Mapoly0058s0090



Description

Protein of unknown function DUF260

Reference DB

Database ID Description
OrthoMCL OG5_147276
PFAM PF03195 Protein of unknown function DUF260
PANTHER PTHR31301 FAMILY NOT NAMED
PANTHER PTHR31301:SF5

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpASLBD7 transcription factor, ASL/LBD Mapoly0058s0090.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0058s0090.1 scaffold_58:914544..915212  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0058s0090.1  

Gene structure:

mRNA scaffold_58:914544..915212  ( - strand )
CDS scaffold_58:914544..915212  ( - strand )

Sequences:

Gene

>Mapoly0058s0090.1
ATGGCATCGTCATCAAGCTCGCCGTGTGCTGCCTGTAAGTTTCTCAGAAGGAAGTGTACAGCGGAGTGCGTGTTCGCGCCGTATTTTCCACCGGATCAACCCCATAAATTTGCGAATGTACACAAGATTTTCGGTGCGAGTAATATCACTAAGCTTCTGAACGAGCTGCCCGTACAACAACGAGAGGACGCGGTGAATTCGCTGGCGTACGAGGCGGATGCCAGGGTCAAGGATCCGGTCTATGGATGCGTGGGAGCGATCTCGGTGCTCCAACGACAAGTTGCGCAGTTGCAGCAAGAATTAGCTATCGCGCATTCAGATCTCGCCAGATATGCCGGGGCAGGAATGGTAGGGGGCCCAGGTAGCGTGACGCAGGGAATGCCCTCCTCGTCGCTCGGAATTGGCATGGGTTTATCGCCTGCGCCGTCGCGCGAGCAGCAGCAGCAGATGCTGACCCGAGAGCAGCTGCTGGACCTGGCCCGCGAGCCGCAACTCTCGCGCGAGCAGCTGCTGGAGCTGGCTAGGGTTGGCGGAGGATCTTACGAGGCCGGCCTCGCAGCGCTGGGCCTCACGGGAGCGCTAGGACCGCTCGGACCCTTTCCTTCCCGTCAAGGGAGCGATGGCAGCGGAAGCGGTGGCGGCATGGGAGGGCACTTATCTCCTCCATAA

mRNA

>Mapoly0058s0090.1
ATGGCATCGTCATCAAGCTCGCCGTGTGCTGCCTGTAAGTTTCTCAGAAGGAAGTGTACAGCGGAGTGCGTGTTCGCGCCGTATTTTCCACCGGATCAACCCCATAAATTTGCGAATGTACACAAGATTTTCGGTGCGAGTAATATCACTAAGCTTCTGAACGAGCTGCCCGTACAACAACGAGAGGACGCGGTGAATTCGCTGGCGTACGAGGCGGATGCCAGGGTCAAGGATCCGGTCTATGGATGCGTGGGAGCGATCTCGGTGCTCCAACGACAAGTTGCGCAGTTGCAGCAAGAATTAGCTATCGCGCATTCAGATCTCGCCAGATATGCCGGGGCAGGAATGGTAGGGGGCCCAGGTAGCGTGACGCAGGGAATGCCCTCCTCGTCGCTCGGAATTGGCATGGGTTTATCGCCTGCGCCGTCGCGCGAGCAGCAGCAGCAGATGCTGACCCGAGAGCAGCTGCTGGACCTGGCCCGCGAGCCGCAACTCTCGCGCGAGCAGCTGCTGGAGCTGGCTAGGGTTGGCGGAGGATCTTACGAGGCCGGCCTCGCAGCGCTGGGCCTCACGGGAGCGCTAGGACCGCTCGGACCCTTTCCTTCCCGTCAAGGGAGCGATGGCAGCGGAAGCGGTGGCGGCATGGGAGGGCACTTATCTCCTCCATAA

CDS

>Mapoly0058s0090.1
ATGGCATCGTCATCAAGCTCGCCGTGTGCTGCCTGTAAGTTTCTCAGAAGGAAGTGTACAGCGGAGTGCGTGTTCGCGCCGTATTTTCCACCGGATCAACCCCATAAATTTGCGAATGTACACAAGATTTTCGGTGCGAGTAATATCACTAAGCTTCTGAACGAGCTGCCCGTACAACAACGAGAGGACGCGGTGAATTCGCTGGCGTACGAGGCGGATGCCAGGGTCAAGGATCCGGTCTATGGATGCGTGGGAGCGATCTCGGTGCTCCAACGACAAGTTGCGCAGTTGCAGCAAGAATTAGCTATCGCGCATTCAGATCTCGCCAGATATGCCGGGGCAGGAATGGTAGGGGGCCCAGGTAGCGTGACGCAGGGAATGCCCTCCTCGTCGCTCGGAATTGGCATGGGTTTATCGCCTGCGCCGTCGCGCGAGCAGCAGCAGCAGATGCTGACCCGAGAGCAGCTGCTGGACCTGGCCCGCGAGCCGCAACTCTCGCGCGAGCAGCTGCTGGAGCTGGCTAGGGTTGGCGGAGGATCTTACGAGGCCGGCCTCGCAGCGCTGGGCCTCACGGGAGCGCTAGGACCGCTCGGACCCTTTCCTTCCCGTCAAGGGAGCGATGGCAGCGGAAGCGGTGGCGGCATGGGAGGGCACTTATCTCCTCCATAA

Protein

>Mapoly0058s0090.1
MASSSSSPCAACKFLRRKCTAECVFAPYFPPDQPHKFANVHKIFGASNITKLLNELPVQQREDAVNSLAYEADARVKDPVYGCVGAISVLQRQVAQLQQELAIAHSDLARYAGAGMVGGPGSVTQGMPSSSLGIGMGLSPAPSREQQQQMLTREQLLDLAREPQLSREQLLELARVGGGSYEAGLAALGLTGALGPLGPFPSRQGSDGSGSGGGMGGHLSPP

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>