Mapoly0077s0027



Description

GTPase Rab5/YPT51 and related small G protein superfamily GTPases

Reference DB

Database ID Description
GO GO:0005525 GTP binding
GO GO:0007264 Small GTPase mediated signal transduction
KEGGORTH K07976 Rab family, other
KOG KOG0092 GTPase Rab5/YPT51 and related small G protein superfamily GTPases
OrthoMCL OG5_126724
PFAM PF00071 Ras family
PANTHER PTHR24073 FAMILY NOT NAMED
PANTHER PTHR24073:SF423

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpARA6 RAB GTPase Mapoly0077s0027.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0077s0027.1 scaffold_77:378533..383268  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0077s0027.1  

Gene structure:

mRNA scaffold_77:378533..383268  ( + strand )
five_prime_UTR scaffold_77:378533..378948  ( + strand )
CDS scaffold_77:378949..378973  ( + strand )
CDS scaffold_77:379495..379568  ( + strand )
CDS scaffold_77:379948..380031  ( + strand )
CDS scaffold_77:380188..380282  ( + strand )
CDS scaffold_77:381011..381116  ( + strand )
CDS scaffold_77:381326..381415  ( + strand )
CDS scaffold_77:381651..381737  ( + strand )
CDS scaffold_77:382673..382720  ( + strand )
three_prime_UTR scaffold_77:382721..383268  ( + strand )

Sequences:

Gene

>Mapoly0077s0027.1
GGCCGACGGCCCAGGTGGAAGATGCAAAGCAGAAGCAGAGCAGTGGATTTGAGCAAGTGCTGGACGAGAGCATTTGGGTCATCGATTGAGGAGAGAGAAGGATCTGTAGCCCAGGCCCCGGGAAGGAGGGATCAATTCTCGAGTTCAAATCATATCTTACCTTCTCCCCCGAGTTTGCTTTCATGTGCTCACGTCAAGCGACATTATCTGAGTGATCCGCATTTCGAGTATTTTTAAAGGCTGGAGAGACGGGGAGAGAGAGAAATTGAGTTCAGAGAGGCAGATAGAGACGCTTTCGATCGCTCGCTCGCTCGCTTGGCGGTTCTAACTAAATTTCTTCTGCTTTTGGACAACTCGTGAGGGGAAGTTTCATACGATTCAAATTTTTTGTGCAAGAGCGTCCGCGGGTTGCAGCGATGGGTTGTGCTGCCTCAGCTCCAGGTAGAAGTCGTTTCTCGATTGAAGATTGTTGTTGTAGTGGTCGGGGAATTCGAGGAGTTGATCAATTCTCGATTCGAGGTCGTGTAGCTCAATGGAAAGGGGTTTGATCGTACTTTTGGGTTTGAATGCTGTTGACGTCGTGAATCGTAATAAAAGACGGAATCCTTTTGTCAGTTCATGTGGTTGGCCAGCCTCAAACGCCCACAGAACTCTTGCGCTGGTTTTAACTTCGAAGCGGGTTGGATTTGATTGCTTCTAGACTGATGTTAGCAGAGATCATGGATTCCTGTGTGGTGGAGTTCCAGTTGAACATTGATGATGATGTCCTCAGTCAACTACAGATGATGTGACCTAATTGCACCCTTAGAAATCGCCAGGTTCCATGCGCTAAATGCTTGGGATGCCCGTATATAGGTCTACTGGAGTACGTTTTGTTGAGGATGGACTCGTAATTCAAGTATCGTATGTTGAGCTTGAATTAACAAAAAATTGTTGAATTGTGGAATGTTTGTATTCTACAGCTAGACAGGGACGTCTAGCCGGCATGAATCAAGATGCCGTAGAAACCTTCGACTCAAAAAACTTGCGAATCAAGGTAAGTTCTGCATTATGCTCATGTGAAATCGTCCGAAGCCATTTGATCAGTCCTGCCGTGACTTGTTTAATGACATATTTTAGAGGGCAAAGCGTCCTGTAATCACTACCAAGAAAGTCTACCTACGGTCGGCACAGGAGTGATGAGTAGGAACCATGACTTTTTACGCTGTGAACCTCCAGTGTTTTCCCCATCCTTGTCGAGGACTATTCGAAATTCCTTGGCTAAATATAAGGAGGGTGGTGTACATAGAGCGGATTAAGGTTTCGAACTATATATAACCTATGACGTAAATGCATCGCATCATGTTCTGGAACCTGCTTGTCATAATTGTAAGGTGGGTCTACGTTGCTGAAGCACGTTTAGTTTGTGCTTGCAGTTAGTGTTGTTGGGTGATTCCGGTGTAGGAAAGAGCTGCATTGTGCTGCAATTTGTACGTGGTCAGTTCGACCCTTCTTCTAAGGTACGTGCCACAAGCTTCCTTCATTTCTAATAGGACTAGATGTTTCTTCAATACTTTCATGCAGCTTTGGATCGAAGTGTTTAGGCATAGCGGAGTTTCGTTTGTTGTCTGGGCTTCATGCTTCTCTTGGTGAGCCTAATCTCGATCATATCTCAGGTGACAGTCGGTGCATCCTTTTTGTCGCAAACAGTAGCTTTGAAAGATTCCACAACGGTGAAGTTTGAGATATGGGACACAGCTGGTCAGGAGAGGTACGTACATTTTATCAAAGTTTTGATCCATGGCACGATTGTATTTAAGTTTCGTTCATATACAGTCTCTACCAGCTGCGATAACAGGTTCATTATTTACCTTAGAATATTCGGTAGATAGTTTAGTCGGATACAATGTAAAGCCTTTTATAAGTGTGGTAAAATATGTCCATATTTCCGAGGAAGGTGAACGGGTGTCCAAGGGGCAAAATGAAATGTGTAGTCGATTGTATTGGAAGGGCCGCTCGATAGAGAAAAGAAAGTGAATACTCATCTTACTGAAGCCTGCAAGATGGACCTTAGGGCCTTAAATGGATGAAGAGATTCCTATCTGAGAGTTGCAAGTCCTATGGTTCTATATAAGATAAATTTTCGCCGTCTAGGCTACGAGTGTTTTCATCCAGTTCACTTTGGCCAACCTGCACCTGAGGAGTAGAGCACTGCATGTTTTAGCTAAGTCATTAGTATGGACGTTTTAATGTCATTCATAATTTTCATTCATTCTAGAGAAGTTGGTTATTCATCAGCATGCCCGAACGGCTATGGTTGTTGTCTTCTAAGATAAAGTGCCACACGGAGTCTGGTTGTCCAAGTTGAGTTACCTCTTTAGTAGTATTGTGCTGCAATATCTATATTCCTCTCCGTCGTTAGTGAATACCAGCATGGTCTGCTTGGGACATGCACTATGTTTGCTCTTACGAAATTTGTGTCATGTGAGCAATTTACAGATATGCCTCGCTGGCGCCTTTATACTATCGGGGGGCCTCAGCAGCTGTCGTAGTTTACGACATCACCAGCCCTGATTCGTTCCAAAAAGCTCAGTTTTGGGTGAAGGTGAGTTGCTTACGTTGTGGTTAAAGATTCACTGTACGATCATCACTCTTCATGTTTCGATGCAAAGAATCAAAGCTCGTCTCCACTATAGCCTAGGTTTGAGAAGCAGTTACCTTAGGCACTTTCCTGTCATCCACGTGCAAACTCATTTCGAAAACATTTTCTACACCGTCAATACTAACCATGGAGTATGCCTATTCGTTCGACAGGAGCTGCAGAAGCATGGGAGTCCTGGTATAGTGATGGCCCTGGTTGGCAACAAGGCAGATCTAGAGGAGTCACGAGAGGTTGCTTCTGAGGTAATTGTCTTTCTTCCTAGAGATATGCCAAGAGCCGAATCTGTGTTATGATACATTCCGTCCACACATTTTTATTTGCAGCGTTTACTGAAGAAAAGGGTTGTAGATTGGAAGTAGATATGGCTCACTATGTGAAATATTCATATGTTCATGTATAGCTTTTAGAATCAAATGGCCCTTAGAATGCAGCCCCCGTCACCAGGCTAATGTTTGTTCTGGATCTTGCACATTCCAGGATTCTCAAGCTTACGCTGAAAGTAACGGCATGTTCTTTATTGAGACTTCAGCAAAGCTAGCAACTAACGTCAACCTCCTTTTTGAAGTGAGTATGAAGCTGGGTTATTTATATGAAAGTAACGCATTTTCTTCGTTAATGACATTCAGTCGTCGTCTCAAGTCAAAGGCAGCTCATTGTCCGTTTTCTTATGTATCGATCAAATAGAAACAAGTTGGCGGATCAGGAACGTGTAGGCAAAGCCTGCGCATATTGTCCAACTGGAATTAATACATCCCCTTGTAGAATGCCACGGGAGGAGAAATCCTTACGATTGACTACCTTATGAGATCGCTGGCCTCTGCAAGGCAGTGTACAGATACATTCATGTGTCGGGCCTGACTTCTGCCTTACGCGAGTCTGAGCAGAAATCCCTGCAGCTCGATTAAACTGATGATACTCCTTAGCTGCTTGATGGCAAAGCAATGCTTGTCGTTGAGACGCTGGGAAAGGTCACTGGTCACTGGACCCTGTTGCAACCACGGTGTTGGTCTACATTGCACTTCACGTTATTTTCCGTTTTCTATCCTTGTTTCCTTCGTTATCGTTTGCACCTGTGTCCTTTGACTGGTCACCTCTCGCTGTTCATCTATGTTTATTTTCTTTTGCTTCGGGCTCCGCGACACCAATCAGGTGACTAAACGTATACGTTTTATTTTCTGCCGTCTTAAAACTAGTCCCTTTGTAGGTTACTCTTTTGATAGCATAAACAATCAGTGTAAATTCTGTCTCAGCCAAATGTCTGTTCCTTTTTTCACGTTACCTTTGTTTATCATCATTTCCAAGTCGATCGGGATTGGTAATCTGAAGTCTTCTGGCTCAATAGCACGGCTTGACTTATCAAATTTATCACGTTTTTGCGTATCTCAGGTTTTCTAAATGGTTTTTACTACACTGGAAATCCTTGTCTTTCACGTTGAGCTCACAAAGGCAGTTCTTTTGCACCAAGCATAGAAACTAATTGTGGCACTTGGGCTGCTCAGGAAATTGGACAGAGGTTACCTCGAGGACAGCCAACCCAGAAGCCTTGAAAGGTACAGGCATGCCTTGAACTGAATTGAAGTACTGTTTCTTGTAAGGTGTGGATGTATCCTCTCAAGCGACAAAATGGGGTCTGTGAATATTACTCAAAAGTTAGTTAGCGCAGTATAAAGAGTACGAAATATCTCGGAGTACCGGCATAGGGACGTAGAAGATGATAGTGACATATGGGCTGCAGCCCTGCATCTCTTCAAGTGTAAATACTACCATATAATAAGTAGGCGAACTGGAGTGCATGTCAGCTCTTCCCTTGTATTTGAAATTCCTGAAATATAGACTTCATCAAAATGTCCATTCACCTCCGATTCAATAGTTCCTACTCGGAGTAGATTTCTTGTCTGAACGTGCCACCTTTTCTAAGCTGACCTTTCGGTTCACTTTCCTTCTGGCAAATCCTTTCAACCCATGATCTGTCGTCTGGGAAGGCTTCCTCCGAAATGTCTCTCCACATTGATGGTTATGCACGCATGAACACATGGTGAAAATATATATTTTGGCATCAATAAACTGGCCCTCGTGGTCTGTAAGCCGGACAATG

mRNA

>Mapoly0077s0027.1
GGCCGACGGCCCAGGTGGAAGATGCAAAGCAGAAGCAGAGCAGTGGATTTGAGCAAGTGCTGGACGAGAGCATTTGGGTCATCGATTGAGGAGAGAGAAGGATCTGTAGCCCAGGCCCCGGGAAGGAGGGATCAATTCTCGAGTTCAAATCATATCTTACCTTCTCCCCCGAGTTTGCTTTCATGTGCTCACGTCAAGCGACATTATCTGAGTGATCCGCATTTCGAGTATTTTTAAAGGCTGGAGAGACGGGGAGAGAGAGAAATTGAGTTCAGAGAGGCAGATAGAGACGCTTTCGATCGCTCGCTCGCTCGCTTGGCGGTTCTAACTAAATTTCTTCTGCTTTTGGACAACTCGTGAGGGGAAGTTTCATACGATTCAAATTTTTTGTGCAAGAGCGTCCGCGGGTTGCAGCGATGGGTTGTGCTGCCTCAGCTCCAGCTAGACAGGGACGTCTAGCCGGCATGAATCAAGATGCCGTAGAAACCTTCGACTCAAAAAACTTGCGAATCAAGTTAGTGTTGTTGGGTGATTCCGGTGTAGGAAAGAGCTGCATTGTGCTGCAATTTGTACGTGGTCAGTTCGACCCTTCTTCTAAGGTGACAGTCGGTGCATCCTTTTTGTCGCAAACAGTAGCTTTGAAAGATTCCACAACGGTGAAGTTTGAGATATGGGACACAGCTGGTCAGGAGAGATATGCCTCGCTGGCGCCTTTATACTATCGGGGGGCCTCAGCAGCTGTCGTAGTTTACGACATCACCAGCCCTGATTCGTTCCAAAAAGCTCAGTTTTGGGTGAAGGAGCTGCAGAAGCATGGGAGTCCTGGTATAGTGATGGCCCTGGTTGGCAACAAGGCAGATCTAGAGGAGTCACGAGAGGTTGCTTCTGAGGATTCTCAAGCTTACGCTGAAAGTAACGGCATGTTCTTTATTGAGACTTCAGCAAAGCTAGCAACTAACGTCAACCTCCTTTTTGAAGAAATTGGACAGAGGTTACCTCGAGGACAGCCAACCCAGAAGCCTTGAAAGGTACAGGCATGCCTTGAACTGAATTGAAGTACTGTTTCTTGTAAGGTGTGGATGTATCCTCTCAAGCGACAAAATGGGGTCTGTGAATATTACTCAAAAGTTAGTTAGCGCAGTATAAAGAGTACGAAATATCTCGGAGTACCGGCATAGGGACGTAGAAGATGATAGTGACATATGGGCTGCAGCCCTGCATCTCTTCAAGTGTAAATACTACCATATAATAAGTAGGCGAACTGGAGTGCATGTCAGCTCTTCCCTTGTATTTGAAATTCCTGAAATATAGACTTCATCAAAATGTCCATTCACCTCCGATTCAATAGTTCCTACTCGGAGTAGATTTCTTGTCTGAACGTGCCACCTTTTCTAAGCTGACCTTTCGGTTCACTTTCCTTCTGGCAAATCCTTTCAACCCATGATCTGTCGTCTGGGAAGGCTTCCTCCGAAATGTCTCTCCACATTGATGGTTATGCACGCATGAACACATGGTGAAAATATATATTTTGGCATCAATAAACTGGCCCTCGTGGTCTGTAAGCCGGACAATG

CDS

>Mapoly0077s0027.1
ATGGGTTGTGCTGCCTCAGCTCCAGCTAGACAGGGACGTCTAGCCGGCATGAATCAAGATGCCGTAGAAACCTTCGACTCAAAAAACTTGCGAATCAAGTTAGTGTTGTTGGGTGATTCCGGTGTAGGAAAGAGCTGCATTGTGCTGCAATTTGTACGTGGTCAGTTCGACCCTTCTTCTAAGGTGACAGTCGGTGCATCCTTTTTGTCGCAAACAGTAGCTTTGAAAGATTCCACAACGGTGAAGTTTGAGATATGGGACACAGCTGGTCAGGAGAGATATGCCTCGCTGGCGCCTTTATACTATCGGGGGGCCTCAGCAGCTGTCGTAGTTTACGACATCACCAGCCCTGATTCGTTCCAAAAAGCTCAGTTTTGGGTGAAGGAGCTGCAGAAGCATGGGAGTCCTGGTATAGTGATGGCCCTGGTTGGCAACAAGGCAGATCTAGAGGAGTCACGAGAGGTTGCTTCTGAGGATTCTCAAGCTTACGCTGAAAGTAACGGCATGTTCTTTATTGAGACTTCAGCAAAGCTAGCAACTAACGTCAACCTCCTTTTTGAAGAAATTGGACAGAGGTTACCTCGAGGACAGCCAACCCAGAAGCCTTGA

Protein

>Mapoly0077s0027.1
MGCAASAPARQGRLAGMNQDAVETFDSKNLRIKLVLLGDSGVGKSCIVLQFVRGQFDPSSKVTVGASFLSQTVALKDSTTVKFEIWDTAGQERYASLAPLYYRGASAAVVVYDITSPDSFQKAQFWVKELQKHGSPGIVMALVGNKADLEESREVASEDSQAYAESNGMFFIETSAKLATNVNLLFEEIGQRLPRGQPTQKP

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>