Mapoly0044s0052



Description

ADP RIBOSYLATION FACTOR-RELATED

Reference DB

Database ID Description
GO GO:0005525 GTP binding
KOG KOG0070 GTP-binding ADP-ribosylation factor Arf1
OrthoMCL OG5_126696
PFAM PF00025 ADP-ribosylation factor family
PANTHER PTHR11711 ADP RIBOSYLATION FACTOR-RELATED

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpARFD3 SAR/ARF GTPase Mapoly0044s0052.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0044s0052.1 scaffold_44:606651..609714  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
Mapoly0044s0052.2 scaffold_44:608390..609679  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0044s0052.1  

Gene structure:

mRNA scaffold_44:606651..609714  ( + strand )
five_prime_UTR scaffold_44:606651..606855  ( + strand )
CDS scaffold_44:606856..607147  ( + strand )
CDS scaffold_44:608515..608690  ( + strand )
CDS scaffold_44:608873..609178  ( + strand )
three_prime_UTR scaffold_44:609179..609714  ( + strand )

Sequences:

Gene

>Mapoly0044s0052.1
TTCTATTAATGGGCCAGGTTAGATCTCGGTGGTCCAGAGTCTATCCACAGAGAGCACTAGGCCTGAATCGGAAGCAGACGACCAATCGAAGGCGATCGGGGGAACAATTATGATCGGAGGCAGGAGGCTCGTTGTCTGATTGTGGGAGCAGCGCTCGCGGTGAGAGTGATGCAATTCTGACCCCGGGCCTAGACCAGCAGACCTAATGTTTTTGCGGGCAAATCGCTCCGCTGGTGGTGACGACGCTAGTGCGAAGTTGATATCAGAGCTGCGCCTGCTGCCCTTCTTGAGGAGTGCAAGCGGAAACCTCGAAACGCGCAACCGATCCCTGGTCAGCAGTCGGTCGTTCGTAGATCTACGACGCGGCTGCGGTTGGGGCAAAGTGTGGAATCTCTGGACCTCGATGGGGCAGACCTTGGGATCCATGCTGCAAAACCTATTCACCATTCAGTCCGCGAGAAACTTACGTCTACTCATGTTGGGCCTAGACGCTGCAGGTACCTCTTCCTCCCCTTCCCTCCCTCCCTCCCTCTCCCCCTCCAAATTTGCCTCGGTCCGTCCCCGACTGTCGTCACGATCCCATCAGCCCCTCTCCCGCTCTTTTCTGAATTTAGCATCCTCCACGTCTCGAGCCGATTATCGATGTCGCCAATTTGTCAGCTGGGGTCTGTCGAAGGGAAGGGAAGGGAAGAGAAGCTAAGAGAAAGGGACGGGGAGAGTGGCCGATGGATGCATTTGAGAACAGTTAGAAAGCGTTTCAGTCGAGCATTTGGATTCGATTCGCCTGCTTGTTGTTAGGGGCCAGGTCTCGTTGTGAAAGTGAGGATCTGGAACTAAAATGGGATGGGATGGGATGGAATGCAGGTAAAACGACCATTCTGTACAAATTAAAGATGGGGGAGAGAGTAGCCACGATCCCCACGATCGGCTTCAATGTAGAGCATCTGCAACATGAGAACAATGTCAGCTTCACTGTCTGGGAGGGGGGGCAAGTGTATCATTCTATTAATGGGCCAGGTTAGATCTCGGTGGTCCAGAGTCTATCCACAGAGAGCACTAGGCCTGAATCGGAAGCAGACGACCAATCGAAGGCGATCGGGGGAACAATTATGATCGGAGGCAGGAGGCTCGTTGTCTGATTGTGGGAGCAGCGCTCGCGGTGAGAGTGATGCAATTCTGACCCCGGGCCTAGACCAGCAGACCTAATGTTTTTGCGGGCAAATCGCTCCGCTGGTGGTGACGACGCTAGTGCGAAGTTGATATCAGAGCTGCGCCTGCTGCCCTTCTTGAGGAGTGCAAGCGGAAACCTCGAAACGCGCAACCGATCCCTGGTCAGCAGTCGGTCGTTCGTAGATCTACGACGCGGCTGCGGTTGGGGCAAAGTGTGGAATCTCTGGACCTCGATGGGGCAGACCTTGGGATCCATGCTGCAAAACCTATTCACCATTCAGTCCGCGAGAAACTTACGTCTACTCATGTTGGGCCTAGACGCTGCAGGTACCTCTTCCTCCCCTTCCCTCCCTCCCTCCCTCTCCCCCTCCAAATTTGCCTCGGTCCGTCCCCGACTGTCGTCACGATCCCATCAGCCCCTCTCCCGCTCTTTTCTGAATTTAGCATCCTCCACGTCTCGAGCCGATTATCGATGTCGCCAATTTGTCAGCTGGGGTCTGTCGAAGGGAAGGGAAGGGAAGAGAAGCTAAGAGAAAGGGACGGGGAGAGTGGCCGATGGATGCATTTGAGAACAGTTAGAAAGCGTTTCAGTCGAGCATTTGGATTCGATTCGCCTGCTTGTTGTTAGGGGCCAGGTCTCGTTGTGAAAGTGAGGATCTGGAACTAAAATGGGATGGGATGGGATGGAATGCAGGTAAAACGACCATTCTGTACAAATTAAAGATGGGGGAGAGAGTAGCCACGATCCCCACGATCGGCTTCAATGTAGAGCATCTGCAACATGAGAACAATGTCAGCTTCACTGTCTGGGACGTTGGCGGTCAGTCCAAGATTCGTCAATTATGGTGTCACTACTTCCATGATGCCCAGGTTGGCTTCCGAGATCGACCACTTCTGCTCTCCTCTCGTCTCCTCTCCTCGTGAATCAATGTCTGGTCTGCTTCCGTTCGAAATTGGTAGCGAGCGTGAGAGGCTGAACAATGAGACCACGACTTGAAGTTTTTTGGTGAGATTCCGACTGACGGTCAGCTCAATTGTGTCGGATTGTGCAGGGGTTGATTTTTGTGGTCGACAGCACGGATCATGACAGAATGCGAGAAGCGTATGAGGAGCTTCAGAGATTGATGGAGGATCCCATTCTATCGGGTGTTAAGGTTCTCGTTCTAGCAAACAAATGCGATCTTCCCAAAGCCATGTCCGTTAAGGAGATCTCGGAAAAACTCGGTCTACATCATATTCGACAGGAATATAATATCCAGGGCTGTTGTGCAATCAGCGGAGAGGGACTGTTCGAAGGACTAGATTGGTTAGCCACAGCACTCAAAGAGGTTCCCAGCTCATCGCCCTGGGTTCAATGAGATCCATGTCACTGACTTCTCAAGTTCTCAGGCCCAGCCTTAAGACTAGATTGAATTTTACTGCAGGCCAAGGGTCAGAACGAGTGTAGAATTCCCAACACTGACAACGCCCATGTTACACAGCGGAGACTTGCACTGCTCTGAACTCCTCGAGCTTCCGCACGGGAGACTGGCCGAGCATCTGGCATCTGCCCTCACTCTCCTCACAAACACCTTGCAGATCACGCAATCCGGAGCAGGGATGAAGACCGCGTGAGCCGCAGGCAATTGGCTGGAGAAGAATGCTCCGGGTCTACTTTCCGAGGGAAAGATTGAAACGAGCAGGTTTCAGAAAATTGTGCACAGAGCTTCACCATCGCACACCATTACAAATACAGAGCCTGTCGTAGTATGCCGGCTTCCCCATACATAGCCCATTGTATTATAATCGACGCTCTGGGATACATTGTCCCCTTACATAAATGTAAAATACGTCTTGTTTGCCAAATGAAATTCAACCCGAGACCTGTCTGTCGTTACTGACCAGACAAATTTCA

mRNA

>Mapoly0044s0052.1
TTCTATTAATGGGCCAGGTTAGATCTCGGTGGTCCAGAGTCTATCCACAGAGAGCACTAGGCCTGAATCGGAAGCAGACGACCAATCGAAGGCGATCGGGGGAACAATTATGATCGGAGGCAGGAGGCTCGTTGTCTGATTGTGGGAGCAGCGCTCGCGGTGAGAGTGATGCAATTCTGACCCCGGGCCTAGACCAGCAGACCTAATGTTTTTGCGGGCAAATCGCTCCGCTGGTGGTGACGACGCTAGTGCGAAGTTGATATCAGAGCTGCGCCTGCTGCCCTTCTTGAGGAGTGCAAGCGGAAACCTCGAAACGCGCAACCGATCCCTGGTCAGCAGTCGGTCGTTCGTAGATCTACGACGCGGCTGCGGTTGGGGCAAAGTGTGGAATCTCTGGACCTCGATGGGGCAGACCTTGGGATCCATGCTGCAAAACCTATTCACCATTCAGTCCGCGAGAAACTTACGTCTACTCATGTTGGGCCTAGACGCTGCAGGTAAAACGACCATTCTGTACAAATTAAAGATGGGGGAGAGAGTAGCCACGATCCCCACGATCGGCTTCAATGTAGAGCATCTGCAACATGAGAACAATGTCAGCTTCACTGTCTGGGACGTTGGCGGTCAGTCCAAGATTCGTCAATTATGGTGTCACTACTTCCATGATGCCCAGGGGTTGATTTTTGTGGTCGACAGCACGGATCATGACAGAATGCGAGAAGCGTATGAGGAGCTTCAGAGATTGATGGAGGATCCCATTCTATCGGGTGTTAAGGTTCTCGTTCTAGCAAACAAATGCGATCTTCCCAAAGCCATGTCCGTTAAGGAGATCTCGGAAAAACTCGGTCTACATCATATTCGACAGGAATATAATATCCAGGGCTGTTGTGCAATCAGCGGAGAGGGACTGTTCGAAGGACTAGATTGGTTAGCCACAGCACTCAAAGAGGTTCCCAGCTCATCGCCCTGGGTTCAATGAGATCCATGTCACTGACTTCTCAAGTTCTCAGGCCCAGCCTTAAGACTAGATTGAATTTTACTGCAGGCCAAGGGTCAGAACGAGTGTAGAATTCCCAACACTGACAACGCCCATGTTACACAGCGGAGACTTGCACTGCTCTGAACTCCTCGAGCTTCCGCACGGGAGACTGGCCGAGCATCTGGCATCTGCCCTCACTCTCCTCACAAACACCTTGCAGATCACGCAATCCGGAGCAGGGATGAAGACCGCGTGAGCCGCAGGCAATTGGCTGGAGAAGAATGCTCCGGGTCTACTTTCCGAGGGAAAGATTGAAACGAGCAGGTTTCAGAAAATTGTGCACAGAGCTTCACCATCGCACACCATTACAAATACAGAGCCTGTCGTAGTATGCCGGCTTCCCCATACATAGCCCATTGTATTATAATCGACGCTCTGGGATACATTGTCCCCTTACATAAATGTAAAATACGTCTTGTTTGCCAAATGAAATTCAACCCGAGACCTGTCTGTCGTTACTGACCAGACAAATTTCA

CDS

>Mapoly0044s0052.1
ATGTTTTTGCGGGCAAATCGCTCCGCTGGTGGTGACGACGCTAGTGCGAAGTTGATATCAGAGCTGCGCCTGCTGCCCTTCTTGAGGAGTGCAAGCGGAAACCTCGAAACGCGCAACCGATCCCTGGTCAGCAGTCGGTCGTTCGTAGATCTACGACGCGGCTGCGGTTGGGGCAAAGTGTGGAATCTCTGGACCTCGATGGGGCAGACCTTGGGATCCATGCTGCAAAACCTATTCACCATTCAGTCCGCGAGAAACTTACGTCTACTCATGTTGGGCCTAGACGCTGCAGGTAAAACGACCATTCTGTACAAATTAAAGATGGGGGAGAGAGTAGCCACGATCCCCACGATCGGCTTCAATGTAGAGCATCTGCAACATGAGAACAATGTCAGCTTCACTGTCTGGGACGTTGGCGGTCAGTCCAAGATTCGTCAATTATGGTGTCACTACTTCCATGATGCCCAGGGGTTGATTTTTGTGGTCGACAGCACGGATCATGACAGAATGCGAGAAGCGTATGAGGAGCTTCAGAGATTGATGGAGGATCCCATTCTATCGGGTGTTAAGGTTCTCGTTCTAGCAAACAAATGCGATCTTCCCAAAGCCATGTCCGTTAAGGAGATCTCGGAAAAACTCGGTCTACATCATATTCGACAGGAATATAATATCCAGGGCTGTTGTGCAATCAGCGGAGAGGGACTGTTCGAAGGACTAGATTGGTTAGCCACAGCACTCAAAGAGGTTCCCAGCTCATCGCCCTGGGTTCAATGA

Protein

>Mapoly0044s0052.1
MFLRANRSAGGDDASAKLISELRLLPFLRSASGNLETRNRSLVSSRSFVDLRRGCGWGKVWNLWTSMGQTLGSMLQNLFTIQSARNLRLLMLGLDAAGKTTILYKLKMGERVATIPTIGFNVEHLQHENNVSFTVWDVGGQSKIRQLWCHYFHDAQGLIFVVDSTDHDRMREAYEELQRLMEDPILSGVKVLVLANKCDLPKAMSVKEISEKLGLHHIRQEYNIQGCCAISGEGLFEGLDWLATALKEVPSSSPWVQ

Mapoly0044s0052.2  

Gene structure:

mRNA scaffold_44:608390..609679  ( + strand )
five_prime_UTR scaffold_44:608390..608498  ( + strand )
CDS scaffold_44:608499..608690  ( + strand )
CDS scaffold_44:608873..609178  ( + strand )
three_prime_UTR scaffold_44:609179..609679  ( + strand )

Sequences:

Gene

>Mapoly0044s0052.2
GAACAGTTAGAAAGCGTTTCAGTCGAGCATTTGGATTCGATTCGCCTGCTTGTTGTTAGGGGCCAGGTCTCGTTGTGAAAGTGAGGATCTGGAACTAAAATGGGATGGGATGGGATGGAATGCAGGTAAAACGACCATTCTGTACAAATTAAAGATGGGGGAGAGAGTAGCCACGATCCCCACGATCGGCTTCAATGTAGAGCATCTGCAACATGAGAACAATGTCAGCTTCACTGTCTGGGACGTTGGCGGTCAGTCCAAGATTCGTCAATTATGGTGTCACTACTTCCATGATGCCCAGGTTGGCTTCCGAGATCGACCACTTCTGCTCTCCTCTCGTCTCCTCTCCTCGTGAATCAATGTCTGGTCTGCTTCCGTTCGAAATTGGTAGCGAGCGTGAGAGGCTGAACAATGAGACCACGACTTGAAGTTTTTTGGTGAGATTCCGACTGACGGTCAGCTCAATTGTGTCGGATTGTGCAGGGGTTGATTTTTGTGGTCGACAGCACGGATCATGACAGAATGCGAGAAGCGTATGAGGAGCTTCAGAGATTGATGGAGGATCCCATTCTATCGGGTGTTAAGGTTCTCGTTCTAGCAAACAAATGCGATCTTCCCAAAGCCATGTCCGTTAAGGAGATCTCGGAAAAACTCGGTCTACATCATATTCGACAGGAATATAATATCCAGGGCTGTTGTGCAATCAGCGGAGAGGGACTGTTCGAAGGACTAGATTGGTTAGCCACAGCACTCAAAGAGGTTCCCAGCTCATCGCCCTGGGTTCAATGAGATCCATGTCACTGACTTCTCAAGTTCTCAGGCCCAGCCTTAAGACTAGATTGAATTTTACTGCAGGCCAAGGGTCAGAACGAGTGTAGAATTCCCAACACTGACAACGCCCATGTTACACAGCGGAGACTTGCACTGCTCTGAACTCCTCGAGCTTCCGCACGGGAGACTGGCCGAGCATCTGGCATCTGCCCTCACTCTCCTCACAAACACCTTGCAGATCACGCAATCCGGAGCAGGGATGAAGACCGCGTGAGCCGCAGGCAATTGGCTGGAGAAGAATGCTCCGGGTCTACTTTCCGAGGGAAAGATTGAAACGAGCAGGTTTCAGAAAATTGTGCACAGAGCTTCACCATCGCACACCATTACAAATACAGAGCCTGTCGTAGTATGCCGGCTTCCCCATACATAGCCCATTGTATTATAATCGACGCTCTGGGATACATTGTCCCCTTACATAAATGTAAAATACGTCTTGTTTGCCAAATGAAATTCAACCCG

mRNA

>Mapoly0044s0052.2
GAACAGTTAGAAAGCGTTTCAGTCGAGCATTTGGATTCGATTCGCCTGCTTGTTGTTAGGGGCCAGGTCTCGTTGTGAAAGTGAGGATCTGGAACTAAAATGGGATGGGATGGGATGGAATGCAGGTAAAACGACCATTCTGTACAAATTAAAGATGGGGGAGAGAGTAGCCACGATCCCCACGATCGGCTTCAATGTAGAGCATCTGCAACATGAGAACAATGTCAGCTTCACTGTCTGGGACGTTGGCGGTCAGTCCAAGATTCGTCAATTATGGTGTCACTACTTCCATGATGCCCAGGGGTTGATTTTTGTGGTCGACAGCACGGATCATGACAGAATGCGAGAAGCGTATGAGGAGCTTCAGAGATTGATGGAGGATCCCATTCTATCGGGTGTTAAGGTTCTCGTTCTAGCAAACAAATGCGATCTTCCCAAAGCCATGTCCGTTAAGGAGATCTCGGAAAAACTCGGTCTACATCATATTCGACAGGAATATAATATCCAGGGCTGTTGTGCAATCAGCGGAGAGGGACTGTTCGAAGGACTAGATTGGTTAGCCACAGCACTCAAAGAGGTTCCCAGCTCATCGCCCTGGGTTCAATGAGATCCATGTCACTGACTTCTCAAGTTCTCAGGCCCAGCCTTAAGACTAGATTGAATTTTACTGCAGGCCAAGGGTCAGAACGAGTGTAGAATTCCCAACACTGACAACGCCCATGTTACACAGCGGAGACTTGCACTGCTCTGAACTCCTCGAGCTTCCGCACGGGAGACTGGCCGAGCATCTGGCATCTGCCCTCACTCTCCTCACAAACACCTTGCAGATCACGCAATCCGGAGCAGGGATGAAGACCGCGTGAGCCGCAGGCAATTGGCTGGAGAAGAATGCTCCGGGTCTACTTTCCGAGGGAAAGATTGAAACGAGCAGGTTTCAGAAAATTGTGCACAGAGCTTCACCATCGCACACCATTACAAATACAGAGCCTGTCGTAGTATGCCGGCTTCCCCATACATAGCCCATTGTATTATAATCGACGCTCTGGGATACATTGTCCCCTTACATAAATGTAAAATACGTCTTGTTTGCCAAATGAAATTCAACCCG

CDS

>Mapoly0044s0052.2
ATGGGATGGAATGCAGGTAAAACGACCATTCTGTACAAATTAAAGATGGGGGAGAGAGTAGCCACGATCCCCACGATCGGCTTCAATGTAGAGCATCTGCAACATGAGAACAATGTCAGCTTCACTGTCTGGGACGTTGGCGGTCAGTCCAAGATTCGTCAATTATGGTGTCACTACTTCCATGATGCCCAGGGGTTGATTTTTGTGGTCGACAGCACGGATCATGACAGAATGCGAGAAGCGTATGAGGAGCTTCAGAGATTGATGGAGGATCCCATTCTATCGGGTGTTAAGGTTCTCGTTCTAGCAAACAAATGCGATCTTCCCAAAGCCATGTCCGTTAAGGAGATCTCGGAAAAACTCGGTCTACATCATATTCGACAGGAATATAATATCCAGGGCTGTTGTGCAATCAGCGGAGAGGGACTGTTCGAAGGACTAGATTGGTTAGCCACAGCACTCAAAGAGGTTCCCAGCTCATCGCCCTGGGTTCAATGA

Protein

>Mapoly0044s0052.2
MGWNAGKTTILYKLKMGERVATIPTIGFNVEHLQHENNVSFTVWDVGGQSKIRQLWCHYFHDAQGLIFVVDSTDHDRMREAYEELQRLMEDPILSGVKVLVLANKCDLPKAMSVKEISEKLGLHHIRQEYNIQGCCAISGEGLFEGLDWLATALKEVPSSSPWVQ

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>