Mapoly0051s0062



Description

Protein of unknown function DUF260

Reference DB

Database ID Description
OrthoMCL OG5_164712
PFAM PF03195 Protein of unknown function DUF260
PANTHER PTHR31301 FAMILY NOT NAMED
PANTHER PTHR31301:SF2

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpASLBD6 transcription factor, ASL/LBD Mapoly0051s0062.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0051s0062.1 scaffold_51:733748..741546  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0051s0062.1  

Gene structure:

mRNA scaffold_51:733748..741546  ( + strand )
five_prime_UTR scaffold_51:733748..734741  ( + strand )
five_prime_UTR scaffold_51:734909..735132  ( + strand )
five_prime_UTR scaffold_51:737446..737548  ( + strand )
five_prime_UTR scaffold_51:738238..738288  ( + strand )
CDS scaffold_51:738289..738302  ( + strand )
CDS scaffold_51:739163..739415  ( + strand )
CDS scaffold_51:740496..740849  ( + strand )
three_prime_UTR scaffold_51:740850..741546  ( + strand )

Sequences:

Gene

>Mapoly0051s0062.1
AGAGAGAGAGAGAGAGAGAGAGAGAGAGATTGAGATTACGGTAGGAACAAGTCAGTGAGTCAGTCGGAGAGATAGAGAGAGAGAGAGAGAGGAGAGAGGGAGAGGGAGTGAGAAAGGGAGGAATCGACGGAGCGAGGAACGGGGCGGGGGGCAGGAGGAGCGGTGCAACATTGCGTCGCAGCGGGATCGAGTCGAGTACATAGCTTAATCAATAGGATTATATGTGCAGAGCAAAAGAAGGAACGTACGTCCCTGTGGGGCTAGAGCGGAGGAACTTGAGGCAACATTCTCGCTAAAGAGTAGAAGAGTCTTTGGTTTGGCTCGATTCCAAGAAAAGGAGTGAGATCAATCATCAATCAACACAGCTCTTGTTCTTGGTGCATACTCCACTCCAGTCCACTTCACTCCGACGTTTTCTCCTGCTTATCAACCCCGGATCGGTTCGGATCCTCCTCCTCTTCTGCCTTGCTTCTCTTCAGTTCCTTCCATACTCTCTCTTTCCCACCCCGCCCCTCGCCATCTCTCTCGTGCCGTGCCGTGTAACTTTGCTTCAGTTTCGCCTGTGCAAATCTCGACCTTTTCCTTCTCCCCCTCCTGTGACTGCTCCGTACGGACTGCCTGCATCCATCACCTGTCTTTCCCCCGCCAGGCCGCTAATTATTAGCACGCCTCGCTCTCCACGTCTCAGCTACGACGACCTCCTTTTCCACCTTGTCCACATCTCACGTACACCCCTAATTTATCTTTCATCTTGCTCTTTACCAAATTCCTCATCAAGCACCAGCCGATTCCTCCCCGCCCCCGTATGTTCGTACCTTTTCCCCTTCCCGTTCCTCGCAGGGTACACTGACTTCTTCACTTCGGCCTGTAGCCAGCTTCTCATCTGGAATCCATCCCATCATTCCTCCTGCGCTTTTCAGTACCTTTCTCTACCTTTTGTTCCGCCCATCCTTATATTTCGTGTCGCGCTCGAACATTCTCGGCTTTCACGGATGTGGGTGGTGTCTCCTCCGTTTTCGGTCTGAAATTTGTGGTGATAGTGAAGGTTGCAGTTGTCGCTATCATTGTGAAGTGTGTTGTCTTACTCAGTCGCTCATCTCGCCCACCTTTTCCTGTTAGCTCATCTGAAGTCCGACTCTCGTGTCCGTGTCCGTGAACCAGATCAGTCTTGGACTTGCCCTGTTAAGTTACCGGTGACTGCGTGCGCGGCCTGCTGATCTGTGAGTCCCACGAGCGCACTCGACACTTGCAGCTCGAGCTCGGTAGATCGAGAGGAGCTGAGGAGTGCATGACTTTCCGGGAGAACCAGGAATTTTGTCAAGTTTGTGCAATGACCATTTGACGATACCACCATCTTCTTCATCGAGTAACGGTTTTAGTTTGAGGTAGGTCACCAATCAACTCTCTCGGTCTGTCATCTCAAGAATGGTAAGGAACGCTGAAATATGAAGCCCATGTTTCCTCCACTTCCAAAACTACATCCATAAGCAGTAACATCAAACCCTTTTCCTGAACACCGACGACGAAAGATTTTGACGCTTGCGCTCGTGGGATCCGCCAAATTTTCCTTTCACCTCAAGACTGTCGTGGAAACCTGTTAATCGCCGGCGTCCTCATCCCCGGACACACCTCACCTCCTTCTTGGTCAAGTGGACTGCGCAACCCTATCCCCGTAGAGCGGCTGCTGGTTGCACCGATCAAGCGTGTCTTGAAAAATTCCGTGCCTCACTTTCCTGCTCCCCAGCGGCGTGCTCGAGTGTCCTCGTCTGGATTTTGAAACTTGTAGGAGAGCCGCTTCAATGCGACTGTCACGGGCCAAACCTTTGAACGGGATGGGTTCCGTAGATCCATGATCTGCGAAAACTTGGATGTTACAAAGTAATTCCAATGGACACATTCGGCCAGCCACAACATGTCTCTCCTAAGGTACTTCAACCCGAGGTTGTAATTATGGCAATGCTGCAACTTCTGGATTGTTCCCTCGCAGGAACGCCGAGCACGCCAACTGACGCTTCTGCTCCAGCAACGCGGGTGCTATAATCGAATGAAGTTGGGACCGAACTGGTACCCAGGAATCTGAAGGTTTGTCCTGTGGGCGAGGATCCGTGAGATTGTTGTGGCCTTCGTGCTCCCGAGGATCGGTTCTCGAGGAGCGTCTGTGCGACGGGGCGCGGAAACTTTGTATTTCGTTAGGACTGGCTATGCGTAGCGGTGGGGGTCCTCTCGTTGAGGATTGCTTTTTCGCTGTCAAGGAAGGAGGGCGATTACGATTCAGAGTCGTCTTACTTGATAAATACGGAAACCGGTGAAGGCTTTGTCTAGGATGGTCGCAGTCTTGTTTCCAATCTTTATAAGGTTTTCCGTATGTCCTAAATATGTTGCCTGCGGTCGGGTTCCAGTTACCTCGCTAAGCTCTTTGGGAGCTCTTTCGAGCATAGCAGCCATGAATTGCTCCGACTTGCATCATGACTATCCAGCCCTCATTACCATCTTGTGCCGTACAATTCCTGTCTAAAGTGGGGTGCCGCGGGCCAGATCATTTTTTTCTTAGATAAGGTAGTGCGGAGCACACTTTGTCCTCTCTCGATCTCATCGTGTCTGTGGCTGGGGATTTGATCTGAGTTGCTCGTCGTGGCGCAAACCCATGAAGCAGTGAGCGAGAGCGACCATTTCTTTTGATGGGCCTGTCTGGACTACAATCCCCTTACTTTCATTAGCGACTGAGAACGTGGGAGATGATCTGATTCAATCACCTCGCCCACTCGCTACCCATCCATCTCTGTGATCATAATTGGGCACGAGCGTTTTGCAAGGGATGTTTGTTGTCGCAGCTCCTGTAAGCTGATCGGAAATGCTCACAGTGGAAATCTATCGAAGTCGGTGCATGGATTTTCAGGTCCGAATAAGATCCGTTCGTAACGTCAACCGTACATCATTGGTGCACCAAATGTACGCGGCTCATCGTACGAGCTCTATTGAGTGGTCGATAGAGATCCCTTCCTCGACTCCTGCTGGTACCTGTGACTCTTGAACGCTGGGGTTTCACCTTTTAGCAGCGAACCTCACGACGTTATGTGGGTTGTTCGTCTTCCTCATTTTTGCTGCACGCCAGATGCGGAATCTGAGAATTGGTCTGCGAAGTTTCTAACGACGACTGTCATTTGTGCCCGAGGGTGATGCACAGCATTGCAGCTCGAAATTCCACTGCTGCGAACCCACTGTAATTCAGTTGCAGACCTTGAGCTTTGGAAGTCTTTGACATTTCCAGCGCCGTCATTCTGTTTATTACCCGCCCACACGAAGGGCTTGCGAAGGTCAGGAATGTGTACTTCGCTTGTTGAACCAGCTCCCCACTGGTGCGAGCTACAGGAGACTGCTCTCTGTTGGACCTCACACGTGGACGTGCAACCCGTGAGAAGGCTGCTAAGAGCCCGATGCTGAAACCTGCGAGCTCTTTGGCCCGGAGAAAGGCTGCCCGAGTAGATCACGTAACGCGAGACTTTCCCCATTCCGGCCCATGGATCGACATCACAGCGGACGAAATCTTGAACTAATGCGTGTCCAGGATTCCATGCCTCCCCTCGATACAATTGGATCTGACACCAATTTGTGGAATGCAGAATCACTTTAGTGACATCCCAAACTTTGCCCAGCTCCGTGTGTCATCCGCTGACAAATGCGACGCACATTTCATGCAGGTGAAGGACGGTTTAATCGATCTCGCTGTGAGCAAGAGAATCGACATTTGCTGCTGGGTGGTGGCGATGTCCTGAAGCCTCTTCTCGGAGAGGTTAGTGACTGGTACGTATTCGGTGAGCGGAGAATCCTAGAGTTGACAAAGTCGAATGGTCGTTAATTGCTGGTGGTTGATGCTCGCTTTGTCTTCAGTCACATGAGTATATCTTTAGGATTGTGCAGTGGATAGGTTAGCAGACTACGGGAGTGGGGCGATGGAAGATGAGATAAATAGCAAATTTATTGTCATTCCTCGAGGAAATTAAAGTGCTCTCTTCGAGCCCGTTTACCAGTGTTCCACGTTGAGTTTGACGTCGAGTCGGCAGTTAAAATTAGACGGAGACTGATAAGGTGTTTGGAAAGGGGTAACCAATGTCTACTGGTAGAGTCTACGGCCCGAGCATGTATGGAGAAAGGGCTAATTGTCGTACTCGCGGTAATTTGCAGTAGTTACAGTTCTTAACCTTACGATTTACCCAGGTTATGTCTGCATTTGAGAGTTGGATACGCGATATAGCAGTCGAGCTGAAGGTTTTTGTCAACGACCTGGGCAGATGCACTGAAGCACCTTGTACCTGACTTCTGCCAGTGTATGCCTGGCAGCGGACCCAATGAGAGTCACTGTTTCGTCAATGTGAGCAGTTTGTGAAAGATCTGAGCAGTGACCTAAAAGCTTCTCGATGAGAAAGCCAGTAGTTTTCGGTATAGGGCCGAAACTCAGTTGACCCGACACACAGTCTTCTATTTGATGGCAGGAACGCTACCCTTGAGAAGCTGGTGGGAGGACACAGGGAGCCCATGTTTGAATGTCAAAAGAGAGGTACAACATCATGAACAGTTCTAAAGCTGCACTCCAGTGGTAGAATCTTGGTTGTCTCGGGGACAGGCTGCAAGTGGCAGGTGGCCCTTGCACGCTTGTACTCCACTTTGCATTGACCATTTCAGCTCTCCGCATGCGCATAGATGATTGTGCTCGAACGATTCATTTCACTTTGTCAAGTCAGAATAACACGCTACTTCACTTTTCCTGGAAGCCATATGTTTCACTCACATCGCTCCTTTTATTTCCTGCAGTGCAGTTCAAAGCCCAGAGGTAGTCATCAACGATGTCCTTCCAGCAAACAATTCATAGATTTCCTAAACCTCTCCTCCAAGATTCTTACCTTCCTTCGCACTACCCGATTTGCGAGTATGTAGACCCGAAATATGTCATTTCTCAATGAGTTTTCTCTCAGCCAAGCGGCTTCATCGCACCGGATTGGTAGATGCGAGTGAATCTGTGGAGAGGTAGACTGATATTCTTGAGATGCCTCTACGGTGTTATGTGATTCTTGTCGCCCAGCTCGCAGTTCCTCCCGTTGTGTTTCCCACTAGGGTTATGCAGATATCGTGCCGGCATAGTACCCTTCCCGAGACTGAATCTTTCCGAAAGAGTCAAACCTCGAAACTTGCCAAGCTGCCTTTTTGGGCACCGCCCAAAATCCACGACCCAGTCTATGGATCACAATTGCATCGTCTGTCATACTCATCCGAAAAACATTGCCAAGATTACAAAACCCTAGCGCTCGAGATTGCGTCGATTTTGACACAGTCGACGAGCAGGCTCAGAGCCGAATCATCATGAGCGGCGAAAGATGTCTTGCATATGTGGTCGGGCTCACGGTGGGGTGTCTGGTGCAGGGAAACATTTGGATTACTAGATAGCAACTCGCGGAAAATCCGACGAGCGGAACCGGAGAAAGTTGTTCGCCGAGCCATGCTGGGACCACAAGGGCAAGGCAACTCGTCCACACCATGTGCTGCGTGCAAGCTGCTGCGGCGCCGGTGCGCGCAAGAATGCCCGTTCTCGCCGTACTTCTCCCCGCACGAGCCCCAGAAATTCGCTTGTGTCCACAAGATCTTCGGTGCGAGCAATGTATCAAAAATGCTGATGGTGAGTCCCCTCTGCCCTCGCTCCAATCCCAACCGCAGTCACCATTCATGGACGCACCTGAGGTTCCGTCTGCAGAACGGATCCCACGCAAATCCTCGTACCTCCCCTCAGGAGGACGATGTCTAGACGCAAGAATAATTGCCCCGCGAATGGGGACCATTTCAAATTGTCAGGGACCGGCCCGCGCAGCTGAGCAAGTCCACCTGCACGACCTGTATTATGCGCAGTGTGCCATGCAATCAATACCCGGAGGGCAGCACAGCCATCCCTAAAGCCCAATTCGCCATTCCAGGCTTCCGGTACGCACAGACGCGCACGCCGGCGCAGGTCTGTCGAATGCCGAGTCCCGCCCCACGCGGCCGCGAGGGGCAAATTATCCCATGACTCGGCGGTCCTTGGGGCGGGGAAGGCGAACGGGAAGGGGAAGGTCGTGCTTTCGCTCGCAGGCAGGCCGACGCAAGCGCGGCGACTCGGCTCGATCGCCGAAGCCAGGCCCAGGCCGGCGACGCGACCTCGACGCGACCACGGGACGGTGCGAGTAAAATCGGGATTCAGGACGACGGGCGGACGAGCGGCCCGTCTCCGCCGGACGGACGCTCGACCGAGAGTCGGATCTGGAAATCGATACGTCGAGCGCATTGCACAATGTCGACCTGCCCGTGTCGAGGATCCGTGGCCCGGACCTGCGATGTGAGTGAGTGAGTGCGCGCTGGAGACCGGGAGCGGGACGGATGGAGATCACGTCAGCGCTCCTCGTCTAGGCGCCGGCGCGACGCTCCAGTTCCGATTGCGATTCGCTGTGCAGTATCCGTTAGACTGATTTTGAACGGGAGGCCTGATGGCCGAGCGCGCGTGAGGTGTGCGCGGCCGAGTCGGCGGCGGATGGCGGTCGAATTGAACGTTGCCTGGCCGCGCGCCACTCGGTCGCTTTCTTTGGGGCGTTGCAGGCGAGGCGGTCCGATGGACCGAGTGAGTGAGTGAGTTTTGAGTGAGGGAGGGAGGGAGTGAGAGAAAGAAAGAAAGGCGTCGAGAGGGAGCTAACTGAGTCGGATTCTATGGTTGGGGTCATGGTGGTGGCAGGAAGTACCAGAGAGCCAGAGGGCCGATGCCGCAAGCAGTCTGGTGTACGAGGCAAATGCTCGCATTCGTGACCCTGTGTATGGCTGCATGGGGGCCATTTCTGCATTGCAACAGCAGGCACAGTCATTACAGGCCGAACTCAATGCTGTTCGGCAAGAAATCATGCGCTACCGCTGTCATGAGAATGCCGTCGCTGCTGTTATGGTGGCTGGATTTCCACCGAACAACGACAGGAGCACAGGCTCAGGGGCACTCTCTTCTCAAACTTCAGCTTCTACCGACTACACCGTACCTTCCCCTAGCAGCGTGGCTACTCCAGACGTGAAGGAGCGGTATTGGACATCCATGAACTAAAGAAGAAACTGTTTGAAGTTCCCACTTTCTTAACAAATGGTGGCAGCATTGCAGCCTCCATTTGTCAAGAAAATGTAACAAGGAAACTAAAATTTGCCTCGGTATGCTGTCAAAAGTATTTGTTAGGGTCGATCGTGTCACAGTTATGATTAAAATCTTTCCCCTTCCACCCCCGTCCCCCTCCCCGGCCTACCGTTGGCCGCAAATGCAATTCTTTTTCTTATTTAGCAAATAATACTAGTGCCCCTGGGCTGCAGCATGTAGCCCTTCTACCCTATCATGATCTTCCAAGCACGCTCCAAGCTATCTCATCCAGCACGCATTGATGTGCATTCAGTGAAGCTGATCAATGTCAACTTTCACGGCAGCCATCAATCATCCTCTGAGCCTTCAAGAATGTCTAGGGGTTGTGAATCATCCAAAGGGTAAGCCAGCAGCCAGATGCTATTCTTGCTGTACATGTGAACCAGTCTCTGTTTGAATGGAAGTTTATGGTTTATCATTGTCCATACTTGCAAGAGGAGTCAATTTTGCGAAAGTAAGAGCCTTTAGTTAGCACAAGTTTATGTGTAAAGGAGTTATGATTGTCTTTATGTAGGTGGTGATGTTTTACCTACCCTATATTATCTGTATGGGTACAATCATTTGTAAGAGACACCTAAGAAATGAGAAGTTAAATCAGTTAAAAGAGCCGTTG

mRNA

>Mapoly0051s0062.1
AGAGAGAGAGAGAGAGAGAGAGAGAGAGATTGAGATTACGGTAGGAACAAGTCAGTGAGTCAGTCGGAGAGATAGAGAGAGAGAGAGAGAGGAGAGAGGGAGAGGGAGTGAGAAAGGGAGGAATCGACGGAGCGAGGAACGGGGCGGGGGGCAGGAGGAGCGGTGCAACATTGCGTCGCAGCGGGATCGAGTCGAGTACATAGCTTAATCAATAGGATTATATGTGCAGAGCAAAAGAAGGAACGTACGTCCCTGTGGGGCTAGAGCGGAGGAACTTGAGGCAACATTCTCGCTAAAGAGTAGAAGAGTCTTTGGTTTGGCTCGATTCCAAGAAAAGGAGTGAGATCAATCATCAATCAACACAGCTCTTGTTCTTGGTGCATACTCCACTCCAGTCCACTTCACTCCGACGTTTTCTCCTGCTTATCAACCCCGGATCGGTTCGGATCCTCCTCCTCTTCTGCCTTGCTTCTCTTCAGTTCCTTCCATACTCTCTCTTTCCCACCCCGCCCCTCGCCATCTCTCTCGTGCCGTGCCGTGTAACTTTGCTTCAGTTTCGCCTGTGCAAATCTCGACCTTTTCCTTCTCCCCCTCCTGTGACTGCTCCGTACGGACTGCCTGCATCCATCACCTGTCTTTCCCCCGCCAGGCCGCTAATTATTAGCACGCCTCGCTCTCCACGTCTCAGCTACGACGACCTCCTTTTCCACCTTGTCCACATCTCACGTACACCCCTAATTTATCTTTCATCTTGCTCTTTACCAAATTCCTCATCAAGCACCAGCCGATTCCTCCCCGCCCCCGTATGTTCGTACCTTTTCCCCTTCCCGTTCCTCGCAGGGTACACTGACTTCTTCACTTCGGCCTGTAGCCAGCTTCTCATCTGGAATCCATCCCATCATTCCTCCTGCGCTTTTCAGTACCTTTCTCTACCTTTTGTTCCGCCCATCCTTATATTTCGTGTCGCGCTCGAACATTCTCGGCTTTCACGGATATCAGTCTTGGACTTGCCCTGTTAAGTTACCGGTGACTGCGTGCGCGGCCTGCTGATCTGTGAGTCCCACGAGCGCACTCGACACTTGCAGCTCGAGCTCGGTAGATCGAGAGGAGCTGAGGAGTGCATGACTTTCCGGGAGAACCAGGAATTTTGTCAAGTTTGTGCAATGACCATTTGACGATACCACCATCTTCTTCATCGAGTAACGGTTTTAGTTTGAGGTGAAGGACGGTTTAATCGATCTCGCTGTGAGCAAGAGAATCGACATTTGCTGCTGGGTGGTGGCGATGTCCTGAAGCCTCTTCTCGGAGAGGTTAGTGACTGGAACGCTACCCTTGAGAAGCTGGTGGGAGGACACAGGGAGCCCATGTTTGAATGTCAAAAGAGAGGGAAACATTTGGATTACTAGATAGCAACTCGCGGAAAATCCGACGAGCGGAACCGGAGAAAGTTGTTCGCCGAGCCATGCTGGGACCACAAGGGCAAGGCAACTCGTCCACACCATGTGCTGCGTGCAAGCTGCTGCGGCGCCGGTGCGCGCAAGAATGCCCGTTCTCGCCGTACTTCTCCCCGCACGAGCCCCAGAAATTCGCTTGTGTCCACAAGATCTTCGGTGCGAGCAATGTATCAAAAATGCTGATGGAAGTACCAGAGAGCCAGAGGGCCGATGCCGCAAGCAGTCTGGTGTACGAGGCAAATGCTCGCATTCGTGACCCTGTGTATGGCTGCATGGGGGCCATTTCTGCATTGCAACAGCAGGCACAGTCATTACAGGCCGAACTCAATGCTGTTCGGCAAGAAATCATGCGCTACCGCTGTCATGAGAATGCCGTCGCTGCTGTTATGGTGGCTGGATTTCCACCGAACAACGACAGGAGCACAGGCTCAGGGGCACTCTCTTCTCAAACTTCAGCTTCTACCGACTACACCGTACCTTCCCCTAGCAGCGTGGCTACTCCAGACGTGAAGGAGCGGTATTGGACATCCATGAACTAAAGAAGAAACTGTTTGAAGTTCCCACTTTCTTAACAAATGGTGGCAGCATTGCAGCCTCCATTTGTCAAGAAAATGTAACAAGGAAACTAAAATTTGCCTCGGTATGCTGTCAAAAGTATTTGTTAGGGTCGATCGTGTCACAGTTATGATTAAAATCTTTCCCCTTCCACCCCCGTCCCCCTCCCCGGCCTACCGTTGGCCGCAAATGCAATTCTTTTTCTTATTTAGCAAATAATACTAGTGCCCCTGGGCTGCAGCATGTAGCCCTTCTACCCTATCATGATCTTCCAAGCACGCTCCAAGCTATCTCATCCAGCACGCATTGATGTGCATTCAGTGAAGCTGATCAATGTCAACTTTCACGGCAGCCATCAATCATCCTCTGAGCCTTCAAGAATGTCTAGGGGTTGTGAATCATCCAAAGGGTAAGCCAGCAGCCAGATGCTATTCTTGCTGTACATGTGAACCAGTCTCTGTTTGAATGGAAGTTTATGGTTTATCATTGTCCATACTTGCAAGAGGAGTCAATTTTGCGAAAGTAAGAGCCTTTAGTTAGCACAAGTTTATGTGTAAAGGAGTTATGATTGTCTTTATGTAGGTGGTGATGTTTTACCTACCCTATATTATCTGTATGGGTACAATCATTTGTAAGAGACACCTAAGAAATGAGAAGTTAAATCAGTTAAAAGAGCCGTTG

CDS

>Mapoly0051s0062.1
ATGTCAAAAGAGAGGGAAACATTTGGATTACTAGATAGCAACTCGCGGAAAATCCGACGAGCGGAACCGGAGAAAGTTGTTCGCCGAGCCATGCTGGGACCACAAGGGCAAGGCAACTCGTCCACACCATGTGCTGCGTGCAAGCTGCTGCGGCGCCGGTGCGCGCAAGAATGCCCGTTCTCGCCGTACTTCTCCCCGCACGAGCCCCAGAAATTCGCTTGTGTCCACAAGATCTTCGGTGCGAGCAATGTATCAAAAATGCTGATGGAAGTACCAGAGAGCCAGAGGGCCGATGCCGCAAGCAGTCTGGTGTACGAGGCAAATGCTCGCATTCGTGACCCTGTGTATGGCTGCATGGGGGCCATTTCTGCATTGCAACAGCAGGCACAGTCATTACAGGCCGAACTCAATGCTGTTCGGCAAGAAATCATGCGCTACCGCTGTCATGAGAATGCCGTCGCTGCTGTTATGGTGGCTGGATTTCCACCGAACAACGACAGGAGCACAGGCTCAGGGGCACTCTCTTCTCAAACTTCAGCTTCTACCGACTACACCGTACCTTCCCCTAGCAGCGTGGCTACTCCAGACGTGAAGGAGCGGTATTGGACATCCATGAACTAA

Protein

>Mapoly0051s0062.1
MSKERETFGLLDSNSRKIRRAEPEKVVRRAMLGPQGQGNSSTPCAACKLLRRRCAQECPFSPYFSPHEPQKFACVHKIFGASNVSKMLMEVPESQRADAASSLVYEANARIRDPVYGCMGAISALQQQAQSLQAELNAVRQEIMRYRCHENAVAAVMVAGFPPNNDRSTGSGALSSQTSASTDYTVPSPSSVATPDVKERYWTSMN

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>