACGATCAAGAGTCGAATTCGAGTGCGAGTCTTTGGTGCTAGAGCGGGAGGGTGGGCGATCCGAGTGCCAGATGTGGACGAGAGAAGCAGCGGAATCGATGGCTGCAGATTCGGGGCCAGTGGGCAGAGGCGGCTCGAGTCTTCCGACGGGAGGATTGAGGAGGGACACGAAGAGCTCTGAGTGATGTGATGCCATTCTGGTAGAGAAAAAGAAGGGATTCTGCTCTTGGGATCGCGCGAGGTCCCTGGGGCCAGCAAGCGCCCAGCTTGCCGAGCGGGCTCTCTGACGTCGAAGGTGCTGCCGCCTCTGTGTGTTTATCCCTGTGTCTCTGTGTTCTAGGCGGTTGTTGGCGGAGGGACGAGGGAGAGGAGTGGCGTTATGTCTGTCTGCTTGACAAGTTGGTACTCCTTGTGGGTCATAAGTTGGGATTTCCTTCCGCCCGTGGCACTGTTTCTGTCGGCGTGAGAAGAGCAAGTTTTCCAGCTCAAGGGACTGGATTTCGAATCGGGAACGGACTGAACACCGGAAGAATCCTCTCCGGTTGTCACTACATCCCCATCAGAGACCATGAGTCACCTCGTTCCCGACTGGGATGGTAACGGTGGAGACTTAGAAGCTGTTTTACCCACAAGCGATTTCTCACTGCCGGTTAAGGGAAAGTGGGACTCATTGCCCCATAAAAGGTCGCACTTGTCTGGTTTGGCCTTCGTGCCAACCCACGATGCTGGCGAAACTGAGTGGGCAGAGGAAAGTCATATTGTAGCTATGCAGAACCAAAGCGGGAAGGGCAACAAGGCTATGTGGCAGCAGATGAATTTCCAGAATGGGTGGTCGAGTGTGCCAGAGTCTGAGGATGCCGTTACTCCTGTGAAGCCCATCAGCTCGTCGTCTCCGGGGAAGGAGCCGGTTCTTGTCAATGAGCCCGCGGTCGACACGCACCACTCCAGTGCCCTCAACATGCAGGAAGACGAGATGGTGTGCTGGCTGCAGTATCCGTTGGACGAACACCTCGAAAGAGACTACTGTTCCGAGTTCTTCGGCGAGCTGCCCAACTCCAACATATCGAACATGCAGCTGATGAAGGATTCATTCGCAGGGCAAAATCAAGTAGCGGGGCGCAACAACAGGAATCCAGGTCCCGTTAACGTAGGGAGTAACAGCAGAATGTCTAGTGCGGATGCGGCGATGGCCATGGGAGCGGGGCGAGCTGCCGGTTTGTTGCCTCAGACAGGGGTGGAGGTTTTCACCAAAGTTCGGACCACTTTGCAACCCTACGGAGGAAAGTGGTCCCCAAATCAGAACAACGCCGGGAAAACGCTGGGAGCGATGACCTCGACCCTGGCTCCGAGCCCGTCAAGATCCCCGCCGATGTCTGGGAACTTGTCGACCCCCATGCTCCCCCCGAAGTCTCAGGGACTCAGCTTCCAGCCTCCCAGAACCTCAGGCCCGATGAATTTCTCGCATTTCTCTCGCCCTGCGGCTGTGATGAAGGCCAATCTCCAGTGCCTAGGAATGTCTCACGTGGCCCCTCCGCACGGGAGCGGGACGAACGTCCGGCTCAAGAGCCAACCCTACAGCGGGAAGCCACCCGTCGACGCAAGCACGTCGACGGGGTCCTCCATTGCAGAGTCAACCACCACGAGGCAACGCAGCGGCGCTTTCCGCAAGGATACCGAATGCCAAGTCGAAGGTTCCGAAGCTCAACAGAGTCTTGGAACCGAATCGAGCTGGCCTTCGATGCAGAATTCGCTGTCGGGCAAGGACACCGACGCTGTCAATTCCTCCGTGGATGGTGTGGACTGCGATTCGAAGCCCGGTATAGCGGATGTGGACAATTGCAGGAATTCTAGCATCACAGGTAGTGGCGGTTTAGGAACTGAAAAGCATCAGTCTCAAGGAGCAGAAGTGCAGGAAGCTCCCGAACCCACCATTACCTCGTCTTCTGGTGGGTCCGGTAATAGTGCAGATAGAGGGAAAGAGGCCGCATCTAGTGGCAAGAGAAGAACCAGGGAAGGAGAGGAGTCCGAGTGCCAGAGCGAACAAGATGGCGAGGACGAGATGGCCCAGCAAAAGAAACCTCAACAGAGAGGCTCCACCACTAAGAGGAGCAGGGCCGCGGAAGTCCACAACCTTTCCGAGCGAAGGCGAAGAGATCGTATCAACGAGAAGATGAAAGCTCTGCAAGAGCTGATCCCCAATTCCAACAAGACGGACAAAGCATCGATGCTGGATGAAGCGATCGAGTACTTGAAGATGCTCCAGTTGCAACTGCAGCAGATGATGTCCATGAGAAGTGGAATGAGCATCCCCTCTATGGTGATGCCGGCGGGAATGCAACACCTTCAAATCCCGCAATTGCCCCAAATGGGCCCAATGCCTCCCATGGGAATGGGAATGGGCATGGGTATGGGCATGGGCCCGATGGGAATGGGAATGAGTATGATGGACATGGGAGGCGGAGCTCCCGGTCGACCGATGATACCCCTTCCGTCTCACAGTGGGCCTTCTCACTCTCACAACGTATCTGCAACCTCACCAGCTGTTTCTATGGTAGACACTCATGACCACCGCCTGCAAAACCCGAGCGTCATGGAGTCACTGAACGTCTTCATGGCGCAACACCGGCAAATGCAAATGGCTCCTCAGCCGATGAGTATGGATGCATTCAGTGCATTCATGATTCATCAGCACCAGCAGCAACACCAGCAGCAGCATCAACAACATCAGCTCCAACACCAACACCAGCATTCGCTCCATCATCTTCCGAGCAGCATGGGCGGTGGAGCCCCCCAATGAAGAGCGGGCCAAATTCTCGGTGGATCTTGATTTCCACGCTTGCTTTCCATTTGTCATGCCATTTCGCATTGGAGGCCAGCGATCTGTCAACAACTATCTGCTGTTCCGCTCTCGGAGAGCGTAATATACTCAGCTGCAGGCGTGGCTGTGAGTCTGACAGCCATCGTCGGGCATCAGGACACGATACAGCTGAAGGTGAAGGCGAAGGCCGATGGAGGTGTGGTCCGGTGCATCATTGGTTTCCACCTCTTAGTTTTGTAGTCTAGTTGGGGGATATGTAAACATCATGATCTCAGGTTGGAAAGTATGATTCTACTAGGACCGGATCTTGTGTAGGTGCCTTCAACCAGGCCGCAGCAGTGTTGAAGGCGTGTATTAGAACGCAGAATTGGATGATATGTATCAAGAAGGTCCTCGCTGCCCTCGCATTAGCGGCGTGCTGCGGTGCCATGCGGGGCCAGGGTCAGGGCCAGGGCGTTTCGCCTCTGTACTTTTATCAGCAAGCATAATTGCATCTTCTAACTAGCCTTAGCGAGGCGAGGTTTTGAGGATTAGTAGTTTTAGAAGAAGGAAGTGTCCGTAGTGCTGTCATTCCAGGGCCGGACCTTCTTCAATTGTTGCGGATCGGGATACTATGGCGCCGAAGTTTGCGCTCCGGCTTACGCTGTTCTCGTTGTGGATTTGGAGGGAACTCGTGTTGCCGGAAGCAGATTTCTAGTCGAAAGCCTGCCGCCCGAAATGTGCCATGTTTAATTGTCGATAAGGTTCAAGTTAAATGTTGGATTACATTCATTGTTCTCCGTTGGCTCAAGGCGAGCCACTTGTAAAAAGAAATGCCAAGTTTACCAACTTGAGACTCCTTGCACG

CDS

>Mapoly0039s0059.11
ATGAGTCACCTCGTTCCCGACTGGGATGGTAACGGTGGAGACTTAGAAGCTGTTTTACCCACAAGCGATTTCTCACTGCCGGTTAAGGGAAAGTGGGACTCATTGCCCCATAAAAGGTCGCACTTGTCTGGTTTGGCCTTCGTGCCAACCCACGATGCTGGCGAAACTGAGTGGGCAGAGGAAAGTCATATTGTAGCTATGCAGAACCAAAGCGGGAAGGGCAACAAGGCTATGTGGCAGCAGATGAATTTCCAGAATGGGTGGTCGAGTGTGCCAGAGTCTGAGGATGCCGTTACTCCTGTGAAGCCCATCAGCTCGTCGTCTCCGGGGAAGGAGCCGGTTCTTGTCAATGAGCCCGCGGTCGACACGCACCACTCCAGTGCCCTCAACATGCAGGAAGACGAGATGGTGTGCTGGCTGCAGTATCCGTTGGACGAACACCTCGAAAGAGACTACTGTTCCGAGTTCTTCGGCGAGCTGCCCAACTCCAACATATCGAACATGCAGCTGATGAAGGATTCATTCGCAGGGCAAAATCAAGTAGCGGGGCGCAACAACAGGAATCCAGGTCCCGTTAACGTAGGGAGTAACAGCAGAATGTCTAGTGCGGATGCGGCGATGGCCATGGGAGCGGGGCGAGCTGCCGGTTTGTTGCCTCAGACAGGGGTGGAGGTTTTCACCAAAGTTCGGACCACTTTGCAACCCTACGGAGGAAAGTGGTCCCCAAATCAGAACAACGCCGGGAAAACGCTGGGAGCGATGACCTCGACCCTGGCTCCGAGCCCGTCAAGATCCCCGCCGATGTCTGGGAACTTGTCGACCCCCATGCTCCCCCCGAAGTCTCAGGGACTCAGCTTCCAGCCTCCCAGAACCTCAGGCCCGATGAATTTCTCGCATTTCTCTCGCCCTGCGGCTGTGATGAAGGCCAATCTCCAGTGCCTAGGAATGTCTCACGTGGCCCCTCCGCACGGGAGCGGGACGAACGTCCGGCTCAAGAGCCAACCCTACAGCGGGAAGCCACCCGTCGACGCAAGCACGTCGACGGGGTCCTCCATTGCAGAGTCAACCACCACGAGGCAACGCAGCGGCGCTTTCCGCAAGGATACCGAATGCCAAGTCGAAGGTTCCGAAGCTCAACAGAGTCTTGGAACCGAATCGAGCTGGCCTTCGATGCAGAATTCGCTGTCGGGCAAGGACACCGACGCTGTCAATTCCTCCGTGGATGGTGTGGACTGCGATTCGAAGCCCGGTATAGCGGATGTGGACAATTGCAGGAATTCTAGCATCACAGGTAGTGGCGGTTTAGGAACTGAAAAGCATCAGTCTCAAGGAGCAGAAGTGCAGGAAGCTCCCGAACCCACCATTACCTCGTCTTCTGGTGGGTCCGGTAATAGTGCAGATAGAGGGAAAGAGGCCGCATCTAGTGGCAAGAGAAGAACCAGGGAAGGAGAGGAGTCCGAGTGCCAGAGCGAACAAGATGGCGAGGACGAGATGGCCCAGCAAAAGAAACCTCAACAGAGAGGCTCCACCACTAAGAGGAGCAGGGCCGCGGAAGTCCACAACCTTTCCGAGCGAAGGCGAAGAGATCGTATCAACGAGAAGATGAAAGCTCTGCAAGAGCTGATCCCCAATTCCAACAAGACGGACAAAGCATCGATGCTGGATGAAGCGATCGAGTACTTGAAGATGCTCCAGTTGCAACTGCAGCAGATGATGTCCATGAGAAGTGGAATGAGCATCCCCTCTATGGTGATGCCGGCGGGAATGCAACACCTTCAAATCCCGCAATTGCCCCAAATGGGCCCAATGCCTCCCATGGGAATGGGAATGGGCATGGGTATGGGCATGGGCCCGATGGGAATGGGAATGAGTATGATGGACATGGGAGGCGGAGCTCCCGGTCGACCGATGATACCCCTTCCGTCTCACAGTGGGCCTTCTCACTCTCACAACGTATCTGCAACCTCACCAGCTGTTTCTATGGTAGACACTCATGACCACCGCCTGCAAAACCCGAGCGTCATGGAGTCACTGAACGTCTTCATGGCGCAACACCGGCAAATGCAAATGGCTCCTCAGCCGATGAGTATGGATGCATTCAGTGCATTCATGATTCATCAGCACCAGCAGCAACACCAGCAGCAGCATCAACAACATCAGCTCCAACACCAACACCAGCATTCGCTCCATCATCTTCCGAGCAGCATGGGCGGTGGAGCCCCCCAATGA

Protein

>Mapoly0039s0059.11
MSHLVPDWDGNGGDLEAVLPTSDFSLPVKGKWDSLPHKRSHLSGLAFVPTHDAGETEWAEESHIVAMQNQSGKGNKAMWQQMNFQNGWSSVPESEDAVTPVKPISSSSPGKEPVLVNEPAVDTHHSSALNMQEDEMVCWLQYPLDEHLERDYCSEFFGELPNSNISNMQLMKDSFAGQNQVAGRNNRNPGPVNVGSNSRMSSADAAMAMGAGRAAGLLPQTGVEVFTKVRTTLQPYGGKWSPNQNNAGKTLGAMTSTLAPSPSRSPPMSGNLSTPMLPPKSQGLSFQPPRTSGPMNFSHFSRPAAVMKANLQCLGMSHVAPPHGSGTNVRLKSQPYSGKPPVDASTSTGSSIAESTTTRQRSGAFRKDTECQVEGSEAQQSLGTESSWPSMQNSLSGKDTDAVNSSVDGVDCDSKPGIADVDNCRNSSITGSGGLGTEKHQSQGAEVQEAPEPTITSSSGGSGNSADRGKEAASSGKRRTREGEESECQSEQDGEDEMAQQKKPQQRGSTTKRSRAAEVHNLSERRRRDRINEKMKALQELIPNSNKTDKASMLDEAIEYLKMLQLQLQQMMSMRSGMSIPSMVMPAGMQHLQIPQLPQMGPMPPMGMGMGMGMGMGPMGMGMSMMDMGGGAPGRPMIPLPSHSGPSHSHNVSATSPAVSMVDTHDHRLQNPSVMESLNVFMAQHRQMQMAPQPMSMDAFSAFMIHQHQQQHQQQHQQHQLQHQHQHSLHHLPSSMGGGAPQ

Mapoly0039s0059.12  

Gene structure:

mRNA scaffold_39:781195..786893  ( - strand )
three_prime_UTR scaffold_39:781195..782061  ( - strand )
CDS scaffold_39:782062..782211  ( - strand )
CDS scaffold_39:782354..782722  ( - strand )
CDS scaffold_39:782835..782900  ( - strand )
CDS scaffold_39:783016..783081  ( - strand )
CDS scaffold_39:783274..783375  ( - strand )
CDS scaffold_39:783497..784880  ( - strand )
CDS scaffold_39:785069..785211  ( - strand )
five_prime_UTR scaffold_39:785212..785214  ( - strand )
five_prime_UTR scaffold_39:785613..785687  ( - strand )
five_prime_UTR scaffold_39:786286..786893  ( - strand )

Sequences:

Gene

>Mapoly0039s0059.12
GCGAGTCGACGGACGGAAAGAAGGAAGGAAGGAAGGAAAGTGGGGCGGGGCGATGAGGGAGGCGAGGAGTACAAGAATGTGGAGTAGTAAGGATATCATTTTGCTGGATGTTGCTGAAGACGATCAAGAGTCGAATTCGAGTGCGAGTCTTTGGTGCTAGAGCGGGAGGGTGGGCGATCCGAGTGCCAGATGTGGACGAGAGAAGCAGCGGAATCGATGGCTGCAGATTCGGGGCCAGTGGGCAGAGGCGGCTCGAGTCTTCCGACGGGAGGATTGAGGAGGGACACGAAGAGCTCTGAGTGATGTGATGCCATTCTGGTAGAGAAAAAGAAGGGATTCTGCTCTTGGGATCGCGCGAGGTCCCTGGGGCCAGCAAGCGCCCAGCTTGCCGAGCGGGCTCTCTGACGTCGAAGGTGCTGCCGCCTCTGTGTGTTTATCCCTGTGTCTCTGTGTTCTAGGCGGTTGTTGGCGGAGGGACGAGGGAGAGGAGTGGCGTTATGTCTGTCTGCTTGACAAGTTGGTACTCCTTGTGGGTCATAAGTTGGGATTTCCTTCCGCCCGTGGCACTGTTTCTGTCGGCGTGAGAAGAGCAAGTTTTCCAGCTCAAGGTTCAGTCCTATCGTTTTTATCTTCGCCTTCCCTCTCCCGCGTGTCTCCATGCATTTGATGACCTTGTCTGTCGGCGACGCTAGCCTCGAGCATCCATGTCAGGCCCACGCCGCTCTAGTGTGTATGTTTGAGTAGACAGCTCTTGTTCTCCCACATAATGAAATGTCCGCGATCACTGAGCCTTGGTAATTTTGATCTCCTTTCTCGCTCACTCTGCCGCAGGAGAGTGTGCAGCTACTTCGTTAAGTGTGCTTGTCCGCACGGTTGACATAACCTCTATGAGATCTTTAGATTCTGAGCGAGATCCTTCTCTTGTGACAGAGCCGTGAGAAAGAGCCGGGGTGGCCTGTTGTATTTCCCGAGGAGATGAATGTACAAACTGCATAAAAACTGCATCTCCTTGATGCTCCGGAATGATGAGGACATGTAAGGAAGCGTTGAGTACACCGACCCAGAAGAATCGTAAATGCATCTGCACTCTGTGTTGTAGAGTTGGGCCCATTTAGTCGACGGCGATAAGTAGCAGATTGACCCGCTTAGCGGCAAGAACCCGTTGTGCCTCTGTTTAAACTGACTGGGTTCGAATTGCTCCTACAGGGACTGGATTTCGAATCGGGAACGGACTGAACACCGGAAGAATCCTCTCCGGTTGTCACTACATCCCCATCAGAGGTGAGTTCAGTGTGGGAAGCCTGTCGAGAGATCGGCGAGCTGGTGATTCTTACTTGCTTTCTGTCTGTGTTTGGAGCGTCTACCTTTCTCGTAATCTACCCATACCTTTCCCGTCACTGAGAAATGAAGAGGCTTTAAAAGTAGGTGAACTTCGAGACTTGGGTGCCATGAGAGTAGATTAGAAGTAGGACGAGCAGGAGACGACTGCAAACTGTCGAAGTCTTCACCTCTCATCTTCTCATTCCCACTGCCATGCCTTACTCACGACCATCCACTACCTCTATGTATGTGGGAGCGCTTCTGGCGAAGCGCTGGGCATTGACAGTGACAGGCCGAGAAGTCGATGCCGTAGCAGTCTAGGTAGGCATTTGATTTACCTCCTCCTGTTTGACTCGCAGACCATGAGTCACCTCGTTCCCGACTGGGATGGTAACGGTGGAGACTTAGAAGCTGTTTTACCCACAAGCGATTTCTCACTGCCGGTTAAGGGAAAGTGGGACTCATTGCCCCATAAAAGGTCGCACTTGTCTGGTTTGGCCTTCGTGTAAGCGCTTGCTCCGGCTTTTCAATCCCCATAGTTTTTTGTGTTCTTGATACCATTGTATGTAAGGTCAATTTCTTGATTGTGGATCTTTGAGAATGCCACTTCGTGATGCCGGCTCGTTGACATGCTGCTCTTCGTCACATGAGCTTCGAAGAGATGTTAAAGGTCGCGTTCTTCTTCTTCTACAGGCCAACCCACGATGCTGGCGAAACTGAGTGGGCAGAGGAAAGTCATATTGTAGCTATGCAGAACCAAAGCGGGAAGGGCAACAAGGCTATGTGGCAGCAGATGAATTTCCAGAATGGGTGGTCGAGTGTGCCAGAGTCTGAGGATGCCGTTACTCCTGTGAAGCCCATCAGCTCGTCGTCTCCGGGGAAGGAGCCGGTTCTTGTCAATGAGCCCGCGGTCGACACGCACCACTCCAGTGCCCTCAACATGCAGGAAGACGAGATGGTGTGCTGGCTGCAGTATCCGTTGGACGAACACCTCGAAAGAGACTACTGTTCCGAGTTCTTCGGCGAGCTGCCCAACTCCAACATATCGAACATGCAGCTGATGAAGGATTCATTCGCAGGGCAAAATCAAGTAGCGGGGCGCAACAACAGGAATCCAGGTCCCGTTAACGTAGGGAGTAACAGCAGAATGTCTAGTGCGGATGCGGCGATGGCCATGGGAGCGGGGCGAGCTGCCGGTTTGTTGCCTCAGACAGGGGTGGAGGTTTTCACCAAAGTTCGGACCACTTTGCAACCCTACGGAGGAAAGTGGTCCCCAAATCAGAACAACGCCGGGAAAACGCTGGGAGCGATGACCTCGACCCTGGCTCCGAGCCCGTCAAGATCCCCGCCGATGTCTGGGAACTTGTCGACCCCCATGCTCCCCCCGAAGTCTCAGGGACTCAGCTTCCAGCCTCCCAGAACCTCAGGCCCGATGAATTTCTCGCATTTCTCTCGCCCTGCGGCTGTGATGAAGGCCAATCTCCAGTGCCTAGGAATGTCTCACGTGGCCCCTCCGCACGGGAGCGGGACGAACGTCCGGCTCAAGAGCCAACCCTACAGCGGGAAGCCACCCGTCGACGCAAGCACGTCGACGGGGTCCTCCATTGCAGAGTCAACCACCACGAGGCAACGCAGCGGCGCTTTCCGCAAGGATACCGAATGCCAAGTCGAAGGTTCCGAAGCTCAACAGAGTCTTGGAACCGAATCGAGCTGGCCTTCGATGCAGAATTCGCTGTCGGGCAAGGACACCGACGCTGTCAATTCCTCCGTGGATGGTGTGGACTGCGATTCGAAGCCCGGTATAGCGGATGTGGACAATTGCAGGAATTCTAGCATCACAGGTAGTGGCGGTTTAGGAACTGAAAAGCATCAGTCTCAAGGAGCAGAAGTGCAGGAAGCTCCCGAACCCACCATTACCTCGTCTTCTGGTGGGTCCGGTAATAGTGCAGATAGAGGGAAAGAGGCCGCATCTAGTGGCAAGAGAAGAACCAGGGAAGGAGAGGAGTCCGAGTGCCAGAGCGAAGTGAGTAACTTGTTGCAACCCCAAGGGAGTCAAGTTGGTGCAGTAGCCCACAGGGTATGTTTTATCTAGTGATGCTAACTTTTTCCTGAATAACATCCCACTGACTGCTCTTTTTATGCGAGGATGTGTGAGAAGTGTACTTGCGTTTAATAAAAGCCAATGTTGTTTCTGGCAGCAAGATGGCGAGGACGAGATGGCCCAGCAAAAGAAACCTCAACAGAGAGGCTCCACCACTAAGAGGAGCAGGGCCGCGGAAGTCCACAACCTTTCCGAGCGAGTGAGAGTCCACCACTAACTGAGAAATTGAGCTCTGCGCCAATTGTACAGGATGGTCCAAGCCGTGAGCATATGACGGCAGTGGACAATCTAGGTCTCAAATCTTGTTTGGGTCGTCAATTTTGTGACTGATGTTAGTTTTGAAGCTCTTGGCTTCCGCAGCTTTACTGATAGAATTTCCTGCCCATTTCAGAGGCGAAGAGATCGTATCAACGAGAAGATGAAAGCTCTGCAAGAGCTGATCCCCAATTCCAACAAGGTTTGTTACAGCTTTCAGCCTTGTTCTTCGTACCTTGCCTCTTCTTTTGGATCACCGTGCGGTAACTTGCCCTTGAAATACAGTCAATGATGCAGACTTTTGATTCATATTGCAGACGGACAAAGCATCGATGCTGGATGAAGCGATCGAGTACTTGAAGATGCTCCAGTTGCAACTGCAGGTAACTATCCCAGCCTTTGACCTTCGCAGTAGTTCTCTGCTCCTCCTTGCGATGCAGGTGCTGTAGAGACGCCCGAGCACAAATACTGAATTCAATTTGCCCTCTTTAGCAGATGATGTCCATGAGAAGTGGAATGAGCATCCCCTCTATGGTGATGCCGGCGGGAATGCAACACCTTCAAATCCCGCAATTGCCCCAAATGGGCCCAATGCCTCCCATGGGAATGGGAATGGGCATGGGTATGGGCATGGGCCCGATGGGAATGGGAATGAGTATGATGGACATGGGAGGCGGAGCTCCCGGTCGACCGATGATACCCCTTCCGTCTCACAGTGGGCCTTCTCACTCTCACAACGTATCTGCAACCTCACCAGCTGTTTCTATGGTAGACACTCATGACCACCGCCTGCAAAACCCGAGCGTCATGGAGTCACTGAACGTCTTCATGGCGCAACACCGGCAAATGCAAATGGCTCCTCAGGTGATCCTTCTCTTTGAATGCCGGCTGGTTCTGTCCGATCTTCTGTCAGCTTTGTTTTTTGTGCAAATTTCCTAGGAGGAAGGAGCATGTGGTTGGGAGACGATGAAGTCTTGATTCTTACTCACTGTGCCTGTTCTTGCAGCCGATGAGTATGGATGCATTCAGTGCATTCATGATTCATCAGCACCAGCAGCAACACCAGCAGCAGCATCAACAACATCAGCTCCAACACCAACACCAGCATTCGCTCCATCATCTTCCGAGCAGCATGGGCGGTGGAGCCCCCCAATGAAGAGCGGGCCAAATTCTCGGTGGATCTTGATTTCCACGCTTGCTTTCCATTTGTCATGCCATTTCGCATTGGAGGCCAGCGATCTGTCAACAACTATCTGCTGTTCCGCTCTCGGAGAGCGTAATATACTCAGCTGCAGGCGTGGCTGTGAGTCTGACAGCCATCGTCGGGCATCAGGACACGATACAGCTGAAGGTGAAGGCGAAGGCCGATGGAGGTGTGGTCCGGTGCATCATTGGTTTCCACCTCTTAGTTTTGTAGTCTAGTTGGGGGATATGTAAACATCATGATCTCAGGTTGGAAAGTATGATTCTACTAGGACCGGATCTTGTGTAGGTGCCTTCAACCAGGCCGCAGCAGTGTTGAAGGCGTGTATTAGAACGCAGAATTGGATGATATGTATCAAGAAGGTCCTCGCTGCCCTCGCATTAGCGGCGTGCTGCGGTGCCATGCGGGGCCAGGGTCAGGGCCAGGGCGTTTCGCCTCTGTACTTTTATCAGCAAGCATAATTGCATCTTCTAACTAGCCTTAGCGAGGCGAGGTTTTGAGGATTAGTAGTTTTAGAAGAAGGAAGTGTCCGTAGTGCTGTCATTCCAGGGCCGGACCTTCTTCAATTGTTGCGGATCGGGATACTATGGCGCCGAAGTTTGCGCTCCGGCTTACGCTGTTCTCGTTGTGGATTTGGAGGGAACTCGTGTTGCCGGAAGCAGATTTCTAGTCGAAAGCCTGCCGCCCGAAATGTGCCATGTTTAATTGTCGATAAGGTTCAAGTTAAATGTTGGATTACATTCATTGTTCTCCGTTGGCTCAAGGCGAGCCACTTGTAAAAAGAAATGCCAAGTTTACCAACTTGAGACTCCTTGCACG

mRNA

>Mapoly0039s0059.12
GCGAGTCGACGGACGGAAAGAAGGAAGGAAGGAAGGAAAGTGGGGCGGGGCGATGAGGGAGGCGAGGAGTACAAGAATGTGGAGTAGTAAGGATATCATTTTGCTGGATGTTGCTGAAGACGATCAAGAGTCGAATTCGAGTGCGAGTCTTTGGTGCTAGAGCGGGAGGGTGGGCGATCCGAGTGCCAGATGTGGACGAGAGAAGCAGCGGAATCGATGGCTGCAGATTCGGGGCCAGTGGGCAGAGGCGGCTCGAGTCTTCCGACGGGAGGATTGAGGAGGGACACGAAGAGCTCTGAGTGATGTGATGCCATTCTGGTAGAGAAAAAGAAGGGATTCTGCTCTTGGGATCGCGCGAGGTCCCTGGGGCCAGCAAGCGCCCAGCTTGCCGAGCGGGCTCTCTGACGTCGAAGGTGCTGCCGCCTCTGTGTGTTTATCCCTGTGTCTCTGTGTTCTAGGCGGTTGTTGGCGGAGGGACGAGGGAGAGGAGTGGCGTTATGTCTGTCTGCTTGACAAGTTGGTACTCCTTGTGGGTCATAAGTTGGGATTTCCTTCCGCCCGTGGCACTGTTTCTGTCGGCGTGAGAAGAGCAAGTTTTCCAGCTCAAGGGACTGGATTTCGAATCGGGAACGGACTGAACACCGGAAGAATCCTCTCCGGTTGTCACTACATCCCCATCAGAGACCATGAGTCACCTCGTTCCCGACTGGGATGGTAACGGTGGAGACTTAGAAGCTGTTTTACCCACAAGCGATTTCTCACTGCCGGTTAAGGGAAAGTGGGACTCATTGCCCCATAAAAGGTCGCACTTGTCTGGTTTGGCCTTCGTGCCAACCCACGATGCTGGCGAAACTGAGTGGGCAGAGGAAAGTCATATTGTAGCTATGCAGAACCAAAGCGGGAAGGGCAACAAGGCTATGTGGCAGCAGATGAATTTCCAGAATGGGTGGTCGAGTGTGCCAGAGTCTGAGGATGCCGTTACTCCTGTGAAGCCCATCAGCTCGTCGTCTCCGGGGAAGGAGCCGGTTCTTGTCAATGAGCCCGCGGTCGACACGCACCACTCCAGTGCCCTCAACATGCAGGAAGACGAGATGGTGTGCTGGCTGCAGTATCCGTTGGACGAACACCTCGAAAGAGACTACTGTTCCGAGTTCTTCGGCGAGCTGCCCAACTCCAACATATCGAACATGCAGCTGATGAAGGATTCATTCGCAGGGCAAAATCAAGTAGCGGGGCGCAACAACAGGAATCCAGGTCCCGTTAACGTAGGGAGTAACAGCAGAATGTCTAGTGCGGATGCGGCGATGGCCATGGGAGCGGGGCGAGCTGCCGGTTTGTTGCCTCAGACAGGGGTGGAGGTTTTCACCAAAGTTCGGACCACTTTGCAACCCTACGGAGGAAAGTGGTCCCCAAATCAGAACAACGCCGGGAAAACGCTGGGAGCGATGACCTCGACCCTGGCTCCGAGCCCGTCAAGATCCCCGCCGATGTCTGGGAACTTGTCGACCCCCATGCTCCCCCCGAAGTCTCAGGGACTCAGCTTCCAGCCTCCCAGAACCTCAGGCCCGATGAATTTCTCGCATTTCTCTCGCCCTGCGGCTGTGATGAAGGCCAATCTCCAGTGCCTAGGAATGTCTCACGTGGCCCCTCCGCACGGGAGCGGGACGAACGTCCGGCTCAAGAGCCAACCCTACAGCGGGAAGCCACCCGTCGACGCAAGCACGTCGACGGGGTCCTCCATTGCAGAGTCAACCACCACGAGGCAACGCAGCGGCGCTTTCCGCAAGGATACCGAATGCCAAGTCGAAGGTTCCGAAGCTCAACAGAGTCTTGGAACCGAATCGAGCTGGCCTTCGATGCAGAATTCGCTGTCGGGCAAGGACACCGACGCTGTCAATTCCTCCGTGGATGGTGTGGACTGCGATTCGAAGCCCGGTATAGCGGATGTGGACAATTGCAGGAATTCTAGCATCACAGGTAGTGGCGGTTTAGGAACTGAAAAGCATCAGTCTCAAGGAGCAGAAGTGCAGGAAGCTCCCGAACCCACCATTACCTCGTCTTCTGGTGGGTCCGGTAATAGTGCAGATAGAGGGAAAGAGGCCGCATCTAGTGGCAAGAGAAGAACCAGGGAAGGAGAGGAGTCCGAGTGCCAGAGCGAAGTGAGTAACTTGTTGCAACCCCAAGGGAGTCAAGTTGGTGCAGTAGCCCACAGGCAAGATGGCGAGGACGAGATGGCCCAGCAAAAGAAACCTCAACAGAGAGGCTCCACCACTAAGAGGAGCAGGGCCGCGGAAGTCCACAACCTTTCCGAGCGAAGGCGAAGAGATCGTATCAACGAGAAGATGAAAGCTCTGCAAGAGCTGATCCCCAATTCCAACAAGACGGACAAAGCATCGATGCTGGATGAAGCGATCGAGTACTTGAAGATGCTCCAGTTGCAACTGCAGATGATGTCCATGAGAAGTGGAATGAGCATCCCCTCTATGGTGATGCCGGCGGGAATGCAACACCTTCAAATCCCGCAATTGCCCCAAATGGGCCCAATGCCTCCCATGGGAATGGGAATGGGCATGGGTATGGGCATGGGCCCGATGGGAATGGGAATGAGTATGATGGACATGGGAGGCGGAGCTCCCGGTCGACCGATGATACCCCTTCCGTCTCACAGTGGGCCTTCTCACTCTCACAACGTATCTGCAACCTCACCAGCTGTTTCTATGGTAGACACTCATGACCACCGCCTGCAAAACCCGAGCGTCATGGAGTCACTGAACGTCTTCATGGCGCAACACCGGCAAATGCAAATGGCTCCTCAGCCGATGAGTATGGATGCATTCAGTGCATTCATGATTCATCAGCACCAGCAGCAACACCAGCAGCAGCATCAACAACATCAGCTCCAACACCAACACCAGCATTCGCTCCATCATCTTCCGAGCAGCATGGGCGGTGGAGCCCCCCAATGAAGAGCGGGCCAAATTCTCGGTGGATCTTGATTTCCACGCTTGCTTTCCATTTGTCATGCCATTTCGCATTGGAGGCCAGCGATCTGTCAACAACTATCTGCTGTTCCGCTCTCGGAGAGCGTAATATACTCAGCTGCAGGCGTGGCTGTGAGTCTGACAGCCATCGTCGGGCATCAGGACACGATACAGCTGAAGGTGAAGGCGAAGGCCGATGGAGGTGTGGTCCGGTGCATCATTGGTTTCCACCTCTTAGTTTTGTAGTCTAGTTGGGGGATATGTAAACATCATGATCTCAGGTTGGAAAGTATGATTCTACTAGGACCGGATCTTGTGTAGGTGCCTTCAACCAGGCCGCAGCAGTGTTGAAGGCGTGTATTAGAACGCAGAATTGGATGATATGTATCAAGAAGGTCCTCGCTGCCCTCGCATTAGCGGCGTGCTGCGGTGCCATGCGGGGCCAGGGTCAGGGCCAGGGCGTTTCGCCTCTGTACTTTTATCAGCAAGCATAATTGCATCTTCTAACTAGCCTTAGCGAGGCGAGGTTTTGAGGATTAGTAGTTTTAGAAGAAGGAAGTGTCCGTAGTGCTGTCATTCCAGGGCCGGACCTTCTTCAATTGTTGCGGATCGGGATACTATGGCGCCGAAGTTTGCGCTCCGGCTTACGCTGTTCTCGTTGTGGATTTGGAGGGAACTCGTGTTGCCGGAAGCAGATTTCTAGTCGAAAGCCTGCCGCCCGAAATGTGCCATGTTTAATTGTCGATAAGGTTCAAGTTAAATGTTGGATTACATTCATTGTTCTCCGTTGGCTCAAGGCGAGCCACTTGTAAAAAGAAATGCCAAGTTTACCAACTTGAGACTCCTTGCACG

CDS

>Mapoly0039s0059.12
ATGAGTCACCTCGTTCCCGACTGGGATGGTAACGGTGGAGACTTAGAAGCTGTTTTACCCACAAGCGATTTCTCACTGCCGGTTAAGGGAAAGTGGGACTCATTGCCCCATAAAAGGTCGCACTTGTCTGGTTTGGCCTTCGTGCCAACCCACGATGCTGGCGAAACTGAGTGGGCAGAGGAAAGTCATATTGTAGCTATGCAGAACCAAAGCGGGAAGGGCAACAAGGCTATGTGGCAGCAGATGAATTTCCAGAATGGGTGGTCGAGTGTGCCAGAGTCTGAGGATGCCGTTACTCCTGTGAAGCCCATCAGCTCGTCGTCTCCGGGGAAGGAGCCGGTTCTTGTCAATGAGCCCGCGGTCGACACGCACCACTCCAGTGCCCTCAACATGCAGGAAGACGAGATGGTGTGCTGGCTGCAGTATCCGTTGGACGAACACCTCGAAAGAGACTACTGTTCCGAGTTCTTCGGCGAGCTGCCCAACTCCAACATATCGAACATGCAGCTGATGAAGGATTCATTCGCAGGGCAAAATCAAGTAGCGGGGCGCAACAACAGGAATCCAGGTCCCGTTAACGTAGGGAGTAACAGCAGAATGTCTAGTGCGGATGCGGCGATGGCCATGGGAGCGGGGCGAGCTGCCGGTTTGTTGCCTCAGACAGGGGTGGAGGTTTTCACCAAAGTTCGGACCACTTTGCAACCCTACGGAGGAAAGTGGTCCCCAAATCAGAACAACGCCGGGAAAACGCTGGGAGCGATGACCTCGACCCTGGCTCCGAGCCCGTCAAGATCCCCGCCGATGTCTGGGAACTTGTCGACCCCCATGCTCCCCCCGAAGTCTCAGGGACTCAGCTTCCAGCCTCCCAGAACCTCAGGCCCGATGAATTTCTCGCATTTCTCTCGCCCTGCGGCTGTGATGAAGGCCAATCTCCAGTGCCTAGGAATGTCTCACGTGGCCCCTCCGCACGGGAGCGGGACGAACGTCCGGCTCAAGAGCCAACCCTACAGCGGGAAGCCACCCGTCGACGCAAGCACGTCGACGGGGTCCTCCATTGCAGAGTCAACCACCACGAGGCAACGCAGCGGCGCTTTCCGCAAGGATACCGAATGCCAAGTCGAAGGTTCCGAAGCTCAACAGAGTCTTGGAACCGAATCGAGCTGGCCTTCGATGCAGAATTCGCTGTCGGGCAAGGACACCGACGCTGTCAATTCCTCCGTGGATGGTGTGGACTGCGATTCGAAGCCCGGTATAGCGGATGTGGACAATTGCAGGAATTCTAGCATCACAGGTAGTGGCGGTTTAGGAACTGAAAAGCATCAGTCTCAAGGAGCAGAAGTGCAGGAAGCTCCCGAACCCACCATTACCTCGTCTTCTGGTGGGTCCGGTAATAGTGCAGATAGAGGGAAAGAGGCCGCATCTAGTGGCAAGAGAAGAACCAGGGAAGGAGAGGAGTCCGAGTGCCAGAGCGAAGTGAGTAACTTGTTGCAACCCCAAGGGAGTCAAGTTGGTGCAGTAGCCCACAGGCAAGATGGCGAGGACGAGATGGCCCAGCAAAAGAAACCTCAACAGAGAGGCTCCACCACTAAGAGGAGCAGGGCCGCGGAAGTCCACAACCTTTCCGAGCGAAGGCGAAGAGATCGTATCAACGAGAAGATGAAAGCTCTGCAAGAGCTGATCCCCAATTCCAACAAGACGGACAAAGCATCGATGCTGGATGAAGCGATCGAGTACTTGAAGATGCTCCAGTTGCAACTGCAGATGATGTCCATGAGAAGTGGAATGAGCATCCCCTCTATGGTGATGCCGGCGGGAATGCAACACCTTCAAATCCCGCAATTGCCCCAAATGGGCCCAATGCCTCCCATGGGAATGGGAATGGGCATGGGTATGGGCATGGGCCCGATGGGAATGGGAATGAGTATGATGGACATGGGAGGCGGAGCTCCCGGTCGACCGATGATACCCCTTCCGTCTCACAGTGGGCCTTCTCACTCTCACAACGTATCTGCAACCTCACCAGCTGTTTCTATGGTAGACACTCATGACCACCGCCTGCAAAACCCGAGCGTCATGGAGTCACTGAACGTCTTCATGGCGCAACACCGGCAAATGCAAATGGCTCCTCAGCCGATGAGTATGGATGCATTCAGTGCATTCATGATTCATCAGCACCAGCAGCAACACCAGCAGCAGCATCAACAACATCAGCTCCAACACCAACACCAGCATTCGCTCCATCATCTTCCGAGCAGCATGGGCGGTGGAGCCCCCCAATGA

Protein

>Mapoly0039s0059.12
MSHLVPDWDGNGGDLEAVLPTSDFSLPVKGKWDSLPHKRSHLSGLAFVPTHDAGETEWAEESHIVAMQNQSGKGNKAMWQQMNFQNGWSSVPESEDAVTPVKPISSSSPGKEPVLVNEPAVDTHHSSALNMQEDEMVCWLQYPLDEHLERDYCSEFFGELPNSNISNMQLMKDSFAGQNQVAGRNNRNPGPVNVGSNSRMSSADAAMAMGAGRAAGLLPQTGVEVFTKVRTTLQPYGGKWSPNQNNAGKTLGAMTSTLAPSPSRSPPMSGNLSTPMLPPKSQGLSFQPPRTSGPMNFSHFSRPAAVMKANLQCLGMSHVAPPHGSGTNVRLKSQPYSGKPPVDASTSTGSSIAESTTTRQRSGAFRKDTECQVEGSEAQQSLGTESSWPSMQNSLSGKDTDAVNSSVDGVDCDSKPGIADVDNCRNSSITGSGGLGTEKHQSQGAEVQEAPEPTITSSSGGSGNSADRGKEAASSGKRRTREGEESECQSEVSNLLQPQGSQVGAVAHRQDGEDEMAQQKKPQQRGSTTKRSRAAEVHNLSERRRRDRINEKMKALQELIPNSNKTDKASMLDEAIEYLKMLQLQLQMMSMRSGMSIPSMVMPAGMQHLQIPQLPQMGPMPPMGMGMGMGMGMGPMGMGMSMMDMGGGAPGRPMIPLPSHSGPSHSHNVSATSPAVSMVDTHDHRLQNPSVMESLNVFMAQHRQMQMAPQPMSMDAFSAFMIHQHQQQHQQQHQQHQLQHQHQHSLHHLPSSMGGGAPQ

Mapoly0039s0059.13  

Gene structure:

mRNA scaffold_39:781195..786893  ( - strand )
three_prime_UTR scaffold_39:781195..782061  ( - strand )
CDS scaffold_39:782062..782211  ( - strand )
CDS scaffold_39:782354..782725  ( - strand )
CDS scaffold_39:782835..782900  ( - strand )
CDS scaffold_39:783016..783081  ( - strand )
CDS scaffold_39:783274..783375  ( - strand )
CDS scaffold_39:783497..784880  ( - strand )
CDS scaffold_39:785069..785211  ( - strand )
five_prime_UTR scaffold_39:785212..785214  ( - strand )
five_prime_UTR scaffold_39:785613..785687  ( - strand )
five_prime_UTR scaffold_39:786286..786893  ( - strand )

Sequences:

Gene

>Mapoly0039s0059.13
GCGAGTCGACGGACGGAAAGAAGGAAGGAAGGAAGGAAAGTGGGGCGGGGCGATGAGGGAGGCGAGGAGTACAAGAATGTGGAGTAGTAAGGATATCATTTTGCTGGATGTTGCTGAAGACGATCAAGAGTCGAATTCGAGTGCGAGTCTTTGGTGCTAGAGCGGGAGGGTGGGCGATCCGAGTGCCAGATGTGGACGAGAGAAGCAGCGGAATCGATGGCTGCAGATTCGGGGCCAGTGGGCAGAGGCGGCTCGAGTCTTCCGACGGGAGGATTGAGGAGGGACACGAAGAGCTCTGAGTGATGTGATGCCATTCTGGTAGAGAAAAAGAAGGGATTCTGCTCTTGGGATCGCGCGAGGTCCCTGGGGCCAGCAAGCGCCCAGCTTGCCGAGCGGGCTCTCTGACGTCGAAGGTGCTGCCGCCTCTGTGTGTTTATCCCTGTGTCTCTGTGTTCTAGGCGGTTGTTGGCGGAGGGACGAGGGAGAGGAGTGGCGTTATGTCTGTCTGCTTGACAAGTTGGTACTCCTTGTGGGTCATAAGTTGGGATTTCCTTCCGCCCGTGGCACTGTTTCTGTCGGCGTGAGAAGAGCAAGTTTTCCAGCTCAAGGTTCAGTCCTATCGTTTTTATCTTCGCCTTCCCTCTCCCGCGTGTCTCCATGCATTTGATGACCTTGTCTGTCGGCGACGCTAGCCTCGAGCATCCATGTCAGGCCCACGCCGCTCTAGTGTGTATGTTTGAGTAGACAGCTCTTGTTCTCCCACATAATGAAATGTCCGCGATCACTGAGCCTTGGTAATTTTGATCTCCTTTCTCGCTCACTCTGCCGCAGGAGAGTGTGCAGCTACTTCGTTAAGTGTGCTTGTCCGCACGGTTGACATAACCTCTATGAGATCTTTAGATTCTGAGCGAGATCCTTCTCTTGTGACAGAGCCGTGAGAAAGAGCCGGGGTGGCCTGTTGTATTTCCCGAGGAGATGAATGTACAAACTGCATAAAAACTGCATCTCCTTGATGCTCCGGAATGATGAGGACATGTAAGGAAGCGTTGAGTACACCGACCCAGAAGAATCGTAAATGCATCTGCACTCTGTGTTGTAGAGTTGGGCCCATTTAGTCGACGGCGATAAGTAGCAGATTGACCCGCTTAGCGGCAAGAACCCGTTGTGCCTCTGTTTAAACTGACTGGGTTCGAATTGCTCCTACAGGGACTGGATTTCGAATCGGGAACGGACTGAACACCGGAAGAATCCTCTCCGGTTGTCACTACATCCCCATCAGAGGTGAGTTCAGTGTGGGAAGCCTGTCGAGAGATCGGCGAGCTGGTGATTCTTACTTGCTTTCTGTCTGTGTTTGGAGCGTCTACCTTTCTCGTAATCTACCCATACCTTTCCCGTCACTGAGAAATGAAGAGGCTTTAAAAGTAGGTGAACTTCGAGACTTGGGTGCCATGAGAGTAGATTAGAAGTAGGACGAGCAGGAGACGACTGCAAACTGTCGAAGTCTTCACCTCTCATCTTCTCATTCCCACTGCCATGCCTTACTCACGACCATCCACTACCTCTATGTATGTGGGAGCGCTTCTGGCGAAGCGCTGGGCATTGACAGTGACAGGCCGAGAAGTCGATGCCGTAGCAGTCTAGGTAGGCATTTGATTTACCTCCTCCTGTTTGACTCGCAGACCATGAGTCACCTCGTTCCCGACTGGGATGGTAACGGTGGAGACTTAGAAGCTGTTTTACCCACAAGCGATTTCTCACTGCCGGTTAAGGGAAAGTGGGACTCATTGCCCCATAAAAGGTCGCACTTGTCTGGTTTGGCCTTCGTGTAAGCGCTTGCTCCGGCTTTTCAATCCCCATAGTTTTTTGTGTTCTTGATACCATTGTATGTAAGGTCAATTTCTTGATTGTGGATCTTTGAGAATGCCACTTCGTGATGCCGGCTCGTTGACATGCTGCTCTTCGTCACATGAGCTTCGAAGAGATGTTAAAGGTCGCGTTCTTCTTCTTCTACAGGCCAACCCACGATGCTGGCGAAACTGAGTGGGCAGAGGAAAGTCATATTGTAGCTATGCAGAACCAAAGCGGGAAGGGCAACAAGGCTATGTGGCAGCAGATGAATTTCCAGAATGGGTGGTCGAGTGTGCCAGAGTCTGAGGATGCCGTTACTCCTGTGAAGCCCATCAGCTCGTCGTCTCCGGGGAAGGAGCCGGTTCTTGTCAATGAGCCCGCGGTCGACACGCACCACTCCAGTGCCCTCAACATGCAGGAAGACGAGATGGTGTGCTGGCTGCAGTATCCGTTGGACGAACACCTCGAAAGAGACTACTGTTCCGAGTTCTTCGGCGAGCTGCCCAACTCCAACATATCGAACATGCAGCTGATGAAGGATTCATTCGCAGGGCAAAATCAAGTAGCGGGGCGCAACAACAGGAATCCAGGTCCCGTTAACGTAGGGAGTAACAGCAGAATGTCTAGTGCGGATGCGGCGATGGCCATGGGAGCGGGGCGAGCTGCCGGTTTGTTGCCTCAGACAGGGGTGGAGGTTTTCACCAAAGTTCGGACCACTTTGCAACCCTACGGAGGAAAGTGGTCCCCAAATCAGAACAACGCCGGGAAAACGCTGGGAGCGATGACCTCGACCCTGGCTCCGAGCCCGTCAAGATCCCCGCCGATGTCTGGGAACTTGTCGACCCCCATGCTCCCCCCGAAGTCTCAGGGACTCAGCTTCCAGCCTCCCAGAACCTCAGGCCCGATGAATTTCTCGCATTTCTCTCGCCCTGCGGCTGTGATGAAGGCCAATCTCCAGTGCCTAGGAATGTCTCACGTGGCCCCTCCGCACGGGAGCGGGACGAACGTCCGGCTCAAGAGCCAACCCTACAGCGGGAAGCCACCCGTCGACGCAAGCACGTCGACGGGGTCCTCCATTGCAGAGTCAACCACCACGAGGCAACGCAGCGGCGCTTTCCGCAAGGATACCGAATGCCAAGTCGAAGGTTCCGAAGCTCAACAGAGTCTTGGAACCGAATCGAGCTGGCCTTCGATGCAGAATTCGCTGTCGGGCAAGGACACCGACGCTGTCAATTCCTCCGTGGATGGTGTGGACTGCGATTCGAAGCCCGGTATAGCGGATGTGGACAATTGCAGGAATTCTAGCATCACAGGTAGTGGCGGTTTAGGAACTGAAAAGCATCAGTCTCAAGGAGCAGAAGTGCAGGAAGCTCCCGAACCCACCATTACCTCGTCTTCTGGTGGGTCCGGTAATAGTGCAGATAGAGGGAAAGAGGCCGCATCTAGTGGCAAGAGAAGAACCAGGGAAGGAGAGGAGTCCGAGTGCCAGAGCGAAGTGAGTAACTTGTTGCAACCCCAAGGGAGTCAAGTTGGTGCAGTAGCCCACAGGGTATGTTTTATCTAGTGATGCTAACTTTTTCCTGAATAACATCCCACTGACTGCTCTTTTTATGCGAGGATGTGTGAGAAGTGTACTTGCGTTTAATAAAAGCCAATGTTGTTTCTGGCAGCAAGATGGCGAGGACGAGATGGCCCAGCAAAAGAAACCTCAACAGAGAGGCTCCACCACTAAGAGGAGCAGGGCCGCGGAAGTCCACAACCTTTCCGAGCGAGTGAGAGTCCACCACTAACTGAGAAATTGAGCTCTGCGCCAATTGTACAGGATGGTCCAAGCCGTGAGCATATGACGGCAGTGGACAATCTAGGTCTCAAATCTTGTTTGGGTCGTCAATTTTGTGACTGATGTTAGTTTTGAAGCTCTTGGCTTCCGCAGCTTTACTGATAGAATTTCCTGCCCATTTCAGAGGCGAAGAGATCGTATCAACGAGAAGATGAAAGCTCTGCAAGAGCTGATCCCCAATTCCAACAAGGTTTGTTACAGCTTTCAGCCTTGTTCTTCGTACCTTGCCTCTTCTTTTGGATCACCGTGCGGTAACTTGCCCTTGAAATACAGTCAATGATGCAGACTTTTGATTCATATTGCAGACGGACAAAGCATCGATGCTGGATGAAGCGATCGAGTACTTGAAGATGCTCCAGTTGCAACTGCAGGTAACTATCCCAGCCTTTGACCTTCGCAGTAGTTCTCTGCTCCTCCTTGCGATGCAGGTGCTGTAGAGACGCCCGAGCACAAATACTGAATTCAATTTGCCCTCTTTAGCAGATGATGTCCATGAGAAGTGGAATGAGCATCCCCTCTATGGTGATGCCGGCGGGAATGCAACACCTTCAAATCCCGCAATTGCCCCAAATGGGCCCAATGCCTCCCATGGGAATGGGAATGGGCATGGGTATGGGCATGGGCCCGATGGGAATGGGAATGAGTATGATGGACATGGGAGGCGGAGCTCCCGGTCGACCGATGATACCCCTTCCGTCTCACAGTGGGCCTTCTCACTCTCACAACGTATCTGCAACCTCACCAGCTGTTTCTATGGTAGACACTCATGACCACCGCCTGCAAAACCCGAGCGTCATGGAGTCACTGAACGTCTTCATGGCGCAACACCGGCAAATGCAAATGGCTCCTCAGGTGATCCTTCTCTTTGAATGCCGGCTGGTTCTGTCCGATCTTCTGTCAGCTTTGTTTTTTGTGCAAATTTCCTAGGAGGAAGGAGCATGTGGTTGGGAGACGATGAAGTCTTGATTCTTACTCACTGTGCCTGTTCTTGCAGCCGATGAGTATGGATGCATTCAGTGCATTCATGATTCATCAGCACCAGCAGCAACACCAGCAGCAGCATCAACAACATCAGCTCCAACACCAACACCAGCATTCGCTCCATCATCTTCCGAGCAGCATGGGCGGTGGAGCCCCCCAATGAAGAGCGGGCCAAATTCTCGGTGGATCTTGATTTCCACGCTTGCTTTCCATTTGTCATGCCATTTCGCATTGGAGGCCAGCGATCTGTCAACAACTATCTGCTGTTCCGCTCTCGGAGAGCGTAATATACTCAGCTGCAGGCGTGGCTGTGAGTCTGACAGCCATCGTCGGGCATCAGGACACGATACAGCTGAAGGTGAAGGCGAAGGCCGATGGAGGTGTGGTCCGGTGCATCATTGGTTTCCACCTCTTAGTTTTGTAGTCTAGTTGGGGGATATGTAAACATCATGATCTCAGGTTGGAAAGTATGATTCTACTAGGACCGGATCTTGTGTAGGTGCCTTCAACCAGGCCGCAGCAGTGTTGAAGGCGTGTATTAGAACGCAGAATTGGATGATATGTATCAAGAAGGTCCTCGCTGCCCTCGCATTAGCGGCGTGCTGCGGTGCCATGCGGGGCCAGGGTCAGGGCCAGGGCGTTTCGCCTCTGTACTTTTATCAGCAAGCATAATTGCATCTTCTAACTAGCCTTAGCGAGGCGAGGTTTTGAGGATTAGTAGTTTTAGAAGAAGGAAGTGTCCGTAGTGCTGTCATTCCAGGGCCGGACCTTCTTCAATTGTTGCGGATCGGGATACTATGGCGCCGAAGTTTGCGCTCCGGCTTACGCTGTTCTCGTTGTGGATTTGGAGGGAACTCGTGTTGCCGGAAGCAGATTTCTAGTCGAAAGCCTGCCGCCCGAAATGTGCCATGTTTAATTGTCGATAAGGTTCAAGTTAAATGTTGGATTACATTCATTGTTCTCCGTTGGCTCAAGGCGAGCCACTTGTAAAAAGAAATGCCAAGTTTACCAACTTGAGACTCCTTGCACG

mRNA

>Mapoly0039s0059.13
GCGAGTCGACGGACGGAAAGAAGGAAGGAAGGAAGGAAAGTGGGGCGGGGCGATGAGGGAGGCGAGGAGTACAAGAATGTGGAGTAGTAAGGATATCATTTTGCTGGATGTTGCTGAAGACGATCAAGAGTCGAATTCGAGTGCGAGTCTTTGGTGCTAGAGCGGGAGGGTGGGCGATCCGAGTGCCAGATGTGGACGAGAGAAGCAGCGGAATCGATGGCTGCAGATTCGGGGCCAGTGGGCAGAGGCGGCTCGAGTCTTCCGACGGGAGGATTGAGGAGGGACACGAAGAGCTCTGAGTGATGTGATGCCATTCTGGTAGAGAAAAAGAAGGGATTCTGCTCTTGGGATCGCGCGAGGTCCCTGGGGCCAGCAAGCGCCCAGCTTGCCGAGCGGGCTCTCTGACGTCGAAGGTGCTGCCGCCTCTGTGTGTTTATCCCTGTGTCTCTGTGTTCTAGGCGGTTGTTGGCGGAGGGACGAGGGAGAGGAGTGGCGTTATGTCTGTCTGCTTGACAAGTTGGTACTCCTTGTGGGTCATAAGTTGGGATTTCCTTCCGCCCGTGGCACTGTTTCTGTCGGCGTGAGAAGAGCAAGTTTTCCAGCTCAAGGGACTGGATTTCGAATCGGGAACGGACTGAACACCGGAAGAATCCTCTCCGGTTGTCACTACATCCCCATCAGAGACCATGAGTCACCTCGTTCCCGACTGGGATGGTAACGGTGGAGACTTAGAAGCTGTTTTACCCACAAGCGATTTCTCACTGCCGGTTAAGGGAAAGTGGGACTCATTGCCCCATAAAAGGTCGCACTTGTCTGGTTTGGCCTTCGTGCCAACCCACGATGCTGGCGAAACTGAGTGGGCAGAGGAAAGTCATATTGTAGCTATGCAGAACCAAAGCGGGAAGGGCAACAAGGCTATGTGGCAGCAGATGAATTTCCAGAATGGGTGGTCGAGTGTGCCAGAGTCTGAGGATGCCGTTACTCCTGTGAAGCCCATCAGCTCGTCGTCTCCGGGGAAGGAGCCGGTTCTTGTCAATGAGCCCGCGGTCGACACGCACCACTCCAGTGCCCTCAACATGCAGGAAGACGAGATGGTGTGCTGGCTGCAGTATCCGTTGGACGAACACCTCGAAAGAGACTACTGTTCCGAGTTCTTCGGCGAGCTGCCCAACTCCAACATATCGAACATGCAGCTGATGAAGGATTCATTCGCAGGGCAAAATCAAGTAGCGGGGCGCAACAACAGGAATCCAGGTCCCGTTAACGTAGGGAGTAACAGCAGAATGTCTAGTGCGGATGCGGCGATGGCCATGGGAGCGGGGCGAGCTGCCGGTTTGTTGCCTCAGACAGGGGTGGAGGTTTTCACCAAAGTTCGGACCACTTTGCAACCCTACGGAGGAAAGTGGTCCCCAAATCAGAACAACGCCGGGAAAACGCTGGGAGCGATGACCTCGACCCTGGCTCCGAGCCCGTCAAGATCCCCGCCGATGTCTGGGAACTTGTCGACCCCCATGCTCCCCCCGAAGTCTCAGGGACTCAGCTTCCAGCCTCCCAGAACCTCAGGCCCGATGAATTTCTCGCATTTCTCTCGCCCTGCGGCTGTGATGAAGGCCAATCTCCAGTGCCTAGGAATGTCTCACGTGGCCCCTCCGCACGGGAGCGGGACGAACGTCCGGCTCAAGAGCCAACCCTACAGCGGGAAGCCACCCGTCGACGCAAGCACGTCGACGGGGTCCTCCATTGCAGAGTCAACCACCACGAGGCAACGCAGCGGCGCTTTCCGCAAGGATACCGAATGCCAAGTCGAAGGTTCCGAAGCTCAACAGAGTCTTGGAACCGAATCGAGCTGGCCTTCGATGCAGAATTCGCTGTCGGGCAAGGACACCGACGCTGTCAATTCCTCCGTGGATGGTGTGGACTGCGATTCGAAGCCCGGTATAGCGGATGTGGACAATTGCAGGAATTCTAGCATCACAGGTAGTGGCGGTTTAGGAACTGAAAAGCATCAGTCTCAAGGAGCAGAAGTGCAGGAAGCTCCCGAACCCACCATTACCTCGTCTTCTGGTGGGTCCGGTAATAGTGCAGATAGAGGGAAAGAGGCCGCATCTAGTGGCAAGAGAAGAACCAGGGAAGGAGAGGAGTCCGAGTGCCAGAGCGAAGTGAGTAACTTGTTGCAACCCCAAGGGAGTCAAGTTGGTGCAGTAGCCCACAGGCAAGATGGCGAGGACGAGATGGCCCAGCAAAAGAAACCTCAACAGAGAGGCTCCACCACTAAGAGGAGCAGGGCCGCGGAAGTCCACAACCTTTCCGAGCGAAGGCGAAGAGATCGTATCAACGAGAAGATGAAAGCTCTGCAAGAGCTGATCCCCAATTCCAACAAGACGGACAAAGCATCGATGCTGGATGAAGCGATCGAGTACTTGAAGATGCTCCAGTTGCAACTGCAGCAGATGATGTCCATGAGAAGTGGAATGAGCATCCCCTCTATGGTGATGCCGGCGGGAATGCAACACCTTCAAATCCCGCAATTGCCCCAAATGGGCCCAATGCCTCCCATGGGAATGGGAATGGGCATGGGTATGGGCATGGGCCCGATGGGAATGGGAATGAGTATGATGGACATGGGAGGCGGAGCTCCCGGTCGACCGATGATACCCCTTCCGTCTCACAGTGGGCCTTCTCACTCTCACAACGTATCTGCAACCTCACCAGCTGTTTCTATGGTAGACACTCATGACCACCGCCTGCAAAACCCGAGCGTCATGGAGTCACTGAACGTCTTCATGGCGCAACACCGGCAAATGCAAATGGCTCCTCAGCCGATGAGTATGGATGCATTCAGTGCATTCATGATTCATCAGCACCAGCAGCAACACCAGCAGCAGCATCAACAACATCAGCTCCAACACCAACACCAGCATTCGCTCCATCATCTTCCGAGCAGCATGGGCGGTGGAGCCCCCCAATGAAGAGCGGGCCAAATTCTCGGTGGATCTTGATTTCCACGCTTGCTTTCCATTTGTCATGCCATTTCGCATTGGAGGCCAGCGATCTGTCAACAACTATCTGCTGTTCCGCTCTCGGAGAGCGTAATATACTCAGCTGCAGGCGTGGCTGTGAGTCTGACAGCCATCGTCGGGCATCAGGACACGATACAGCTGAAGGTGAAGGCGAAGGCCGATGGAGGTGTGGTCCGGTGCATCATTGGTTTCCACCTCTTAGTTTTGTAGTCTAGTTGGGGGATATGTAAACATCATGATCTCAGGTTGGAAAGTATGATTCTACTAGGACCGGATCTTGTGTAGGTGCCTTCAACCAGGCCGCAGCAGTGTTGAAGGCGTGTATTAGAACGCAGAATTGGATGATATGTATCAAGAAGGTCCTCGCTGCCCTCGCATTAGCGGCGTGCTGCGGTGCCATGCGGGGCCAGGGTCAGGGCCAGGGCGTTTCGCCTCTGTACTTTTATCAGCAAGCATAATTGCATCTTCTAACTAGCCTTAGCGAGGCGAGGTTTTGAGGATTAGTAGTTTTAGAAGAAGGAAGTGTCCGTAGTGCTGTCATTCCAGGGCCGGACCTTCTTCAATTGTTGCGGATCGGGATACTATGGCGCCGAAGTTTGCGCTCCGGCTTACGCTGTTCTCGTTGTGGATTTGGAGGGAACTCGTGTTGCCGGAAGCAGATTTCTAGTCGAAAGCCTGCCGCCCGAAATGTGCCATGTTTAATTGTCGATAAGGTTCAAGTTAAATGTTGGATTACATTCATTGTTCTCCGTTGGCTCAAGGCGAGCCACTTGTAAAAAGAAATGCCAAGTTTACCAACTTGAGACTCCTTGCACG

CDS

>Mapoly0039s0059.13
ATGAGTCACCTCGTTCCCGACTGGGATGGTAACGGTGGAGACTTAGAAGCTGTTTTACCCACAAGCGATTTCTCACTGCCGGTTAAGGGAAAGTGGGACTCATTGCCCCATAAAAGGTCGCACTTGTCTGGTTTGGCCTTCGTGCCAACCCACGATGCTGGCGAAACTGAGTGGGCAGAGGAAAGTCATATTGTAGCTATGCAGAACCAAAGCGGGAAGGGCAACAAGGCTATGTGGCAGCAGATGAATTTCCAGAATGGGTGGTCGAGTGTGCCAGAGTCTGAGGATGCCGTTACTCCTGTGAAGCCCATCAGCTCGTCGTCTCCGGGGAAGGAGCCGGTTCTTGTCAATGAGCCCGCGGTCGACACGCACCACTCCAGTGCCCTCAACATGCAGGAAGACGAGATGGTGTGCTGGCTGCAGTATCCGTTGGACGAACACCTCGAAAGAGACTACTGTTCCGAGTTCTTCGGCGAGCTGCCCAACTCCAACATATCGAACATGCAGCTGATGAAGGATTCATTCGCAGGGCAAAATCAAGTAGCGGGGCGCAACAACAGGAATCCAGGTCCCGTTAACGTAGGGAGTAACAGCAGAATGTCTAGTGCGGATGCGGCGATGGCCATGGGAGCGGGGCGAGCTGCCGGTTTGTTGCCTCAGACAGGGGTGGAGGTTTTCACCAAAGTTCGGACCACTTTGCAACCCTACGGAGGAAAGTGGTCCCCAAATCAGAACAACGCCGGGAAAACGCTGGGAGCGATGACCTCGACCCTGGCTCCGAGCCCGTCAAGATCCCCGCCGATGTCTGGGAACTTGTCGACCCCCATGCTCCCCCCGAAGTCTCAGGGACTCAGCTTCCAGCCTCCCAGAACCTCAGGCCCGATGAATTTCTCGCATTTCTCTCGCCCTGCGGCTGTGATGAAGGCCAATCTCCAGTGCCTAGGAATGTCTCACGTGGCCCCTCCGCACGGGAGCGGGACGAACGTCCGGCTCAAGAGCCAACCCTACAGCGGGAAGCCACCCGTCGACGCAAGCACGTCGACGGGGTCCTCCATTGCAGAGTCAACCACCACGAGGCAACGCAGCGGCGCTTTCCGCAAGGATACCGAATGCCAAGTCGAAGGTTCCGAAGCTCAACAGAGTCTTGGAACCGAATCGAGCTGGCCTTCGATGCAGAATTCGCTGTCGGGCAAGGACACCGACGCTGTCAATTCCTCCGTGGATGGTGTGGACTGCGATTCGAAGCCCGGTATAGCGGATGTGGACAATTGCAGGAATTCTAGCATCACAGGTAGTGGCGGTTTAGGAACTGAAAAGCATCAGTCTCAAGGAGCAGAAGTGCAGGAAGCTCCCGAACCCACCATTACCTCGTCTTCTGGTGGGTCCGGTAATAGTGCAGATAGAGGGAAAGAGGCCGCATCTAGTGGCAAGAGAAGAACCAGGGAAGGAGAGGAGTCCGAGTGCCAGAGCGAAGTGAGTAACTTGTTGCAACCCCAAGGGAGTCAAGTTGGTGCAGTAGCCCACAGGCAAGATGGCGAGGACGAGATGGCCCAGCAAAAGAAACCTCAACAGAGAGGCTCCACCACTAAGAGGAGCAGGGCCGCGGAAGTCCACAACCTTTCCGAGCGAAGGCGAAGAGATCGTATCAACGAGAAGATGAAAGCTCTGCAAGAGCTGATCCCCAATTCCAACAAGACGGACAAAGCATCGATGCTGGATGAAGCGATCGAGTACTTGAAGATGCTCCAGTTGCAACTGCAGCAGATGATGTCCATGAGAAGTGGAATGAGCATCCCCTCTATGGTGATGCCGGCGGGAATGCAACACCTTCAAATCCCGCAATTGCCCCAAATGGGCCCAATGCCTCCCATGGGAATGGGAATGGGCATGGGTATGGGCATGGGCCCGATGGGAATGGGAATGAGTATGATGGACATGGGAGGCGGAGCTCCCGGTCGACCGATGATACCCCTTCCGTCTCACAGTGGGCCTTCTCACTCTCACAACGTATCTGCAACCTCACCAGCTGTTTCTATGGTAGACACTCATGACCACCGCCTGCAAAACCCGAGCGTCATGGAGTCACTGAACGTCTTCATGGCGCAACACCGGCAAATGCAAATGGCTCCTCAGCCGATGAGTATGGATGCATTCAGTGCATTCATGATTCATCAGCACCAGCAGCAACACCAGCAGCAGCATCAACAACATCAGCTCCAACACCAACACCAGCATTCGCTCCATCATCTTCCGAGCAGCATGGGCGGTGGAGCCCCCCAATGA

Protein

>Mapoly0039s0059.13
MSHLVPDWDGNGGDLEAVLPTSDFSLPVKGKWDSLPHKRSHLSGLAFVPTHDAGETEWAEESHIVAMQNQSGKGNKAMWQQMNFQNGWSSVPESEDAVTPVKPISSSSPGKEPVLVNEPAVDTHHSSALNMQEDEMVCWLQYPLDEHLERDYCSEFFGELPNSNISNMQLMKDSFAGQNQVAGRNNRNPGPVNVGSNSRMSSADAAMAMGAGRAAGLLPQTGVEVFTKVRTTLQPYGGKWSPNQNNAGKTLGAMTSTLAPSPSRSPPMSGNLSTPMLPPKSQGLSFQPPRTSGPMNFSHFSRPAAVMKANLQCLGMSHVAPPHGSGTNVRLKSQPYSGKPPVDASTSTGSSIAESTTTRQRSGAFRKDTECQVEGSEAQQSLGTESSWPSMQNSLSGKDTDAVNSSVDGVDCDSKPGIADVDNCRNSSITGSGGLGTEKHQSQGAEVQEAPEPTITSSSGGSGNSADRGKEAASSGKRRTREGEESECQSEVSNLLQPQGSQVGAVAHRQDGEDEMAQQKKPQQRGSTTKRSRAAEVHNLSERRRRDRINEKMKALQELIPNSNKTDKASMLDEAIEYLKMLQLQLQQMMSMRSGMSIPSMVMPAGMQHLQIPQLPQMGPMPPMGMGMGMGMGMGPMGMGMSMMDMGGGAPGRPMIPLPSHSGPSHSHNVSATSPAVSMVDTHDHRLQNPSVMESLNVFMAQHRQMQMAPQPMSMDAFSAFMIHQHQQQHQQQHQQHQLQHQHQHSLHHLPSSMGGGAPQ

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>