Mapoly0042s0078



Description

ADP RIBOSYLATION FACTOR-RELATED

Reference DB

Database ID Description
GO GO:0005525 GTP binding
KOG KOG0070 GTP-binding ADP-ribosylation factor Arf1
OrthoMCL OG5_126696
PFAM PF00025 ADP-ribosylation factor family
PANTHER PTHR11711 ADP RIBOSYLATION FACTOR-RELATED

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpARFD1 SAR/ARF GTPase Mapoly0042s0078.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0042s0078.1 scaffold_42:938024..940503  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0042s0078.1  

Gene structure:

mRNA scaffold_42:938024..940503  ( + strand )
five_prime_UTR scaffold_42:938024..938179  ( + strand )
CDS scaffold_42:938180..938273  ( + strand )
CDS scaffold_42:938743..938915  ( + strand )
CDS scaffold_42:939631..939918  ( + strand )
three_prime_UTR scaffold_42:939919..940503  ( + strand )

Sequences:

Gene

>Mapoly0042s0078.1
TGAGATATCCTTTGGTCCCTCTTCTCTCATTCTGATGGAAGATTGAGACTCAGCGCAGCTTATTCTTACCATCTTCAATCGGACAGAGATCTGAGATCTGTCAAGTCTGGGAGAAGACACCAAAGGGTTCATTCAGATCGATAGCGATCTTGTCAAATGGGGCAGATTCTAGCTAGTCTCATCGACAGACTCTCGCAGTCTTTTGGGCAGAAGGAGCTCAGAATCCTCATGTTAGGCCTAGATGCAGCAGGTCGGTACTCTCTCCTCTTGGCGCACTTTCTACTGAAGAGGTTGCCCCTTCGATTTCGGTCTAAATGTCAAACCTGCTCCCTTTCAAAAAATCCGATCTACGGCTGATTGGTACAATTCAAGGACAGATCGGGAAATCACGTTATGCAGACATACATTACTGAATCTCGATTTTGAATCTTGCACATGTGCACCTTAGAATGTGTTTAATTGCATCTGCTAATCACGACTTCACAGGTGCTTCCAGCCTTCTTCTTCTTCTTCTTCTTCTTTAGCATTAAAGATCTGTTCCGGCATCATTGTTGTCAGTCAACTACCATCATTATCTAAAACTCGTCGAGGGCAGCTCAGATTCAGCCATGTGGAATGACATAGTCACAAACAGTGCTACCGATCACTTTGTGAATTTCTGCTGGCAAATCTAGGTTCTTCGGAATTTATCATAAAACTGTGATCATATGTGACGACAGGGAAAACTACCGTGCTTTACAAATTAAAGCTTGGGGAGAAAGTCTGCTCGATACCAACAATAGGCTTCAACGTGGAAACCGTGCAGTACAAGAACGTCAATTTCACAGTGTGGGACGTTGGCGGTCAAGACAAGATTCGACTGCTCTGGAAACACTACTTCTCTGGTACTCAGGTTGGTCTACTCCACCAACTTATTCAACTGACACAGAGTTTAGTTCCTGTTATCCATCATAGATGAGGACGAATCGGCTCTGTCTCGTGACTACGTGGAGCCCATCATTCCGATCTCTGTGGGCAGCACAGAGCTTTTATGCCGGGCTTTGCTCACCTGACATACGCCTTTGGGCATGAAATCTTTTCTACTTGCAATTTCTGCTCTAAACTTCACATTCAGCGATTCGATCTGGCTACCACCACAGTTCCTGAATCTTCTAAATCAACAGTAAGCTGAAATCTCCTGTCAACCGATTACGTTTCGGTAGTATCTGCACTGATCGACTCACTTCACACTTCGAAGCTCTGGCTGACCATTTTCGTCTACCTCTGGTCTGCCACTTGACAAGAGTCCCTCATCGATCTACAAGCTGTGAGACTTGCTTTTATTTGGTTTGGTATGAATCAGCTCAAGTAGGACAAATACTTTGTCGGACAGACCAGGATGGGGACAGCCAGCGCCCATGTGAGTTTGAGAACAGATATATTCTGGTACGTCAGGAACATTACTCTTTCCAGAGTTGAAGGAAGTCCGAGGACGGGTATTCGAATTCCTTCAACATTTACATATCTAAATACTTGTGGACGCTGTATTTGTCATCGGGTGCGAGAATTCGACTATGCATCGATTCTTATCTTTTTCTCATTCTGTGTGCATGATTCTGTCTGTGCAGGGATTGATCTTTGTGGTAGATTGTGCTGACAAAGACAGAATCCTCGAGGCAAGAGATGAACTGCACAAGCTGCTCAACGACCCCGAGCTGGCGCACGTCACGTTGTTGGTGCTGTCCAACAAAAGCGACCTTCCGACCGCCATGTCGGTATCCGAAGTGACCGACAAGCTGCAGCTTGCAAGCTTGAGGCAGACCACTTGGTACATTCAAAATTGCTGCGCCGCAAGTGGAGAGGGACTCTACGAAGGCTTGGACTGGATGTCTCAGTCCCTCAAAACTGCAACCTAAAGCTCAACCACGACATTCTCGAGTTAGATCGTTCCGGCTCTTTTCCAGATCAAAAGGCAGGCCTGCAGAGGATGCATCGTCTCTAGAGGATCTCAGTGTTAATTTTGAAGGCAGGCTGATTCAGTCGCTACACAGTAGATCACATTCATCATCCTCACCTCTAGAGTTTCTCCATTAGAGCATTCCTTCAGCAATTCCACCCTGCAGCCCAAAAGGCATGGGTGCACAGGAATAGCAGTAGTACGCGTTTGAGTCGAATCATGATTCAGCTGTCGAGGCAATGGAAATCACGAAGTCCTGCATACATATACAGATGGGGTGCTCGCAGCTCGGAGCTTTTGTATCTAGAGTTTAGCTCTAGGATTCTTCAGGCAGTCCGCAGAATCACTTCGGTTCTTCTCTTCTCCCCAATTCAGCTTATGCAAATTACATGTCATCATTTTGACTAGAAAATCCAGTAAACCTGCCGTCGTGCAGGCCAGTGCTCTATCTGCAATGCAAAGCTTTTAAATAAAAGCGTGCGATGCAAATGTAGATCGTATGGAGTGAAGCGTCAAATGAGTTTGCACTGGACCTCGCGAGTTC

mRNA

>Mapoly0042s0078.1
TGAGATATCCTTTGGTCCCTCTTCTCTCATTCTGATGGAAGATTGAGACTCAGCGCAGCTTATTCTTACCATCTTCAATCGGACAGAGATCTGAGATCTGTCAAGTCTGGGAGAAGACACCAAAGGGTTCATTCAGATCGATAGCGATCTTGTCAAATGGGGCAGATTCTAGCTAGTCTCATCGACAGACTCTCGCAGTCTTTTGGGCAGAAGGAGCTCAGAATCCTCATGTTAGGCCTAGATGCAGCAGGGAAAACTACCGTGCTTTACAAATTAAAGCTTGGGGAGAAAGTCTGCTCGATACCAACAATAGGCTTCAACGTGGAAACCGTGCAGTACAAGAACGTCAATTTCACAGTGTGGGACGTTGGCGGTCAAGACAAGATTCGACTGCTCTGGAAACACTACTTCTCTGGTACTCAGGGATTGATCTTTGTGGTAGATTGTGCTGACAAAGACAGAATCCTCGAGGCAAGAGATGAACTGCACAAGCTGCTCAACGACCCCGAGCTGGCGCACGTCACGTTGTTGGTGCTGTCCAACAAAAGCGACCTTCCGACCGCCATGTCGGTATCCGAAGTGACCGACAAGCTGCAGCTTGCAAGCTTGAGGCAGACCACTTGGTACATTCAAAATTGCTGCGCCGCAAGTGGAGAGGGACTCTACGAAGGCTTGGACTGGATGTCTCAGTCCCTCAAAACTGCAACCTAAAGCTCAACCACGACATTCTCGAGTTAGATCGTTCCGGCTCTTTTCCAGATCAAAAGGCAGGCCTGCAGAGGATGCATCGTCTCTAGAGGATCTCAGTGTTAATTTTGAAGGCAGGCTGATTCAGTCGCTACACAGTAGATCACATTCATCATCCTCACCTCTAGAGTTTCTCCATTAGAGCATTCCTTCAGCAATTCCACCCTGCAGCCCAAAAGGCATGGGTGCACAGGAATAGCAGTAGTACGCGTTTGAGTCGAATCATGATTCAGCTGTCGAGGCAATGGAAATCACGAAGTCCTGCATACATATACAGATGGGGTGCTCGCAGCTCGGAGCTTTTGTATCTAGAGTTTAGCTCTAGGATTCTTCAGGCAGTCCGCAGAATCACTTCGGTTCTTCTCTTCTCCCCAATTCAGCTTATGCAAATTACATGTCATCATTTTGACTAGAAAATCCAGTAAACCTGCCGTCGTGCAGGCCAGTGCTCTATCTGCAATGCAAAGCTTTTAAATAAAAGCGTGCGATGCAAATGTAGATCGTATGGAGTGAAGCGTCAAATGAGTTTGCACTGGACCTCGCGAGTTC

CDS

>Mapoly0042s0078.1
ATGGGGCAGATTCTAGCTAGTCTCATCGACAGACTCTCGCAGTCTTTTGGGCAGAAGGAGCTCAGAATCCTCATGTTAGGCCTAGATGCAGCAGGGAAAACTACCGTGCTTTACAAATTAAAGCTTGGGGAGAAAGTCTGCTCGATACCAACAATAGGCTTCAACGTGGAAACCGTGCAGTACAAGAACGTCAATTTCACAGTGTGGGACGTTGGCGGTCAAGACAAGATTCGACTGCTCTGGAAACACTACTTCTCTGGTACTCAGGGATTGATCTTTGTGGTAGATTGTGCTGACAAAGACAGAATCCTCGAGGCAAGAGATGAACTGCACAAGCTGCTCAACGACCCCGAGCTGGCGCACGTCACGTTGTTGGTGCTGTCCAACAAAAGCGACCTTCCGACCGCCATGTCGGTATCCGAAGTGACCGACAAGCTGCAGCTTGCAAGCTTGAGGCAGACCACTTGGTACATTCAAAATTGCTGCGCCGCAAGTGGAGAGGGACTCTACGAAGGCTTGGACTGGATGTCTCAGTCCCTCAAAACTGCAACCTAA

Protein

>Mapoly0042s0078.1
MGQILASLIDRLSQSFGQKELRILMLGLDAAGKTTVLYKLKLGEKVCSIPTIGFNVETVQYKNVNFTVWDVGGQDKIRLLWKHYFSGTQGLIFVVDCADKDRILEARDELHKLLNDPELAHVTLLVLSNKSDLPTAMSVSEVTDKLQLASLRQTTWYIQNCCAASGEGLYEGLDWMSQSLKTAT

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>