Mapoly0083s0064



Description

ADP-RIBOSYLATION FACTOR-LIKE 5, ARL5

Reference DB

Database ID Description
GO GO:0005525 GTP binding
KEGGORTH K07977 Arf/Sar family, other
KOG KOG0070 GTP-binding ADP-ribosylation factor Arf1
OrthoMCL OG5_130458
PFAM PF00025 ADP-ribosylation factor family
PANTHER PTHR11711 ADP RIBOSYLATION FACTOR-RELATED
PANTHER PTHR11711:SF31 ADP-RIBOSYLATION FACTOR-LIKE 5, ARL5

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpARFC1 SAR/ARF GTPase Mapoly0083s0064.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0083s0064.1 scaffold_83:624201..627847  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0083s0064.1  

Gene structure:

mRNA scaffold_83:624201..627847  ( + strand )
five_prime_UTR scaffold_83:624201..625679  ( + strand )
five_prime_UTR scaffold_83:625860..626214  ( + strand )
CDS scaffold_83:626215..626769  ( + strand )
three_prime_UTR scaffold_83:626770..627847  ( + strand )

Sequences:

Gene

>Mapoly0083s0064.1
CCTGCGAAGGATTACTACTGTAATGCATATTAAATACGCCGGACCCGACGTTGATTTTTTCCCGGATCGCCATGTCGGGTCTCGAGCGCCTCTCCAAACATGGTGCCTCACGGAAAGGACTTTTCAGCATTTGGGCTGCGTTGCGTTGCAGATGTGCATGCCATCGACGCATTGCTCCGTGCGAGACGAAGAGAGGACGAGAGCAGGAGACGAAGACTTTCGAGAGTGCACCTTCTTCGTCGCTCCAGGTTTCAGATCTGCCCGAAAAGCGTCGTCAGGCTGCGCTTGCGTCGAAGCCGGCCAACACTTTGACTTCGACCCCAGCAGCAGCAGCTCTTGCGCCATCGCTGCCATTTGGACTCCGTCCGCCGAACCGAGCCGAGCCGATCCGATCCGTTCCACATCACCGGGCGATGGGTAAAATCCACCCTTCGAGATCCAGCATGCGCACTTTTACCCCTCCGCCGGGCACCTGTTGCCCGCACGGAGGAGGAGGAGGAGGACGCAGGGGGTCGGTATAGCCGGCAGTCCAGCTGCGCAGAGAGAGAGGGACCCGAAGGCCAGGCGACCGACCACGCAGTAGTAGACTGGACGGGGGGACGGGGGGACGGCGTTGGGGCGAGAGTGTAATTCCACAGTGTCGTAAACTGCAATTGGACGAGGAGAGGAGAGATGCTGCAGGCTTTACACGTGATACATCGGGTCGCGGGTCGCGGCTCGAGGCCGATGACATCGCACTTACTCACCGGTGCGAGGTTCCGGGTACAGAACATGGTCGAGTGAAGTGAGAAGTGGGTGGCGAGGGTGGGCAGGAGGCGAAAGTGGAGGCGACTGCAGGCAAGCAGGCAGAAGAGAAGAGGGCCAAGGAAGAGCAGCAGCAGCAGCAGCAGAGAGAGAGAGAGAGAGGAGTGTAGCGATCAGCTGGCCGTCGTCTGCCCGTCGAATCATATGCCGCAGTAAGAAGAAGAAGAAGACGACGACGACGACGACGAAGGAGGGAAGCAGCTGAGACGCCCTCCTCTTGCTCTCCTCAGGCCGATCTGCTGTCACGACACGACACCAGACCTCCTGCTCGCACGAAAGCTGGGAGGCTCCCTCCTTGGGCTTCCCTTCCCTCTTCCCTTCCCTTCCCTTGCCCCTCTCCTTCCCTTCCCCTTCCCTTCCCTTCCCTTCCCTCGCCTCCCTCTTTCTTTCGGCGTTCCAAGGCTTTCGTCGTCGAGGCTTCTTTCTTCTTTCTTCTCTTCCTTTGGCTCCGCTTGGCTCGGGCAGGGCAGGGCAGGGCAGGGCAGGGCAGGGCTTGGCGTGGAGTGGAGTTGGGGTGGAGTGGAGTGGCTTGGCTTGGCTTGGCTTGGCTTTCTTTTTCTGTTCGATCTATGGGAGTCGGGGCTGGTCAAAGGGAATAGAAGGAGCAGGAGCAGGAGCAGGAGCGAGCTGGGTCCATTGTTTGCCACTCTCGTTCGGAGGCACGGAGACCTTCGGGTGAGTTCGACTTGACTCGTTTCATCTCGCTTCGCTTGGACTGGCTCAGATATGCCGAGGTTCTTTATCTGATCAAAATCGTCGTCGTCGTCATCGTAATCATCATCATGCATATTAATAGGTCTCAGCTTTTCAATCCGCTCAGTGTGTAGCACCTGATAGCAATCGATAGTAGTACAGGCGGCCGAGCCGAGCAGAGCAGAGCGGCAACAGCATCACTCGAGAGAATTTCGTCGGTGAGCGATTGCCATACAAAGCAGCAATTATGTTTCTCTCTTATGGAAAACGATGAGAATCGTAGTTCAGGGCTCTGGTAAGTTTTATAGTGGTGCCCACAGAGTTCAAGAAGGGTGTGCTCCGATTGGACAGGCGCTCCTCAATCAGCTGGACTGTGAGGCAGTAGAGTAGCTGTGCTTATCATCTCGTTGAGTTGGGACGAGACGTGCGAGCAGCAGGAGGAGGAGGAGAGCGAGGAGTAGCTGTAGAGGGGACGGTGACAGGAGGGTGCATCTGTTGGCACAAAAAGAGAGCAACCATGGGGATGATCGTGTCGCGTTTGTGGTATACGATGTTTCCTGCTAAAGAGTACAAGATAGTGGTGGTGGGATTGGACAACGCTGGAAAAACTACCACTCTGTATAAGTTGCACTTGGGGGACGTGGTGAGTACCCAGCCCACGGTGGGCAGTAATGTAGAGCAAGTAAATTATAAGAATCTCCGATTTGAAGTTTGGGATCTAGGTGGGCAAGAGCGTTTGCGAGCATCGTGGGCTACTTATTATCGGGGCACCCATGCGCTGGTTATGGTGGTGGATAGTACAGATCGACAAAGGCTGACAATCGTTAGAAATGAATTAACTCAACTCTTGGGGCACGACGATCTTCAAGGAGCCGTCATTCTAGTGTTTGCAAACAAGCAGGATTTGAAAGATTCCATGTCACCTGCGGAAATAAGCGAAGGGCTGTCGTTGCACGAAATTAAAAAGCACGACTGGCACATTCAGTCTTGCTGTGCCTTGACGGGAGAAGGGTTGTGGGAAGGATTGGGGTGGATTGCTCAACATATGCCAGGGAACGGTCTCAAGGAGTGAGGATGGCACCGTTGAATCCGCGTAACATTGTTGTGATTTAGGGCTTGGGTAAAAATTACTTTCGAGCTCGTGAGAGCAGTATTTGCAAAAGTCCATAAGAAACACCTGCAGGAATAAGCAAATGATTGTCACTGCACGAAATCGAGAGACGTGACTGCGCAATCGACCGTGCCGTGCTCCGACCGGCACGAGATTCGGAGAAAGAAATTTGGGTTGGATTGCACAACTTATGCCAGAAATTGGTATCAAGGGGAGTAGGGTGACGTCAACAATGTCTCAGGTGCAGCACCATTGCGGTTTAGGGCTTGGTTGCTGTGCTACTCAGCGTACGAGAGCAGGTTTTGCTGCTGCCGCAAGACCCAGAGCATTGTGTTTTACAATATTTGGTGGCCTGTAATTTATTACCGATTGCTTCTTTCATGGCATTTGCTCCTATCGAAATATGATGGTCGCTTTAGTCGTTGGTAGAAACATTGCCAGCTGAGTTAATTTTAGTTAATACGAGTGTTTGTCACAATTCCCTTATCTCATGAAGGAAGCAGAATGTCCAGAACGTCATGAATGATCAAATGTGCAATTCTTTCCTAGTCAATGAACCTATCAGCTTATTTTGTTCAGTTTCACGACTTTGCCCCACTTTGTTACACTCCTGTACTCTTGTTCCATAGTACGTAGTGCCAACATAAATTGGTGTACTGACTTTTTCTTGAATCAATTACCTCTTTAGCATAGGCTTCACACTTATCATGAACGGCTAAGCACTTTCTTTTCGGCTCTGAAGCTGAGGTTAATATCGGACGTCCATATGACTGCTTAGAACCAAGTACTTTACTGTCGGAATTTCGTCAATATCTTTGATTTTGAATCTATCATCGTTCTTTGCTATCTTTTTATGCCTTCACGATGTAACTTTTAGCAGTGGAAAATACTGTGAAGGAAATATATCTAGGTATGTGTTTACAGTTATGGTGTGTCTCGACCTGTATGTCATGTTTACGAGAAACCAGTGGCCAAGTAGAAAACATGAATATGTCAGTTTTGATGGTATATCTCACTAAACTTTCGATATCATGTGGTG

mRNA

>Mapoly0083s0064.1
CCTGCGAAGGATTACTACTGTAATGCATATTAAATACGCCGGACCCGACGTTGATTTTTTCCCGGATCGCCATGTCGGGTCTCGAGCGCCTCTCCAAACATGGTGCCTCACGGAAAGGACTTTTCAGCATTTGGGCTGCGTTGCGTTGCAGATGTGCATGCCATCGACGCATTGCTCCGTGCGAGACGAAGAGAGGACGAGAGCAGGAGACGAAGACTTTCGAGAGTGCACCTTCTTCGTCGCTCCAGGTTTCAGATCTGCCCGAAAAGCGTCGTCAGGCTGCGCTTGCGTCGAAGCCGGCCAACACTTTGACTTCGACCCCAGCAGCAGCAGCTCTTGCGCCATCGCTGCCATTTGGACTCCGTCCGCCGAACCGAGCCGAGCCGATCCGATCCGTTCCACATCACCGGGCGATGGGTAAAATCCACCCTTCGAGATCCAGCATGCGCACTTTTACCCCTCCGCCGGGCACCTGTTGCCCGCACGGAGGAGGAGGAGGAGGACGCAGGGGGTCGGTATAGCCGGCAGTCCAGCTGCGCAGAGAGAGAGGGACCCGAAGGCCAGGCGACCGACCACGCAGTAGTAGACTGGACGGGGGGACGGGGGGACGGCGTTGGGGCGAGAGTGTAATTCCACAGTGTCGTAAACTGCAATTGGACGAGGAGAGGAGAGATGCTGCAGGCTTTACACGTGATACATCGGGTCGCGGGTCGCGGCTCGAGGCCGATGACATCGCACTTACTCACCGGTGCGAGGTTCCGGGTACAGAACATGGTCGAGTGAAGTGAGAAGTGGGTGGCGAGGGTGGGCAGGAGGCGAAAGTGGAGGCGACTGCAGGCAAGCAGGCAGAAGAGAAGAGGGCCAAGGAAGAGCAGCAGCAGCAGCAGCAGAGAGAGAGAGAGAGAGGAGTGTAGCGATCAGCTGGCCGTCGTCTGCCCGTCGAATCATATGCCGCAGTAAGAAGAAGAAGAAGACGACGACGACGACGACGAAGGAGGGAAGCAGCTGAGACGCCCTCCTCTTGCTCTCCTCAGGCCGATCTGCTGTCACGACACGACACCAGACCTCCTGCTCGCACGAAAGCTGGGAGGCTCCCTCCTTGGGCTTCCCTTCCCTCTTCCCTTCCCTTCCCTTGCCCCTCTCCTTCCCTTCCCCTTCCCTTCCCTTCCCTTCCCTCGCCTCCCTCTTTCTTTCGGCGTTCCAAGGCTTTCGTCGTCGAGGCTTCTTTCTTCTTTCTTCTCTTCCTTTGGCTCCGCTTGGCTCGGGCAGGGCAGGGCAGGGCAGGGCAGGGCAGGGCTTGGCGTGGAGTGGAGTTGGGGTGGAGTGGAGTGGCTTGGCTTGGCTTGGCTTGGCTTTCTTTTTCTGTTCGATCTATGGGAGTCGGGGCTGGTCAAAGGGAATAGAAGGAGCAGGAGCAGGAGCAGGAGCGAGCTGGGTCCATTGTTTGCCACTCTCGTTCGGAGGCACGGAGACCTTCGGGCGGCCGAGCCGAGCAGAGCAGAGCGGCAACAGCATCACTCGAGAGAATTTCGTCGGTGAGCGATTGCCATACAAAGCAGCAATTATGTTTCTCTCTTATGGAAAACGATGAGAATCGTAGTTCAGGGCTCTGGTAAGTTTTATAGTGGTGCCCACAGAGTTCAAGAAGGGTGTGCTCCGATTGGACAGGCGCTCCTCAATCAGCTGGACTGTGAGGCAGTAGAGTAGCTGTGCTTATCATCTCGTTGAGTTGGGACGAGACGTGCGAGCAGCAGGAGGAGGAGGAGAGCGAGGAGTAGCTGTAGAGGGGACGGTGACAGGAGGGTGCATCTGTTGGCACAAAAAGAGAGCAACCATGGGGATGATCGTGTCGCGTTTGTGGTATACGATGTTTCCTGCTAAAGAGTACAAGATAGTGGTGGTGGGATTGGACAACGCTGGAAAAACTACCACTCTGTATAAGTTGCACTTGGGGGACGTGGTGAGTACCCAGCCCACGGTGGGCAGTAATGTAGAGCAAGTAAATTATAAGAATCTCCGATTTGAAGTTTGGGATCTAGGTGGGCAAGAGCGTTTGCGAGCATCGTGGGCTACTTATTATCGGGGCACCCATGCGCTGGTTATGGTGGTGGATAGTACAGATCGACAAAGGCTGACAATCGTTAGAAATGAATTAACTCAACTCTTGGGGCACGACGATCTTCAAGGAGCCGTCATTCTAGTGTTTGCAAACAAGCAGGATTTGAAAGATTCCATGTCACCTGCGGAAATAAGCGAAGGGCTGTCGTTGCACGAAATTAAAAAGCACGACTGGCACATTCAGTCTTGCTGTGCCTTGACGGGAGAAGGGTTGTGGGAAGGATTGGGGTGGATTGCTCAACATATGCCAGGGAACGGTCTCAAGGAGTGAGGATGGCACCGTTGAATCCGCGTAACATTGTTGTGATTTAGGGCTTGGGTAAAAATTACTTTCGAGCTCGTGAGAGCAGTATTTGCAAAAGTCCATAAGAAACACCTGCAGGAATAAGCAAATGATTGTCACTGCACGAAATCGAGAGACGTGACTGCGCAATCGACCGTGCCGTGCTCCGACCGGCACGAGATTCGGAGAAAGAAATTTGGGTTGGATTGCACAACTTATGCCAGAAATTGGTATCAAGGGGAGTAGGGTGACGTCAACAATGTCTCAGGTGCAGCACCATTGCGGTTTAGGGCTTGGTTGCTGTGCTACTCAGCGTACGAGAGCAGGTTTTGCTGCTGCCGCAAGACCCAGAGCATTGTGTTTTACAATATTTGGTGGCCTGTAATTTATTACCGATTGCTTCTTTCATGGCATTTGCTCCTATCGAAATATGATGGTCGCTTTAGTCGTTGGTAGAAACATTGCCAGCTGAGTTAATTTTAGTTAATACGAGTGTTTGTCACAATTCCCTTATCTCATGAAGGAAGCAGAATGTCCAGAACGTCATGAATGATCAAATGTGCAATTCTTTCCTAGTCAATGAACCTATCAGCTTATTTTGTTCAGTTTCACGACTTTGCCCCACTTTGTTACACTCCTGTACTCTTGTTCCATAGTACGTAGTGCCAACATAAATTGGTGTACTGACTTTTTCTTGAATCAATTACCTCTTTAGCATAGGCTTCACACTTATCATGAACGGCTAAGCACTTTCTTTTCGGCTCTGAAGCTGAGGTTAATATCGGACGTCCATATGACTGCTTAGAACCAAGTACTTTACTGTCGGAATTTCGTCAATATCTTTGATTTTGAATCTATCATCGTTCTTTGCTATCTTTTTATGCCTTCACGATGTAACTTTTAGCAGTGGAAAATACTGTGAAGGAAATATATCTAGGTATGTGTTTACAGTTATGGTGTGTCTCGACCTGTATGTCATGTTTACGAGAAACCAGTGGCCAAGTAGAAAACATGAATATGTCAGTTTTGATGGTATATCTCACTAAACTTTCGATATCATGTGGTG

CDS

>Mapoly0083s0064.1
ATGGGGATGATCGTGTCGCGTTTGTGGTATACGATGTTTCCTGCTAAAGAGTACAAGATAGTGGTGGTGGGATTGGACAACGCTGGAAAAACTACCACTCTGTATAAGTTGCACTTGGGGGACGTGGTGAGTACCCAGCCCACGGTGGGCAGTAATGTAGAGCAAGTAAATTATAAGAATCTCCGATTTGAAGTTTGGGATCTAGGTGGGCAAGAGCGTTTGCGAGCATCGTGGGCTACTTATTATCGGGGCACCCATGCGCTGGTTATGGTGGTGGATAGTACAGATCGACAAAGGCTGACAATCGTTAGAAATGAATTAACTCAACTCTTGGGGCACGACGATCTTCAAGGAGCCGTCATTCTAGTGTTTGCAAACAAGCAGGATTTGAAAGATTCCATGTCACCTGCGGAAATAAGCGAAGGGCTGTCGTTGCACGAAATTAAAAAGCACGACTGGCACATTCAGTCTTGCTGTGCCTTGACGGGAGAAGGGTTGTGGGAAGGATTGGGGTGGATTGCTCAACATATGCCAGGGAACGGTCTCAAGGAGTGA

Protein

>Mapoly0083s0064.1
MGMIVSRLWYTMFPAKEYKIVVVGLDNAGKTTTLYKLHLGDVVSTQPTVGSNVEQVNYKNLRFEVWDLGGQERLRASWATYYRGTHALVMVVDSTDRQRLTIVRNELTQLLGHDDLQGAVILVFANKQDLKDSMSPAEISEGLSLHEIKKHDWHIQSCCALTGEGLWEGLGWIAQHMPGNGLKE

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>