Mapoly0069s0082



Description

ZINC FINGER CCHC DOMAIN CONTAINING PROTEIN

Reference DB

Database ID Description
GO GO:0003676 Nucleic acid binding
GO GO:0008270 Zinc ion binding
OrthoMCL OG5_128115
PFAM PF00098 Zinc knuckle
PANTHER PTHR23002 ZINC FINGER CCHC DOMAIN CONTAINING PROTEIN
PANTHER PTHR23002:SF51

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpC2H2-11 transcription factor, C2H2-ZnF Mapoly0069s0082.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0069s0082.1 scaffold_69:934537..938037  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0069s0082.1  

Gene structure:

mRNA scaffold_69:934537..938037  ( + strand )
five_prime_UTR scaffold_69:934537..934905  ( + strand )
CDS scaffold_69:934906..935081  ( + strand )
CDS scaffold_69:936175..936270  ( + strand )
CDS scaffold_69:936950..937475  ( + strand )
three_prime_UTR scaffold_69:937476..938037  ( + strand )

Sequences:

Gene

>Mapoly0069s0082.1
CTTTCTCCTCAGTAAAGTTCAAATTTAAGATCAGTGAAGGGTAAACGAAACTTTTAAGAGTTGCAGAAGGCCTGTGGGGGTATAATTGCGAAGACCAGAGCAAATGCGAATTGTAAGGGAGCCGTAGAACGAGCGGGTGGAGCGTCTAGTCCAAGCCCCGGAGACCATTTTCCTGTTTCGAAGGGAGGGAGCGGAGCAGAGCAAAGCTGCCTACGTGCCGAGGTCGAGACCGGGAGGGGGTTGCAGGCAAATTAGAAGGGAGGAACTAGGAGATTGGCGGAGCATTGGCGAATCGCAGAGGCAATCCGCTTTCAGAGGCATTTTATCTCCTGTTTATTCCTTTCGGGGGTTTTTTGAGGAGGGAGTTGGATGTCGGTGGTGCTGGATACTCAAGCCAAGCTTGGGATGAGTCTTGACGACTTAACGTCCCGCTCGTCCTCACGCCGCATTCAAAGCGGCATTGTTGGCAAGAGAGCTTTTCGCCGAAGCATCCCCTACAAAGTGTTCCCTCGTGAGAAGAGTGGGTTTGCTCGTCCCCCAGCCAGGTGATTGTTCCATCCATCGACCTGGACAGCATCAACTGTACTATATGACGGAGGGAGATCTGTTTACTGCAGGGAGGTGTCGAAGAAGGGAGGGAAGGGGAAGCATTTTCTTTTGAAGGGAGGGTGGTTGGAAGTTGTCCACTGGAGTTTTTTTCAGGTTGGAGTCTTTGTGAGATGTTGAGGGAAGGAGGTGGTAGATATGTGTGGAGGATGGAAGTGGTGAAGGGAGCCGGATGTTGTGTATGTATGTGGCAGTTGTGGTGAAGGAAGATATCTGTGAAGATGAAATACTTGACGTTGAAGTAAAAGCTGTCAGTTGTTATGTGGGAAGGGGTTTAGTAGAGGTGATTTGTCGTTGTTGCTCAGTCGGCTGCTGGCTTTACCGGCTTCGGTATATCCGAGGGTTGAAGTGATAGGTTGGGAATTCTTGGGAGATACCGTGGGAGAATGAGATCAGATTGATTGTTTGGATAAGAATTTATGAAGAGGTAAGGATAGTCAAAGTTTGTATATAGTTACCATGAAAGTTTTTGTGCCATTTAGTTTAAAATTGTGCGGTAGTGAAGGCCATCGACCATTTACACAAAGTTCATTCTCTTCGATGAGGAAACAACTTTGAGTTCAATGGGATTTGGAACTATAAAGTCCCTGCCATTATGTTCAAAGTCACTTCGGTTACGTCGAGACCATCAAGTACACGCGGATGAAGTCATCAAGTCTCCATAGGCTGCACACGAACTCCGTCTATTTTACGGCTCATCTTGGCCAAAGTTTTGTCACCACATCAGTTGTCATCCTTGCTGATCGGAAAGTTATGTAGGTTGGTTATATCTTTGTACTACAAGATGTTACTTGTTGCGGGCCGGCACAACTATTTCGGACATTGTAATTACTGGGTGACAGATATTCAAAACATCCTGTCCAATACACAAACAGATGGGTGGGATGATATCTCAGTTCAGGCTACTGAGCAGCCAGCCGTAGAAACAACTACAAACTTCCATGACTTTTTCGGTCGTGGATATCTGACATCGCTGCTGTTTTCTTTTCATGACATGTGCTAAAACTTGTCTGTTTTTCTTCTTTGGTACAGGCCGCTCTTAGAGCTATGTAATAACTGCAGACGCACGGGACATTTTGCAAGGGACTGTCCCAATGCATCGGTCTGCAACAATTGTGGTGTTTCAGGGTATGTTCATTCAAAGTCTCTATTCTTGTGCATTATGTTTTTTACAGGCATGTTAATTAACGTTTCAGCTATTTATCTATCGTGTAACAAACGAAACTGCTCCCGTGTGATTCACGACTTCTTACTTCATTTCTCCATAATAAACTATACAGCTTCTTAGAAAGATGTTTTGAAGAGAAAACATGATGTTTTCATTTTTCGAGATCTCTAACAGATAGATTATAGTTAACTTGTAGTAAGAGATAAAAGTTTTAATTGGAGTGGTCCAGTGTCGAAACAACCTTGGAGTGAGCTCCCAGCGAATCGTGGACCATCTTCATCTTAGTCCAATACCAATGTTATCAATATTGCAATATATCTCTTCGTTCCTGGCCATTTTTGTATAAAACCTACCACATTTTTTGTTACACTCATCACGGACAAGATTTATTGGTGTTTCAATGTATTTGTCTATTACATAGTATATAAATGAGCACCCTTTTTATGGTTTTTTATCTTGATTATCATGTTTTAAAATTGTTTGCATTTTTTCTTCCTATTTTTTGTCGAAGAGACTCAAGTCAACATTCAATCGTTATTGATTTTTTAATGGGTCTGAGTGCTCTGCACTCGTGGTCTATCATGGTAATGGTTAGCTTGTTCTTAATAGTTCCGAGTCAATCATGATGCTGTTGTGCAGGCATATAGCTGCAGCGTGCCCAACTGAACCACTATGCCGTAACTGCAAGAAACCCGGGCACATTGCGAGTGAGTGTCACAATGAGCCAGTGTGCAACATGTGTGGGAAACCTGGCCACATCGCCAAGGGTTGTGCTGCACAGGAGCTGGGTCTTCCGAAGTCTAGGCTATGCAACAATTGCTATCGACCAGGACATGTCTCAGTCGACTGTCCCAACGAGAAGGCGTGTAACAACTGCCGGCAATCTGGCCATTTGGCCCGTGATTGTCTAAATAGCCCAGTTTGCAATGGGTGTAGCCAGCCCGGTCACATCGCTCGGGACTGCCCCAGACTGGCTGTGGGCGGTGGAGGGACTAGACCAAATGAGAACTTTCCGAACGTGGTTTGTCGGAACTGTAAGCAACCTGGACACAAAGGGAAGGATTGTCTCCAGGTCATTATCTGTAATAACTGTGGTGGGCGCGGACACATGGCCGTGGAGTGCCCATCCGATCCTATGTTGGCTCGAGGCGTTCGACGTCGGTGATTGTGGAGCTTCTGGAGGAAGCAGTGGCCAATCAGCCATGAGAGCCCGCCGGATGTTGTCTCGAGGTGTCTGACAATATGGATCTTTTGAAGAAAGAGCAGAGTACCTATCAATCGTGGGTTTAGTTTCTCTGTGGATTCTATAAATTGATCTTGACGTTTAAATGGAAGACTCAAAAAGGCCAAACTGCTTAGAATTAGAGAGCTAGAGAATTTACTAGGTTTGAAATCTCGGCTCTCCATCACAACATGACTTTGTAAAGGTTTTATTTGTTTCCCCCTTTTTCTTTTTCTTTTACCTTAAATCGGCAGATGGAGTAGTTTCCAACCCGAAGCGTGCATTCCAGCTTTTGTGGTTTAGTCAGCCGGGAGTACGCAGCATTTCGAGCTTGTGATTTAGCTGAGACGCCTGGTTATTTAAAGCGGCTCAGACAGTTGTATACTTCTTCATCATATGTCAAGAATGTCTCTCCTCGACAGATTTTTGCTGTAGTAGAGGAAAGTCATTGGACATGTCACGATGACAAATACACGATACTTACGGGATGAAACATTTTGCAATC

mRNA

>Mapoly0069s0082.1
CTTTCTCCTCAGTAAAGTTCAAATTTAAGATCAGTGAAGGGTAAACGAAACTTTTAAGAGTTGCAGAAGGCCTGTGGGGGTATAATTGCGAAGACCAGAGCAAATGCGAATTGTAAGGGAGCCGTAGAACGAGCGGGTGGAGCGTCTAGTCCAAGCCCCGGAGACCATTTTCCTGTTTCGAAGGGAGGGAGCGGAGCAGAGCAAAGCTGCCTACGTGCCGAGGTCGAGACCGGGAGGGGGTTGCAGGCAAATTAGAAGGGAGGAACTAGGAGATTGGCGGAGCATTGGCGAATCGCAGAGGCAATCCGCTTTCAGAGGCATTTTATCTCCTGTTTATTCCTTTCGGGGGTTTTTTGAGGAGGGAGTTGGATGTCGGTGGTGCTGGATACTCAAGCCAAGCTTGGGATGAGTCTTGACGACTTAACGTCCCGCTCGTCCTCACGCCGCATTCAAAGCGGCATTGTTGGCAAGAGAGCTTTTCGCCGAAGCATCCCCTACAAAGTGTTCCCTCGTGAGAAGAGTGGGTTTGCTCGTCCCCCAGCCAGGCCGCTCTTAGAGCTATGTAATAACTGCAGACGCACGGGACATTTTGCAAGGGACTGTCCCAATGCATCGGTCTGCAACAATTGTGGTGTTTCAGGGCATATAGCTGCAGCGTGCCCAACTGAACCACTATGCCGTAACTGCAAGAAACCCGGGCACATTGCGAGTGAGTGTCACAATGAGCCAGTGTGCAACATGTGTGGGAAACCTGGCCACATCGCCAAGGGTTGTGCTGCACAGGAGCTGGGTCTTCCGAAGTCTAGGCTATGCAACAATTGCTATCGACCAGGACATGTCTCAGTCGACTGTCCCAACGAGAAGGCGTGTAACAACTGCCGGCAATCTGGCCATTTGGCCCGTGATTGTCTAAATAGCCCAGTTTGCAATGGGTGTAGCCAGCCCGGTCACATCGCTCGGGACTGCCCCAGACTGGCTGTGGGCGGTGGAGGGACTAGACCAAATGAGAACTTTCCGAACGTGGTTTGTCGGAACTGTAAGCAACCTGGACACAAAGGGAAGGATTGTCTCCAGGTCATTATCTGTAATAACTGTGGTGGGCGCGGACACATGGCCGTGGAGTGCCCATCCGATCCTATGTTGGCTCGAGGCGTTCGACGTCGGTGATTGTGGAGCTTCTGGAGGAAGCAGTGGCCAATCAGCCATGAGAGCCCGCCGGATGTTGTCTCGAGGTGTCTGACAATATGGATCTTTTGAAGAAAGAGCAGAGTACCTATCAATCGTGGGTTTAGTTTCTCTGTGGATTCTATAAATTGATCTTGACGTTTAAATGGAAGACTCAAAAAGGCCAAACTGCTTAGAATTAGAGAGCTAGAGAATTTACTAGGTTTGAAATCTCGGCTCTCCATCACAACATGACTTTGTAAAGGTTTTATTTGTTTCCCCCTTTTTCTTTTTCTTTTACCTTAAATCGGCAGATGGAGTAGTTTCCAACCCGAAGCGTGCATTCCAGCTTTTGTGGTTTAGTCAGCCGGGAGTACGCAGCATTTCGAGCTTGTGATTTAGCTGAGACGCCTGGTTATTTAAAGCGGCTCAGACAGTTGTATACTTCTTCATCATATGTCAAGAATGTCTCTCCTCGACAGATTTTTGCTGTAGTAGAGGAAAGTCATTGGACATGTCACGATGACAAATACACGATACTTACGGGATGAAACATTTTGCAATC

CDS

>Mapoly0069s0082.1
ATGTCGGTGGTGCTGGATACTCAAGCCAAGCTTGGGATGAGTCTTGACGACTTAACGTCCCGCTCGTCCTCACGCCGCATTCAAAGCGGCATTGTTGGCAAGAGAGCTTTTCGCCGAAGCATCCCCTACAAAGTGTTCCCTCGTGAGAAGAGTGGGTTTGCTCGTCCCCCAGCCAGGCCGCTCTTAGAGCTATGTAATAACTGCAGACGCACGGGACATTTTGCAAGGGACTGTCCCAATGCATCGGTCTGCAACAATTGTGGTGTTTCAGGGCATATAGCTGCAGCGTGCCCAACTGAACCACTATGCCGTAACTGCAAGAAACCCGGGCACATTGCGAGTGAGTGTCACAATGAGCCAGTGTGCAACATGTGTGGGAAACCTGGCCACATCGCCAAGGGTTGTGCTGCACAGGAGCTGGGTCTTCCGAAGTCTAGGCTATGCAACAATTGCTATCGACCAGGACATGTCTCAGTCGACTGTCCCAACGAGAAGGCGTGTAACAACTGCCGGCAATCTGGCCATTTGGCCCGTGATTGTCTAAATAGCCCAGTTTGCAATGGGTGTAGCCAGCCCGGTCACATCGCTCGGGACTGCCCCAGACTGGCTGTGGGCGGTGGAGGGACTAGACCAAATGAGAACTTTCCGAACGTGGTTTGTCGGAACTGTAAGCAACCTGGACACAAAGGGAAGGATTGTCTCCAGGTCATTATCTGTAATAACTGTGGTGGGCGCGGACACATGGCCGTGGAGTGCCCATCCGATCCTATGTTGGCTCGAGGCGTTCGACGTCGGTGA

Protein

>Mapoly0069s0082.1
MSVVLDTQAKLGMSLDDLTSRSSSRRIQSGIVGKRAFRRSIPYKVFPREKSGFARPPARPLLELCNNCRRTGHFARDCPNASVCNNCGVSGHIAAACPTEPLCRNCKKPGHIASECHNEPVCNMCGKPGHIAKGCAAQELGLPKSRLCNNCYRPGHVSVDCPNEKACNNCRQSGHLARDCLNSPVCNGCSQPGHIARDCPRLAVGGGGTRPNENFPNVVCRNCKQPGHKGKDCLQVIICNNCGGRGHMAVECPSDPMLARGVRRR

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>