Mapoly0044s0050



Description

ADP RIBOSYLATION FACTOR-RELATED

Reference DB

Database ID Description
GO GO:0005525 GTP binding
KOG KOG0070 GTP-binding ADP-ribosylation factor Arf1
OrthoMCL OG5_126696
PFAM PF00025 ADP-ribosylation factor family
PANTHER PTHR11711 ADP RIBOSYLATION FACTOR-RELATED

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpARFD2 SAR/ARF GTPase Mapoly0044s0050.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0044s0050.1 scaffold_44:601843..604922  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0044s0050.1  

Gene structure:

mRNA scaffold_44:601843..604922  ( - strand )
three_prime_UTR scaffold_44:601843..602484  ( - strand )
CDS scaffold_44:602485..602775  ( - strand )
CDS scaffold_44:603552..603724  ( - strand )
CDS scaffold_44:604347..604440  ( - strand )
five_prime_UTR scaffold_44:604441..604922  ( - strand )

Sequences:

Gene

>Mapoly0044s0050.1
TCCCTTCCTCCTGAGCGAAGGGAAGGGAGAGATTATCGACGCCTCGTGGAGAGCTTTGAAAGAAATATAAATTAGAGATTTGGCTCCTGCTGAGCGTACAATTAAATCGTAAAGTGAACGACGTCGATCTTCGACTGATCAGAGTTGCCAGGTGGAGCTGGCTCTTGCACGCGGGTGCCAAAATTATCTCTCCCTCCCTTTCCTTTCCTTTTCTTCCCTTGCCTGGCCTTGCCTGGCCTTGCATTGCATTGCATTGCATTGCCTTGCCTTGCCTACCCTGGGACGCAGCGCAGTCAATCATCGCTAACACAGACCTGTACTTACATCGTTCACGATTGAGCGTGCTGAGAGGGTAGAAAAGTCGACGATCCGCTCCGACCCGGCCCGACCCGACCCTGCGTGTCTGTCCGTCTGCCTGCCTGCGTGCCTGCCTGCGTGCCTGCAGCTAGGAGCTGTCGATTACATCTCTGAGAAGCTGACAGATGGGGCAGATTCTCGCTCGTCTCATCGACAGACTCGCACAGTCTTTTGGACACAGGGAACTCCGAATTCTTATGCTCGGCCTGGACGCAGCAGGTCATTAGCTCTCCTCACTCGAAATCTCCTCACACATGCCGCTGTCCATGCTAACTCTACGTGGTTGAAGATCCTCTCGCGAGAGCTCCCGACGACACTCCCGAATTCGCGTCCCGCTCGGATCAATGGAGATCGAGGCGACCTCTTCGATGAGGAGACGTGAACCTGCGAAGAGAATTTCTCAGAACGGAGTCATGACATGTGACCTGTAACATGCGCGCAGGATTAGCTTCGCATGGATGGATGCCTGCTTGCTTGCTTGCTCAGTCGTGAGGATGTCTCCTCCTTTTGTTGATCAGACTCCAAATCGCCCAGATTAATCCCTAAGAGAGACGACAAAAGTTCAGAATCTTCTCCTCTCTGGGTGATTCTCATCCTATTCACCGTCAGTCCCGGAGTTGCTGTACTTCCTTGCCTGGACGGACCACTTACTCACTCTCCCTCCATTAGAACTCGCACTAGTCTCTGATGGAGAGACCACATTGACGTCAAGCAAGCAGCAGGGCGGGAGAGGGCAGCAGAGGGGAGGGGATGGTGTGGGAGGACGTGCCGTCAATGCCTGCTCCTCGTCGTTAGCGCTATATTGACGTATGTTGGCTCGGCGTGTGTCCCGGATGTGCAGGAAAAACCACTGTACTCTATAAGTTGAAGTTAGGGGAGAAGGTTTGCACCATACCGACGATTGGATTTAACGTCGAGACTGTGCAGTATAAGAATATAAACTTCACCGTCTGGGACGTCGGTGGTCAGCACAAGATCAGACAACTGTGGAAGTACTACTTCAGCGGTATTCAGGTTCGTGTCGTATCATTAGCACAGCCCACCGCCAAATGTCCGGTTCATGATGTTGTTGATGATGTTGATGATAATGATTATACGAGTTGAATATCGGTGGAGGTCGATGCGAATTTTGTGATTCGGTCACGCTACAGCGTTGAGTCGGTTCTTCAGCCGTACGCTTTTCCTTTTGATGCTCTCACGACGATTGTTCGAGCTGCGGGGACTCGATTGATTAGGCCGCGAGCCTCGTGAGTCCTCTCTTGGGCCGCTCCATAGATTATGGAACCAGCTCCTGAGGTCGAATATGAACTGCTAGAATCTTCTCACTCTTTATCGCAATATCATCGCTCCTATTTATCAAAATGAATATATCATCACAGCATATGCTTGTTTCCCAAAATGTTCAATTAAATTCCTGTAGATGATTATATGCTTTTCATTAAGGCTCCGATTAGATATCAGAATGCTTGTAGCTCGAGTTGCTTTGGGCCTAGGCTAACGTCGTGAGAGTACGTCGACCTCGTGAAGATTATTAGTCGTGGACTTGTTGGGAAGTAGACTCAGAGTTTTTCTTGCCTCAAATAAATTAAATGTCCCTAAGAAATGACTGCGACATCTGTAACTGCTCATAAGATCATCAGCTCGGATACATCCTTCAACATTCAAGCCATTTATGGTGCCATGATACCTGACATCGAATTGAAGTTCCTTTCCCGTGTAGCAGGAAAATGGACATCCTAGGGTTTAAATTATTGCATGAAAATTAACTCTGGTGATGATCTCTCGCGCAGGGATTGATTTTTGTGGTGGACAGCACTGACAAAGAACGGATCACTGAGGCAAGGGACGAACTTCATAACCTGATCAACGATCCTGAGCTTTCTCATGTTACATTATTGGTTCTAGCTAACAAAACAGATCTTCCTCAAACAATGTCTGTCGCTCAGATCACCGATTTGTTACAGCTCCCAAGCCTGAGGCAAACCAAATGGTACATCCAAAGCTGCAGTGCTACTAGTGGTCTGGGCCTTTATGAAGGTTTGGATTGGCTGGGTCAAGAACTCAAGAAGGTGGGAAGCTGACGATCCAGTGTACCTCTACTTCCAGAGGATTCTCCATCAAAACACTTTTCAATGATCGATGATTAGCCTGCATATGGTAATGGAACTGCTACGATGAGATGTGTATTGCGACACTGCAGGAATGGCGGCTTAATCACTTAAGGACATGCCTTCTTGGAGATTTTTTCGAGTGATTGAATCGCGGGTCTCCAACCCACTACTTTTCAGTGTGCTTACCTGCAGATACAAGTAGAATATTGTTTTGTGATAATCGACGAGAGTGCAGGAAGCTCCATTCGGTTCAAGAGATACTTATACGTTCGAAGATCGCACTTTTTCTGGAGAGGTGTGGCTCACCTTTCATCACTGAGGCTTGTTCAAGTAGCGTGTGGCAAAGTCTTCTAAACCCCAACCATGATTCAATCTGAGTCGTGGTTGAACACAGTTTCGAGCCTTTCTTGCTGTCCAGTGGAGCTTAGGATTACGTGGTTGAATTAGAAGTCCTCGAATTGCAAAGTGTACATTGCTTTAGCTGGTGGGTGTCCATCTTAGCTGTGATGGAAAAAGTGTGATGATCATCCCAAATTGATCATGAAAAAACATATGTGTTCGCTGAAAGAAGACTTCGGTCTGAAATCTGAAATTTGTCTCAATAATTTCTTT

mRNA

>Mapoly0044s0050.1
TCCCTTCCTCCTGAGCGAAGGGAAGGGAGAGATTATCGACGCCTCGTGGAGAGCTTTGAAAGAAATATAAATTAGAGATTTGGCTCCTGCTGAGCGTACAATTAAATCGTAAAGTGAACGACGTCGATCTTCGACTGATCAGAGTTGCCAGGTGGAGCTGGCTCTTGCACGCGGGTGCCAAAATTATCTCTCCCTCCCTTTCCTTTCCTTTTCTTCCCTTGCCTGGCCTTGCCTGGCCTTGCATTGCATTGCATTGCATTGCCTTGCCTTGCCTACCCTGGGACGCAGCGCAGTCAATCATCGCTAACACAGACCTGTACTTACATCGTTCACGATTGAGCGTGCTGAGAGGGTAGAAAAGTCGACGATCCGCTCCGACCCGGCCCGACCCGACCCTGCGTGTCTGTCCGTCTGCCTGCCTGCGTGCCTGCCTGCGTGCCTGCAGCTAGGAGCTGTCGATTACATCTCTGAGAAGCTGACAGATGGGGCAGATTCTCGCTCGTCTCATCGACAGACTCGCACAGTCTTTTGGACACAGGGAACTCCGAATTCTTATGCTCGGCCTGGACGCAGCAGGAAAAACCACTGTACTCTATAAGTTGAAGTTAGGGGAGAAGGTTTGCACCATACCGACGATTGGATTTAACGTCGAGACTGTGCAGTATAAGAATATAAACTTCACCGTCTGGGACGTCGGTGGTCAGCACAAGATCAGACAACTGTGGAAGTACTACTTCAGCGGTATTCAGGGATTGATTTTTGTGGTGGACAGCACTGACAAAGAACGGATCACTGAGGCAAGGGACGAACTTCATAACCTGATCAACGATCCTGAGCTTTCTCATGTTACATTATTGGTTCTAGCTAACAAAACAGATCTTCCTCAAACAATGTCTGTCGCTCAGATCACCGATTTGTTACAGCTCCCAAGCCTGAGGCAAACCAAATGGTACATCCAAAGCTGCAGTGCTACTAGTGGTCTGGGCCTTTATGAAGGTTTGGATTGGCTGGGTCAAGAACTCAAGAAGGTGGGAAGCTGACGATCCAGTGTACCTCTACTTCCAGAGGATTCTCCATCAAAACACTTTTCAATGATCGATGATTAGCCTGCATATGGTAATGGAACTGCTACGATGAGATGTGTATTGCGACACTGCAGGAATGGCGGCTTAATCACTTAAGGACATGCCTTCTTGGAGATTTTTTCGAGTGATTGAATCGCGGGTCTCCAACCCACTACTTTTCAGTGTGCTTACCTGCAGATACAAGTAGAATATTGTTTTGTGATAATCGACGAGAGTGCAGGAAGCTCCATTCGGTTCAAGAGATACTTATACGTTCGAAGATCGCACTTTTTCTGGAGAGGTGTGGCTCACCTTTCATCACTGAGGCTTGTTCAAGTAGCGTGTGGCAAAGTCTTCTAAACCCCAACCATGATTCAATCTGAGTCGTGGTTGAACACAGTTTCGAGCCTTTCTTGCTGTCCAGTGGAGCTTAGGATTACGTGGTTGAATTAGAAGTCCTCGAATTGCAAAGTGTACATTGCTTTAGCTGGTGGGTGTCCATCTTAGCTGTGATGGAAAAAGTGTGATGATCATCCCAAATTGATCATGAAAAAACATATGTGTTCGCTGAAAGAAGACTTCGGTCTGAAATCTGAAATTTGTCTCAATAATTTCTTT

CDS

>Mapoly0044s0050.1
ATGGGGCAGATTCTCGCTCGTCTCATCGACAGACTCGCACAGTCTTTTGGACACAGGGAACTCCGAATTCTTATGCTCGGCCTGGACGCAGCAGGAAAAACCACTGTACTCTATAAGTTGAAGTTAGGGGAGAAGGTTTGCACCATACCGACGATTGGATTTAACGTCGAGACTGTGCAGTATAAGAATATAAACTTCACCGTCTGGGACGTCGGTGGTCAGCACAAGATCAGACAACTGTGGAAGTACTACTTCAGCGGTATTCAGGGATTGATTTTTGTGGTGGACAGCACTGACAAAGAACGGATCACTGAGGCAAGGGACGAACTTCATAACCTGATCAACGATCCTGAGCTTTCTCATGTTACATTATTGGTTCTAGCTAACAAAACAGATCTTCCTCAAACAATGTCTGTCGCTCAGATCACCGATTTGTTACAGCTCCCAAGCCTGAGGCAAACCAAATGGTACATCCAAAGCTGCAGTGCTACTAGTGGTCTGGGCCTTTATGAAGGTTTGGATTGGCTGGGTCAAGAACTCAAGAAGGTGGGAAGCTGA

Protein

>Mapoly0044s0050.1
MGQILARLIDRLAQSFGHRELRILMLGLDAAGKTTVLYKLKLGEKVCTIPTIGFNVETVQYKNINFTVWDVGGQHKIRQLWKYYFSGIQGLIFVVDSTDKERITEARDELHNLINDPELSHVTLLVLANKTDLPQTMSVAQITDLLQLPSLRQTKWYIQSCSATSGLGLYEGLDWLGQELKKVGS

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>