Mapoly0071s0114



Description

ADP RIBOSYLATION FACTOR-RELATED

Reference DB

Database ID Description
GO GO:0005525 GTP binding
KOG KOG0070 GTP-binding ADP-ribosylation factor Arf1
OrthoMCL OG5_126696
PFAM PF00025 ADP-ribosylation factor family
PANTHER PTHR11711 ADP RIBOSYLATION FACTOR-RELATED

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpARFC3 SAR/ARF GTPase Mapoly0071s0114.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0071s0114.1 scaffold_71:1004142..1004717  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0071s0114.1  

Gene structure:

mRNA scaffold_71:1004142..1004717  ( + strand )
CDS scaffold_71:1004142..1004717  ( + strand )

Sequences:

Gene

>Mapoly0071s0114.1
ATGGGGCTGACGATTTCGAGGGTGTTTCGGAGCCTCTTCTTCTTCGCGAGGCTAATTAAGAAGGAGATGCGAATTTTGATTGTGGGGCTGGATGGGGCCGGGAAGACCACAATCCTGTACAGGATGAAGCTATCACAGGTCGTCGACGCGATTCCGACCATCGGATTCAATGTCGAGACCGTCGAGTATAAGAATATCAGTTTCACGGTGTGGGATGTCGGAGGCTCGGCCGGCAGGCGGCAGTTCTGGCGGCACTACTACGCGAACACGCAGGCGGTGATCTACGTCGTGGACAGCGGCGACAGGCTCCGTCAGGCCGAGGCCTGTCACGAGCTGCACAGCATGTTGCAAGAGGAGGAGCTTCGCGGCGCAGCGCTGCTGGTGTTCGCCAACAAGCAGGATCTGCCCGGGTCCATGAAAGAACCCGAGGAGTTCGAGGAGGCGCTTGATCTCGCGGCCTTGCGCGAGAAGAGGCCCCTGCATCTCCAGAGGGCGTCCGCTGTGACCGGCGAGGGCCTTCTCGAGGGTCTGGAATGGTTGTTCATCACTCTCACGAACAAATCCATCAAGTCCTGA

mRNA

>Mapoly0071s0114.1
ATGGGGCTGACGATTTCGAGGGTGTTTCGGAGCCTCTTCTTCTTCGCGAGGCTAATTAAGAAGGAGATGCGAATTTTGATTGTGGGGCTGGATGGGGCCGGGAAGACCACAATCCTGTACAGGATGAAGCTATCACAGGTCGTCGACGCGATTCCGACCATCGGATTCAATGTCGAGACCGTCGAGTATAAGAATATCAGTTTCACGGTGTGGGATGTCGGAGGCTCGGCCGGCAGGCGGCAGTTCTGGCGGCACTACTACGCGAACACGCAGGCGGTGATCTACGTCGTGGACAGCGGCGACAGGCTCCGTCAGGCCGAGGCCTGTCACGAGCTGCACAGCATGTTGCAAGAGGAGGAGCTTCGCGGCGCAGCGCTGCTGGTGTTCGCCAACAAGCAGGATCTGCCCGGGTCCATGAAAGAACCCGAGGAGTTCGAGGAGGCGCTTGATCTCGCGGCCTTGCGCGAGAAGAGGCCCCTGCATCTCCAGAGGGCGTCCGCTGTGACCGGCGAGGGCCTTCTCGAGGGTCTGGAATGGTTGTTCATCACTCTCACGAACAAATCCATCAAGTCCTGA

CDS

>Mapoly0071s0114.1
ATGGGGCTGACGATTTCGAGGGTGTTTCGGAGCCTCTTCTTCTTCGCGAGGCTAATTAAGAAGGAGATGCGAATTTTGATTGTGGGGCTGGATGGGGCCGGGAAGACCACAATCCTGTACAGGATGAAGCTATCACAGGTCGTCGACGCGATTCCGACCATCGGATTCAATGTCGAGACCGTCGAGTATAAGAATATCAGTTTCACGGTGTGGGATGTCGGAGGCTCGGCCGGCAGGCGGCAGTTCTGGCGGCACTACTACGCGAACACGCAGGCGGTGATCTACGTCGTGGACAGCGGCGACAGGCTCCGTCAGGCCGAGGCCTGTCACGAGCTGCACAGCATGTTGCAAGAGGAGGAGCTTCGCGGCGCAGCGCTGCTGGTGTTCGCCAACAAGCAGGATCTGCCCGGGTCCATGAAAGAACCCGAGGAGTTCGAGGAGGCGCTTGATCTCGCGGCCTTGCGCGAGAAGAGGCCCCTGCATCTCCAGAGGGCGTCCGCTGTGACCGGCGAGGGCCTTCTCGAGGGTCTGGAATGGTTGTTCATCACTCTCACGAACAAATCCATCAAGTCCTGA

Protein

>Mapoly0071s0114.1
MGLTISRVFRSLFFFARLIKKEMRILIVGLDGAGKTTILYRMKLSQVVDAIPTIGFNVETVEYKNISFTVWDVGGSAGRRQFWRHYYANTQAVIYVVDSGDRLRQAEACHELHSMLQEEELRGAALLVFANKQDLPGSMKEPEEFEEALDLAALREKRPLHLQRASAVTGEGLLEGLEWLFITLTNKSIKS

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>