Mapoly0080s0037



Description

Protein of unknown function DUF260

Reference DB

Database ID Description
OrthoMCL OG5_156414
PFAM PF03195 Protein of unknown function DUF260
PANTHER PTHR31301 FAMILY NOT NAMED
PANTHER PTHR31301:SF1

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpASLBD9 transcription factor, ASL/LBD Mapoly0080s0037.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0080s0037.1 scaffold_80:399957..401716  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0080s0037.1  

Gene structure:

mRNA scaffold_80:399957..401716  ( + strand )
five_prime_UTR scaffold_80:399957..399999  ( + strand )
CDS scaffold_80:400000..400422  ( + strand )
three_prime_UTR scaffold_80:400423..400632  ( + strand )
three_prime_UTR scaffold_80:401187..401716  ( + strand )

Sequences:

Gene

>Mapoly0080s0037.1
AATTATCACACTATTCCACAGACTGTGGACTCGCAGGCGAGTTATGGTTTATAACACGATGCGGCACAGTAGCGGAGCGAGCTCGCGTTGCGCATCATGCAAATATCTACGAAAGAGGTGCACGGACGAGTGCGTACTCGCACCTTACTTTCCTGCAGATCAGCCTTTGAAGTTCGCTATTGTTCATGCACATTTCGATATAGTCAATGTCATTGAGTTACTGCACGGGATTCCAGAATCGTTCCGATTGTCTGTGGTGAAAGATTTGGTTCTCCAGGCCATCATCAAGGTCGCGAATTCCCGGACGAGGATGATGTTACGTCAGGTTGAAGGAAGGCCCCCCTATGCTTCGAGGTCGGATATAAGATATGTCGAACAGGTTTCGGAAATACTCCGAGGACAAGAAGCGTATGAGACTGACTTATGGTTCATGCCACTAAGATATCGCAGGGCTCGCCAGAATTGAGCTTAGCGGATCTGGTGATCTGGTGATCTGGTTGGCCTTCGAGGTCGAGATGGCTTTCGAGGCCAAGGCGAGGATGAAGTGTCCGGCTGACGGATGCTCCGGCGATGTTTCGTCGACGAATAGAAGATTTATGAAGTTTCAGGAAAAGGTTTCGGATTAACTACTTCGAGTATAAGAAGAAGCGCATGAGACTGACACAGGGGCCAAGTGGTACCCCCACTCCCTCATCAATCGTTACTAATCTTCGTTACTAATCTAGTTGCCAGTTGATGGTTATAGCATGCCAAGGGTTTCGTTTACTCGCATTTTTTTGTCGAATTAGTCAAACCGTAATAGCACGTCACAGACTACAGTGGATCTCACGAGTATAGTAGCCCTGTTATGAAAGTCATCTTTGCATCGCAGTCAACGGTATGGCCTCCCGCTGCCTTCCTGGCAAGCGCAACCCTGAGTTCACTCATGAGCAGGCCTTTGCTATTTTGGCAATTGCCAAATTTGATAAATCTGGACGTGCAAAATTTGTCATAAAAGTTTGTACTAACTAACGGCACATGTACAGTTGATTCGTCACATCTTCCCAAATAGTAATATTTATTTATTTATATTTATTTATTTATTTATTGTAACTCATAAGTAACTATTGTACATGGATGAATGAGGCACCGACGAAGATTCATCGGTGCCAAATTCGCAATTAATTTCCTTGTCTGTGAGCAAAGTTTACTGCCATTGCCGACGCGCCCTGAAAAGCATTGCTAATTCAGCGCAGGTCATCATTGGGACGCTATGAGATTGAACAGAGCAGGCCGATCGACGCTCATCATTGGGACGAACGCGTGATGCCGCACTTCCAGCGAATAGCTGTAGAATAGGCCGTAGTCATCAAGATCTTGATGTATGTGATCGCCGTAGCTTCGTGCTCAGCTGATGATATTGATCGCTGCTTCGTGCTCAGTTGATGATATTGATAGGCAAGTTCAAAAACTGTGCAATATGAGCAGATCGCTTGTTGAAGTGCTGTTGATATGGCATCATTGTCGCAAGAGAAAGAAACCTCGCTGCATTACTGATCACTAGATCATCACTTGATATAAATTTGTTGCAATGATAGACAGCTTCGTCGATAGCAATTTGTGCTATACTTATCGTGCAGTATTTCGAGCCGCTCTTGACAATACTTATTTTGGATGGAACTTTTAGCCATTAGAGTAACGACGCCGCTTGCAGCCAGGGCAGATCAGACATCTGTCATTAGACAAATCGATAACGTCAACAAAATCCTTAGCAATATCCT

mRNA

>Mapoly0080s0037.1
AATTATCACACTATTCCACAGACTGTGGACTCGCAGGCGAGTTATGGTTTATAACACGATGCGGCACAGTAGCGGAGCGAGCTCGCGTTGCGCATCATGCAAATATCTACGAAAGAGGTGCACGGACGAGTGCGTACTCGCACCTTACTTTCCTGCAGATCAGCCTTTGAAGTTCGCTATTGTTCATGCACATTTCGATATAGTCAATGTCATTGAGTTACTGCACGGGATTCCAGAATCGTTCCGATTGTCTGTGGTGAAAGATTTGGTTCTCCAGGCCATCATCAAGGTCGCGAATTCCCGGACGAGGATGATGTTACGTCAGGTTGAAGGAAGGCCCCCCTATGCTTCGAGGTCGGATATAAGATATGTCGAACAGGTTTCGGAAATACTCCGAGGACAAGAAGCGTATGAGACTGACTTATGGTTCATGCCACTAAGATATCGCAGGGCTCGCCAGAATTGAGCTTAGCGGATCTGGTGATCTGGTGATCTGGTTGGCCTTCGAGGTCGAGATGGCTTTCGAGGCCAAGGCGAGGATGAAGTGTCCGGCTGACGGATGCTCCGGCGATGTTTCGTCGACGAATAGAAGATTTATGAAGTTTCAGGAAAAGGTTTCGGATTAACTACTTCGAGTATAAGAAGAAGCGCATGAGACTGACACAGGGGCCAAGTGCGCAGGTCATCATTGGGACGCTATGAGATTGAACAGAGCAGGCCGATCGACGCTCATCATTGGGACGAACGCGTGATGCCGCACTTCCAGCGAATAGCTGTAGAATAGGCCGTAGTCATCAAGATCTTGATGTATGTGATCGCCGTAGCTTCGTGCTCAGCTGATGATATTGATCGCTGCTTCGTGCTCAGTTGATGATATTGATAGGCAAGTTCAAAAACTGTGCAATATGAGCAGATCGCTTGTTGAAGTGCTGTTGATATGGCATCATTGTCGCAAGAGAAAGAAACCTCGCTGCATTACTGATCACTAGATCATCACTTGATATAAATTTGTTGCAATGATAGACAGCTTCGTCGATAGCAATTTGTGCTATACTTATCGTGCAGTATTTCGAGCCGCTCTTGACAATACTTATTTTGGATGGAACTTTTAGCCATTAGAGTAACGACGCCGCTTGCAGCCAGGGCAGATCAGACATCTGTCATTAGACAAATCGATAACGTCAACAAAATCCTTAGCAATATCCT

CDS

>Mapoly0080s0037.1
ATGGTTTATAACACGATGCGGCACAGTAGCGGAGCGAGCTCGCGTTGCGCATCATGCAAATATCTACGAAAGAGGTGCACGGACGAGTGCGTACTCGCACCTTACTTTCCTGCAGATCAGCCTTTGAAGTTCGCTATTGTTCATGCACATTTCGATATAGTCAATGTCATTGAGTTACTGCACGGGATTCCAGAATCGTTCCGATTGTCTGTGGTGAAAGATTTGGTTCTCCAGGCCATCATCAAGGTCGCGAATTCCCGGACGAGGATGATGTTACGTCAGGTTGAAGGAAGGCCCCCCTATGCTTCGAGGTCGGATATAAGATATGTCGAACAGGTTTCGGAAATACTCCGAGGACAAGAAGCGTATGAGACTGACTTATGGTTCATGCCACTAAGATATCGCAGGGCTCGCCAGAATTGA

Protein

>Mapoly0080s0037.1
MVYNTMRHSSGASSRCASCKYLRKRCTDECVLAPYFPADQPLKFAIVHAHFDIVNVIELLHGIPESFRLSVVKDLVLQAIIKVANSRTRMMLRQVEGRPPYASRSDIRYVEQVSEILRGQEAYETDLWFMPLRYRRARQN

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>