Mapoly0058s0005



Description

MYB-LIKE DNA-BINDING PROTEIN MYB

Reference DB

Database ID Description
GO GO:0003682 Chromatin binding
OrthoMCL OG5_127030
PFAM PF00249 Myb-like DNA-binding domain
PFAM PF13921 Myb-like DNA-binding domain
PANTHER PTHR10641 MYB-LIKE DNA-BINDING PROTEIN MYB
PANTHER PTHR10641:SF221

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
Mp3R-MYB2 transcription factor, MYB Mapoly0058s0005.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0058s0005.1 scaffold_58:62815..67768  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0058s0005.1  

Gene structure:

mRNA scaffold_58:62815..67768  ( - strand )
three_prime_UTR scaffold_58:62815..62905  ( - strand )
CDS scaffold_58:62906..62985  ( - strand )
CDS scaffold_58:64298..64542  ( - strand )
CDS scaffold_58:64653..64781  ( - strand )
CDS scaffold_58:65233..65336  ( - strand )
CDS scaffold_58:65492..65586  ( - strand )
CDS scaffold_58:65709..65766  ( - strand )
CDS scaffold_58:66161..66227  ( - strand )
CDS scaffold_58:66382..66560  ( - strand )
five_prime_UTR scaffold_58:66561..66591  ( - strand )
five_prime_UTR scaffold_58:67635..67768  ( - strand )

Sequences:

Gene

>Mapoly0058s0005.1
GAGAGAGAACGTTCAAGACTGCTGCTGGAGCATGTAGAGCAGAGCTTGTTGAGGATTTATCGTTGAGATCGTGGGATCGCCGGCACCGACAACTGCTGCAACTGTTGTTGCTGCTGCTCCTGCACCGGCTGCAGGTGAGCGATTGGATTTCACGCTGCTCCGCAACGTTGTGCATGTGATCTCGTGATGCTCTGCCACTAACGTGTTGAATTAAGGTTGCAGTTGTCGATGTCCACACGTTAACAAGTAGATGATGAAGTACTTGCAGCTGATGATTTCATGCATATCCTTCCGGTCGTTGAACTTTACTGGTCAGTGTACCAGCTTGTTGCTGCTATTGCTTGGTGCAAATCACATCTTTGTCCCCTGTCAACACGAGTACTCTCGTGAATTTGTTTCAACCCAATCAAGATCACATTGAGGTTGGTTTGTTGAAGTATACGGTAGGTCTATTGTAATTCTTTCGTGGCCGTGCCACGAGTGAAGGTTGTTGATACTCTGCTTTGTACATTTGAGGCAATCCATGATTTTGAGCTATTCAAAACCGTGAGTGCTACTCACTACGCTCTGGAGTTGAGGTTCTGCTATCTGAACATAAGACAGAACTGAGTACTTCAACTCTGAGAGCCTCATGTTTTGTGATCAAACTCACCCTCCTCCAATCATGTAGATAACAGGCAAGTTTTGACGAGTGCACATGTTAATGCCAACACTTTGAAATCATCTTTACCTTGCGGTTGTGTATCCAATGAAAGCGATCATGAGTCTCAGTGATATAAAGAAAGAAAAATTGTGATGAGAGGTGATGCTTGAATAGCATCAGACAAAAATATGCCAACACCTGTTGAAGTTGTCTTGCCGTTTAGACTATAACAGTTTTGACCATCATTCGTGCCACCATCATTCGATGATATTAAAAGTTTCTTCTGTCTTTTTTCGCGTGTCTTTAGTTTCTCTTCTTATCCCATTTATGCAACTCTGTTACCAATTGGGTGACAAAAGAAAATTGAATAGTTATTACAGAGTAAAGTTTTGACAATCATTCGATAGTATTGAAAGGTTCTTCTTTCTTTTCATCTCTGGCTTTTTTCGCATCTCTCTAGTTTCTCTTCTTATCCTATTTAAGCAATTCTGTTACCAATTGATTGACACAAAAAGAGTTGAAGGATTATTGCAGAATATATTTTTGAGAACTAGAGTTGGAACAAATGGAGGGAACTTCGTCTTCAGCCATATCAAAACTCGAGCCTAGGCGATGCCTCGGAGACATCAGCAATTCTAGCGAGCCAAAACTCGAGCCTAGGAGATGCCTCGGAGACATCAGCAATTCTAGCGAGGCGGATCTAGCTATTATATTGGTCAATGATCGCGTGGATCACACCGAGAAGTAAGAACATTCATTATGTTTTGCTCGCAGCAACATTTCACTTTTGCAATTGACTCCAGATACCAACATAAAGCGAAATCCACCACCAGTAAATCATGGCTAAATCAAATATTTGAGCTGAAGTCTAAAATTGTGGCTGCTCTCGATGTCCCAGGGGGAAGGCAAAAGTTAATGATGTGCCTCCACCACGTAAGCAGATTAGAACTTGGACGATTGAGGAGGTAAGTACTGTAGTCTAACTAATACTATACTTCTGGATGTAAGTCAATGCTTCAATCTTGGATCTGTTTAGAACTAGCAGGTCCAAACATGTGTCCACTTTCACCATTTCAAGCGATCACGACCTCAGTACCGTTCGTCTGAACAACATGCACGCAGTTGGCAATCCTTTAGTAATATGTGTTGAAGGAGAACCTTGAATGTGATGAGCTTTAAGTGCAAACTCTTTCTTATGAGGTCGTGCTAATTCATGATCAAGCTTAGTCATAGGACAGTTTTTACTTCCCCGCTCCTATCTAAGGTACTTTTACGTGGAGCGTAACGAAGTGATAAAAATCAGCTGCGATATTTGATAGCATCTAATTTTTATCTGAAAATTTACCATATTGTTGCCAGGATGATGCTTTACGAGCGGCCGTTGCCCTTCACAAAGCGCGCAATTGGAAACAGATCGGTAAGTGTATGTGTAAATAAGGGAGGTATATATGTATCATGCATGAATGTGGCAATTTCAGTAGCTGGAGACCTTTGCTATAATGTGGAAAATCTCATGCATTTAGCTCATGGCATGTGCAGCTGCGGCTTTACCGAACCGATCAGACGTTCAGTGTCTTCATCGGTGGCAGAAAGTGCTCAATCCCGTTCTTGTGAAAGGATACTGGACCAAGGAGGTTAGAAGACGAAGACTAGCCTTCTTGTTGTACACTCAGTTTATCTTGTTTATCAGTCTTGTTATACAGTGTATGCTTAGATGTTTCAGGCACCCATGACCTACTCATTGCTAATGGGTAACTCTGGACACTAATTGCAATGGGTTCATTCGCAGGAGGACGAGCGCATGATTGAACTGGTGGCGATGTTCGGAGTGAAGCGATGGGCTGCCATCGCTCGCTCTCTACCAGGCAGAAATGGGAAGCAATGTCGAGAAAGGTGCGTCTCAGTTATCTACACTATATATCTGTAGTTGATTGTTAATGAAGCTATATACAAATGGGTGTTTTAGTGGTAGATACATGTCGTTCTGCACATTATTACATTGATCTGAAGAAAGTCTCAACTAGCGTCCTAAGTCTACAGCTCTTAACAGTTCCTTTAGAGAGCAGTTATTACTGACCAGTTCACAGACGTTTAATTCGACATTTGCATACAGGATATCCATACCCATTTACCATACGGACTCCGTTCAATATCCTTGTCTTCCAGTTAAAACGTCACCATAATTACCACTATTTGCCATTACCATTATTTAACTTGTAGTGCAAAGGAATCTACGACGTCTTTCGTCTTATACATATTTATTTATATTCATATTTCTAATAGAGAGAGAGAGAGAGAGATGCTTCAATCCAACTTCCTGAATTGCTAAATTCTTTCTATACAGATGGTGCAATCATCTGGATCCCCAGATCAAGAGGGAGCCATGGACAGAGGCAGAAGATATGATGCTGTTTTTGGCTCACAAGCGGTTTGGAAACAAGTGGGCTGAGATATCCAAGCTACTTCCTGGCAGGTACATGCATTCCCTCTCAATTGTGTTCTCACTGTCTACGTTATAAGTCAAAATTTCGTGGAAACTCGTATTAAGATAATTCGGCTGTATGAAATGTGCACCATCTGCAGGTCCGATAATGGCATAAAAAACAGGTGGAATACGGCAGTACAAAGAAAGGCCGAGGCCCTGGAGGCATGTGCCGCCAGTTGGAACAAGCTTAAGCCATCTGGGAGTTTTCTGTCCAACGAGACCACCAATGGTTCTGAGGTACCTCAGGACTCATTGGCATTGAGTGACCAGGCGACCACTGAAGTTGAAGAATCTAGTGCTGCGCAGGACCTGTTGGCATTGACCAAAGACTACGATTCTGAAGGTACCGACGAGATGGTAATGGATGGGCAAGATTATTCTGACATACGAGAGTTCAGATTCTGTATCTGATACGATTATGTAAACCTGCACACAAGTTTCATGGTGACATAACTTTGGCTCATTTCGTTGTTTTGCTATTCCAAGTAGATGTAATTATTGATGAAGGTTTCCCACTGGTAAAGTGGATATTTCGTCAGTTTGTTCTCAATTTCCATGCAATGGCCCGCGACAAAGTAACTTAGGGACATGGGCTAAAACTAAAGACATGGGCTACATTATTTTAACTTCTGAAGTATGCAATCATTTCTTTTGCAATTTCAGAATCTTGCCTTTTGATTTTTTTTTTGTCGCTAAATTGTTGCCAAACTGAAGTCAAATCTCCACAAAAACAAGGAAGCAGATCAAATTTCAAATATCATGTCCCCAAATTGGGTCTCACAATAGATTAGATTCAGATGATATTAGTCTCACTCTTCATGTTATTGTCTTCTAGTCCAGAATTCATAAATATCTGTTTGAAAGAACCGAAACTTGAGATGTTGAGAGTCTATACACGTTAGGGAATGTAGATCGGTTTTTATAATGTATGTTTCTCAATTGCAATTCGTTTGTTCGGATGGCTTTCTTATAATCAGAATGGAAATATCAACGAGGTAAAACCTACTTCTTCATGCTAACAGAAATTCTTTAATTCTTATGCATCTAGAGCGAGCTTTCATTGCTTGAACATGAGCTTTCATTCTTCTCATCCTTGGAGAATGTCTTTCCAAAAGGAGGTGACATGGCACAAATTTTTACGCACGTAACGTTTATAAATCCACCATTATTATTCTCTACTACCAACATTCCATGTATAATCTATTTGTATGTTTATTGAAATACATCATAAATCGTTAGAAAAATCTTGTAAGTATATTACACAGAAAACTAGAATTCTTCAATTGAAGTAAAGAAATGCATAGAATCCAAAATATATGCTTTTAGTTACAAACGGAAAAGTTCAGTGACTACCGAAAGTCAGTCAATATGAAAATTAATAGGTCTTGAAAGTCAATCAATACAAAAATCCAGAGGTTGTGAAAGTCAATAAATATAAAATTGAGCCAACTTCTTCAACAAGCATGAATATATCCTCAGCATGAGCTTTTTAGCTTTTGTATGTTAAAAATCATCTCTGCAGGTATAAAACTAAATATGTGAGCTTGAGTCATAATCTTAAAAATGATAGCTTAGAATTCTGTTTGGCTTATTCTTACATTTTGATTGACTTTGATGATGCTGCTAATTAGATGTTAACTGAAATTGTGTTACAGATTTTGTTCCTGATTTTATAAAAAGGTGGAAAGATTTGAGACTCTTCAGTTATAAAGCGAGTGATCATAAATGCTTATAACTTCTTGGCATTTCAATTTACAAAAACTGCTTCAAGATGTATGCGGAGACAAAGAGATGATTAATCATCAAGTAATAGCAGCAACAAGCAG

mRNA

>Mapoly0058s0005.1
GAGAGAGAACGTTCAAGACTGCTGCTGGAGCATGTAGAGCAGAGCTTGTTGAGGATTTATCGTTGAGATCGTGGGATCGCCGGCACCGACAACTGCTGCAACTGTTGTTGCTGCTGCTCCTGCACCGGCTGCAGAATATATTTTTGAGAACTAGAGTTGGAACAAATGGAGGGAACTTCGTCTTCAGCCATATCAAAACTCGAGCCTAGGCGATGCCTCGGAGACATCAGCAATTCTAGCGAGCCAAAACTCGAGCCTAGGAGATGCCTCGGAGACATCAGCAATTCTAGCGAGGCGGATCTAGCTATTATATTGGTCAATGATCGCGTGGATCACACCGAGAAGGGGAAGGCAAAAGTTAATGATGTGCCTCCACCACGTAAGCAGATTAGAACTTGGACGATTGAGGAGGATGATGCTTTACGAGCGGCCGTTGCCCTTCACAAAGCGCGCAATTGGAAACAGATCGCTGCGGCTTTACCGAACCGATCAGACGTTCAGTGTCTTCATCGGTGGCAGAAAGTGCTCAATCCCGTTCTTGTGAAAGGATACTGGACCAAGGAGGAGGACGAGCGCATGATTGAACTGGTGGCGATGTTCGGAGTGAAGCGATGGGCTGCCATCGCTCGCTCTCTACCAGGCAGAAATGGGAAGCAATGTCGAGAAAGATGGTGCAATCATCTGGATCCCCAGATCAAGAGGGAGCCATGGACAGAGGCAGAAGATATGATGCTGTTTTTGGCTCACAAGCGGTTTGGAAACAAGTGGGCTGAGATATCCAAGCTACTTCCTGGCAGGTCCGATAATGGCATAAAAAACAGGTGGAATACGGCAGTACAAAGAAAGGCCGAGGCCCTGGAGGCATGTGCCGCCAGTTGGAACAAGCTTAAGCCATCTGGGAGTTTTCTGTCCAACGAGACCACCAATGGTTCTGAGGTACCTCAGGACTCATTGGCATTGAGTGACCAGGCGACCACTGAAGTTGAAGAATCTAGTGCTGCGCAGGACCTGTTGGCATTGACCAAAGACTACGATTCTGAAGATTTTGTTCCTGATTTTATAAAAAGGTGGAAAGATTTGAGACTCTTCAGTTATAAAGCGAGTGATCATAAATGCTTATAACTTCTTGGCATTTCAATTTACAAAAACTGCTTCAAGATGTATGCGGAGACAAAGAGATGATTAATCATCAAGTAATAGCAGCAACAAGCAG

CDS

>Mapoly0058s0005.1
ATGGAGGGAACTTCGTCTTCAGCCATATCAAAACTCGAGCCTAGGCGATGCCTCGGAGACATCAGCAATTCTAGCGAGCCAAAACTCGAGCCTAGGAGATGCCTCGGAGACATCAGCAATTCTAGCGAGGCGGATCTAGCTATTATATTGGTCAATGATCGCGTGGATCACACCGAGAAGGGGAAGGCAAAAGTTAATGATGTGCCTCCACCACGTAAGCAGATTAGAACTTGGACGATTGAGGAGGATGATGCTTTACGAGCGGCCGTTGCCCTTCACAAAGCGCGCAATTGGAAACAGATCGCTGCGGCTTTACCGAACCGATCAGACGTTCAGTGTCTTCATCGGTGGCAGAAAGTGCTCAATCCCGTTCTTGTGAAAGGATACTGGACCAAGGAGGAGGACGAGCGCATGATTGAACTGGTGGCGATGTTCGGAGTGAAGCGATGGGCTGCCATCGCTCGCTCTCTACCAGGCAGAAATGGGAAGCAATGTCGAGAAAGATGGTGCAATCATCTGGATCCCCAGATCAAGAGGGAGCCATGGACAGAGGCAGAAGATATGATGCTGTTTTTGGCTCACAAGCGGTTTGGAAACAAGTGGGCTGAGATATCCAAGCTACTTCCTGGCAGGTCCGATAATGGCATAAAAAACAGGTGGAATACGGCAGTACAAAGAAAGGCCGAGGCCCTGGAGGCATGTGCCGCCAGTTGGAACAAGCTTAAGCCATCTGGGAGTTTTCTGTCCAACGAGACCACCAATGGTTCTGAGGTACCTCAGGACTCATTGGCATTGAGTGACCAGGCGACCACTGAAGTTGAAGAATCTAGTGCTGCGCAGGACCTGTTGGCATTGACCAAAGACTACGATTCTGAAGATTTTGTTCCTGATTTTATAAAAAGGTGGAAAGATTTGAGACTCTTCAGTTATAAAGCGAGTGATCATAAATGCTTATAA

Protein

>Mapoly0058s0005.1
MEGTSSSAISKLEPRRCLGDISNSSEPKLEPRRCLGDISNSSEADLAIILVNDRVDHTEKGKAKVNDVPPPRKQIRTWTIEEDDALRAAVALHKARNWKQIAAALPNRSDVQCLHRWQKVLNPVLVKGYWTKEEDERMIELVAMFGVKRWAAIARSLPGRNGKQCRERWCNHLDPQIKREPWTEAEDMMLFLAHKRFGNKWAEISKLLPGRSDNGIKNRWNTAVQRKAEALEACAASWNKLKPSGSFLSNETTNGSEVPQDSLALSDQATTEVEESSAAQDLLALTKDYDSEDFVPDFIKRWKDLRLFSYKASDHKCL

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>