Mapoly0073s0059



Description

(UnKnown)

Reference DB

Database ID Description
OrthoMCL OG5_166963

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpBHLH39 transcription factor, bHLH Mapoly0073s0059.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0073s0059.1 scaffold_73:687102..688982  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0073s0059.1  

Gene structure:

mRNA scaffold_73:687102..688982  ( + strand )
five_prime_UTR scaffold_73:687102..687445  ( + strand )
CDS scaffold_73:687446..688339  ( + strand )
three_prime_UTR scaffold_73:688340..688982  ( + strand )

Sequences:

Gene

>Mapoly0073s0059.1
CTCTCGCCTCACGCATAGACCACTGACAGGATTGGGCGTCTGCTACCCCCTTGTGCAATTTATCCGATCCGTCTCCCTCGAGGGAGAAGCCGATTCGGTGCTGCCGTGGAAGCGCTGCCTGAGAGGAGCGCGACGACGAAATTGACGCGGGGGCTTATCGTGCGATAGTCTTAATTCGAGAGTGATCGGAAGGAAACGAGGCCAAGGCAACGAGAGCTTGTAGAGTTTTGGTTGCGAGAGTTTCTCGAGAGCCGAGTAGGTCGGTTGAGAAGAGCTCGGTCGTAGCAGGCAGGCGTAAGGCTTGGAGAGATTTTTGAGCGCCGAATTGCGCGGACTTTGCCACAATGGATCACGTTCTTTGTGACAGTAGTGGAATTACGCTGCAAACGTCCATCCACGACGGCTCGGATTACTCTGCGTCATTTCTGAAGTCGTTCCTCCCTGCCTACAACATCGTCAACCTGTCGGCCGATCTGTCCACGGTCTCGGATCGTTTCAAAGCAATTCAATTCGCGGCCGATGCGTCGCTGGCCATCAGCGGCAGCGGAGCCTCGTGGAGCGACGCCCTGAGCCAGAAGCTGGCCGCCACCTCCTCCTCGTCCATCCAGGCCGTGCAACCCGCCTGCGAGGAGAGGCAATCGCGAGGCTCCGAGCCCTGCGCGAGCCCGGCCGAATCGACCTCGTCCAATCACCACACTGGCGAGTGCGGCTGCCCGCCCGAGAGGACGGAGAGCGCCAGCAGCAGGTTGATGCGCAGTTACGGGAACTTATTCGTGCAGAGGAAAAGATTAGCGGGTAGAAGGAACTTGGCCGGGCGCACGCTGCGCAAGGGAGACAGGGAAAATTGCTTCAGAAATCACGAATGCTATCTGGAAGCGAGCAGGCAGGCGATTCTCAAGAAGCTGGCGCTGAGGAACAAGAGCAAGAGGCGCCTGCTGAGATGCGCCTGGAAGCCCAAGCCCGTGCTGCGCAAGGTGAAATCGCTGGCGCGGCCCCGCAGCAGGCCCTCGCGATCGCTCAAGGTCGCCGAGAGCGTCGAACAGGATCAGGACCTCGAGAGCCGATTCGTGGCCTTGCAAAGACTCGTGCCCGGCGGCTCCAACATGGACACCTCGTCGCTGCTGGATGAGACGGCCGATTTCGTCATGTTCCTGCAGATGCAGGTGCAATCCATGCAGGCGCTCGCCAGCGCCCTCGACGCGCAGCAAGCCCGCATGCCCGAGTTCTCGGCCTCGTAAGCGTGTACATCCCCTTCCATTCGCGACTCCTTCTCCACATTCTGACGCCACGCTCGCGAGCGCGAGAGCTGAACGTGGAATTCGCCGGTCCGCCATGGTGCACCTCTGCTGCCGTCCCGCATGCAACACACCTGCGGCTCTCGGCGCCGTCCACTCGCGGGGGAGATCATCTCACTCTTATTCTTTTCGCCCCGGCTCTCGGCTTACGGCTGCTCCTGCGCCGGCCGCCCTCTGTTCCTGGTCGCTGCGCCAACGATACGTCACGGTTTTGAATACCATGGAGCCAATTCTGGGAGCTCCTCTCCCAGCGCGAGTTCGGCTCCAATAATTCCTAGCCGAAAGCAAATCTTCATCACACAAGTTTTTGTAGGTCGAGGAGAATGAATCTCCTTCAAAGTCTAGCTAGGCTCTTGCGAGTATATGATGACCTTGATTCAGTAATGTACCACTCTGTATTATAACACACCTTGTGAAAATTCACCTCTTTCTTACCCACCTGCACAGCCTTCGCCCTTCTCGATGAATTGTGTTGTGCATGAATGGATCTTCTTCAATGAGGGAGACTGTCAGTCGAATGTTTTTAATTGGACCCATTTTCGTTTGAGGTGTTCACTGGAACGGATGCCCTTGCTCTCGAGTCGCT

mRNA

>Mapoly0073s0059.1
CTCTCGCCTCACGCATAGACCACTGACAGGATTGGGCGTCTGCTACCCCCTTGTGCAATTTATCCGATCCGTCTCCCTCGAGGGAGAAGCCGATTCGGTGCTGCCGTGGAAGCGCTGCCTGAGAGGAGCGCGACGACGAAATTGACGCGGGGGCTTATCGTGCGATAGTCTTAATTCGAGAGTGATCGGAAGGAAACGAGGCCAAGGCAACGAGAGCTTGTAGAGTTTTGGTTGCGAGAGTTTCTCGAGAGCCGAGTAGGTCGGTTGAGAAGAGCTCGGTCGTAGCAGGCAGGCGTAAGGCTTGGAGAGATTTTTGAGCGCCGAATTGCGCGGACTTTGCCACAATGGATCACGTTCTTTGTGACAGTAGTGGAATTACGCTGCAAACGTCCATCCACGACGGCTCGGATTACTCTGCGTCATTTCTGAAGTCGTTCCTCCCTGCCTACAACATCGTCAACCTGTCGGCCGATCTGTCCACGGTCTCGGATCGTTTCAAAGCAATTCAATTCGCGGCCGATGCGTCGCTGGCCATCAGCGGCAGCGGAGCCTCGTGGAGCGACGCCCTGAGCCAGAAGCTGGCCGCCACCTCCTCCTCGTCCATCCAGGCCGTGCAACCCGCCTGCGAGGAGAGGCAATCGCGAGGCTCCGAGCCCTGCGCGAGCCCGGCCGAATCGACCTCGTCCAATCACCACACTGGCGAGTGCGGCTGCCCGCCCGAGAGGACGGAGAGCGCCAGCAGCAGGTTGATGCGCAGTTACGGGAACTTATTCGTGCAGAGGAAAAGATTAGCGGGTAGAAGGAACTTGGCCGGGCGCACGCTGCGCAAGGGAGACAGGGAAAATTGCTTCAGAAATCACGAATGCTATCTGGAAGCGAGCAGGCAGGCGATTCTCAAGAAGCTGGCGCTGAGGAACAAGAGCAAGAGGCGCCTGCTGAGATGCGCCTGGAAGCCCAAGCCCGTGCTGCGCAAGGTGAAATCGCTGGCGCGGCCCCGCAGCAGGCCCTCGCGATCGCTCAAGGTCGCCGAGAGCGTCGAACAGGATCAGGACCTCGAGAGCCGATTCGTGGCCTTGCAAAGACTCGTGCCCGGCGGCTCCAACATGGACACCTCGTCGCTGCTGGATGAGACGGCCGATTTCGTCATGTTCCTGCAGATGCAGGTGCAATCCATGCAGGCGCTCGCCAGCGCCCTCGACGCGCAGCAAGCCCGCATGCCCGAGTTCTCGGCCTCGTAAGCGTGTACATCCCCTTCCATTCGCGACTCCTTCTCCACATTCTGACGCCACGCTCGCGAGCGCGAGAGCTGAACGTGGAATTCGCCGGTCCGCCATGGTGCACCTCTGCTGCCGTCCCGCATGCAACACACCTGCGGCTCTCGGCGCCGTCCACTCGCGGGGGAGATCATCTCACTCTTATTCTTTTCGCCCCGGCTCTCGGCTTACGGCTGCTCCTGCGCCGGCCGCCCTCTGTTCCTGGTCGCTGCGCCAACGATACGTCACGGTTTTGAATACCATGGAGCCAATTCTGGGAGCTCCTCTCCCAGCGCGAGTTCGGCTCCAATAATTCCTAGCCGAAAGCAAATCTTCATCACACAAGTTTTTGTAGGTCGAGGAGAATGAATCTCCTTCAAAGTCTAGCTAGGCTCTTGCGAGTATATGATGACCTTGATTCAGTAATGTACCACTCTGTATTATAACACACCTTGTGAAAATTCACCTCTTTCTTACCCACCTGCACAGCCTTCGCCCTTCTCGATGAATTGTGTTGTGCATGAATGGATCTTCTTCAATGAGGGAGACTGTCAGTCGAATGTTTTTAATTGGACCCATTTTCGTTTGAGGTGTTCACTGGAACGGATGCCCTTGCTCTCGAGTCGCT

CDS

>Mapoly0073s0059.1
ATGGATCACGTTCTTTGTGACAGTAGTGGAATTACGCTGCAAACGTCCATCCACGACGGCTCGGATTACTCTGCGTCATTTCTGAAGTCGTTCCTCCCTGCCTACAACATCGTCAACCTGTCGGCCGATCTGTCCACGGTCTCGGATCGTTTCAAAGCAATTCAATTCGCGGCCGATGCGTCGCTGGCCATCAGCGGCAGCGGAGCCTCGTGGAGCGACGCCCTGAGCCAGAAGCTGGCCGCCACCTCCTCCTCGTCCATCCAGGCCGTGCAACCCGCCTGCGAGGAGAGGCAATCGCGAGGCTCCGAGCCCTGCGCGAGCCCGGCCGAATCGACCTCGTCCAATCACCACACTGGCGAGTGCGGCTGCCCGCCCGAGAGGACGGAGAGCGCCAGCAGCAGGTTGATGCGCAGTTACGGGAACTTATTCGTGCAGAGGAAAAGATTAGCGGGTAGAAGGAACTTGGCCGGGCGCACGCTGCGCAAGGGAGACAGGGAAAATTGCTTCAGAAATCACGAATGCTATCTGGAAGCGAGCAGGCAGGCGATTCTCAAGAAGCTGGCGCTGAGGAACAAGAGCAAGAGGCGCCTGCTGAGATGCGCCTGGAAGCCCAAGCCCGTGCTGCGCAAGGTGAAATCGCTGGCGCGGCCCCGCAGCAGGCCCTCGCGATCGCTCAAGGTCGCCGAGAGCGTCGAACAGGATCAGGACCTCGAGAGCCGATTCGTGGCCTTGCAAAGACTCGTGCCCGGCGGCTCCAACATGGACACCTCGTCGCTGCTGGATGAGACGGCCGATTTCGTCATGTTCCTGCAGATGCAGGTGCAATCCATGCAGGCGCTCGCCAGCGCCCTCGACGCGCAGCAAGCCCGCATGCCCGAGTTCTCGGCCTCGTAA

Protein

>Mapoly0073s0059.1
MDHVLCDSSGITLQTSIHDGSDYSASFLKSFLPAYNIVNLSADLSTVSDRFKAIQFAADASLAISGSGASWSDALSQKLAATSSSSIQAVQPACEERQSRGSEPCASPAESTSSNHHTGECGCPPERTESASSRLMRSYGNLFVQRKRLAGRRNLAGRTLRKGDRENCFRNHECYLEASRQAILKKLALRNKSKRRLLRCAWKPKPVLRKVKSLARPRSRPSRSLKVAESVEQDQDLESRFVALQRLVPGGSNMDTSSLLDETADFVMFLQMQVQSMQALASALDAQQARMPEFSAS

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>