Mapoly0084s0052



Description

(UnKnown)

Reference DB

Database ID Description

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpCLE2 peptide hormone Mapoly0084s0052.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0084s0052.1 scaffold_84:569173..573667  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0084s0052.1  

Gene structure:

mRNA scaffold_84:569173..573667  ( + strand )
five_prime_UTR scaffold_84:569173..570840  ( + strand )
CDS scaffold_84:570841..571254  ( + strand )
three_prime_UTR scaffold_84:571255..573667  ( + strand )

Sequences:

Gene

>Mapoly0084s0052.1
GCAAGCTCCTGCGGCATCAATGAGTGTTGTGTACACCAACCGCAGTTTGCTTCTCCAAGGCTTACCTGACCGGTGGACATTCCTGCGGCCCCGACGCCCGACGCCCGTGAGAGAGAGTGCCCTGTATCGGGGACATAGACTTTTCACTGCTGTATAAGTATATAACCATGGAGAGTATACCGCAAGCTCCAGCACGGCTCTAACACGTAGATTTATTGATTGGGATTCTCTGATACATGTACAGCACTAGAGTCTGTTCTGGTCTGATCTGATTCAGACAGCAATTGCAACCGAGAAGCTGCGTGCTGTTGTGCCAACCACAGTCGAATTCGTCCTGCTCTACAAGGATACCACCACTGATACCACTTCTCCTGAGGCTCTTGTTCTTCCACTACTAGTACAATCGCGCGATTGCAAGTTCAGTAGAAGACGGCCAGCGCCGAGCGAGAGAGAGAGAGAGAGAGTACTTCGGGTAGAGAAGGGGTGAGACTAGAATTAAGCGACTTGGGGACGGAGAGGAGAGGACCGAGGTGGCGGTCTGGGGAAGCGGTGGGGAAGTACTACTGAGGGGCACATGTGTGCAGTCGTCTGCTGATCTCGCGGTGGCGTGCACACAAGCACATGAACGGCAGCAAAGCGCAAGGGGGAAGCCATCTTCGCGGAGCGAGCTCCGTCGTCTGCACTCTCCCTCCCTCCTTCTCTCCCTCTTTCTTTTCCCCCTCGCGAGCCAGCCATCTGGAACAGCACAGACAGACAGATGACAGAGTCGTTTACTTAATTTGTGGACTTTTCCGGGCTTGAGTGTGTTTCGCCACCAAATCGTCGCCTCTCAGACTCGCTTAACTCCGCGCCTTCGCTGGCCCCCTCCGGCCCTGCGGCCCTCCCTCCCTGCCTGAGCCCGGCCCTCACCTCACCTGGCTTCCCGTCCCGTGCCTGGCCTGGGCTGGGCTGGCCTCGGGCTCGGGCTCGTCCGTCTTGCTTGTTCATGTTCTGAGAGCATTTGACGAGACTCGTCATTGCTGCTGCTGCTGCTGCTGCTGCTCCGGCTGCCTACCACTATTTCAACAGGACCCGCTTCCTTCTTTCGCCTCTGTGTCTGTCTGCCCGCCTGTCTGTCCCTCCGCATTCATCACTGAACGCGTTTCCTTCCCCGACACTCTCAAGTGCTGGTAGAGAAACAAACATTCCGCATCTTCTGCTGTTCCATCGGGCCTCGTCTCGTCCTCCTCCTCCTCCGTCGTCGTGCCCCTACTGCTGCTTCTGCTTCTGGTTCTGGCCCCGGAGCTGCTGCTAGTGCTAGCGCTGGTAGAAGTAGTAGTGCCCACAGCATTCGGTCTCCTCTCTCTCGCTCTCTCTCTCTCTCTCTCTCTCTCTCTTGCTCGCTCGCTTGACGCACGACCACGAGACGAGGGCAGCGGAGGGGAGTGGGGGAGGGGAGGGGTGACGGGACGACGTGCTCATGTTGCTATGGTATGAAATACGAGAAAGCCTGGATCAACTCGAACATTGTAAATATCCTGAAATCTGCTGCTGTTTCTGCTGCTGCCGGTTACGGGCCGAGCATCAGGCGGAGGCGGAGGAGGAAGAGGACGTGCAGCATCAGCGTCGGCATCAGCAGAGAGGAGGCCGAGTAGTACTTGCTGCACATTTACGTTTATTACAGCTCTAATGAGGAATCCAGGGAGTACAGGAACAGGCTCAGGAATGGTGATTAGAAGCGCGCTCGTATCGTGGCTGCGATTCCTAGTTTTGGCATTCCTCGTGTGCAGCTCGGACGCATCTCGTGGACTTAGGCTCAGTTTGAGAGGTGGTGGGCAAGTAGACGCGTCGCCGGGCACAATCCATGAGCAGCAGCTGGGCACCGAGCCCGCGGTGCAGCAGCTGCTGCTGCTGCCGGAGCACACCCTCAGGAGATTACTGGCCGGGGCCGAAGCGACCTTAAACACGGGGGATTTCGAGGAGATTTCCGAATGCAATTTGGAGAATTTGCACGAGTGCGCGCCCCCGGCGCTCGGGTCTCAATTTCCCACCTTCGAGTCCAAGAAGGAGGTGCCCAATGGTCCCAACCCGCTTCACAACTAGCGTGATTGATTGGCCGGTAGGATTTTCTGTATTCACGATCACACCCATACCCGAGAGGAGGAGGACGGCTGCAGAGATTTAGATTCCTCCCACCGGACGACAGCAACAATGTAGAGCTGGGATGCACCTACCGACCCGGACAGACAGCCAGCCAGAGCTCGCATCCCTCAGCCTCCCAGAGCCGCGTTCTTTTCTTCGACTTGTATCATTCATTCTGTAAACCTGAAGAACGAATTCGACTCACCACCACTCTTGGGAACACTGTCTCACGAGGATTCGTCGGCTGTGCGTGTGGATCTAATCTATCATCGCTGGAATTCCAGAACCAGGCCGTGCCCGTGCTCGTGGCTCGCTCGGCCTCGCCGTTCAGTCGGTCCATCCACCATCACCTACACCATCAGATTAATAAATGAAAATCCTCGTGGGAGGGAGCGCCCTCGGAGCAAGGGCAGTTTAGACAGAGATCGCATAGAAGAAGAAGAAGTGGAAGAAGAAGAAGACGAAGACGAAGGGAAGACACCTTTTGGTAGACAGCGCCTATAGTGTTACATTAGTACTGTAAAGTACTTACATGAGTACTTGCTCAGCTTCATTCACATTACCAATTTTTTCATACAGCTGTTTTGTCGCTCGAGTTTCCATCGTTACTGTCGGTCGTCGTTGTCGCCGCCGCCGTTGCTGCTGCTGCTGCTGCTGTGAACCAGGGAAAGATTTCATCATGAGTGTGCACGAGGACGTGGGAGAGAGGGAGAGTGGGAGAGGAGAGGCGAGCAGATTTGTTGACTTGGACGCGCAGTGAGTGAGTGGGTTGAGCTATTGCAGTATCACGACCATTTTATCCATCTATCCATTCAATTCGATCGAGGGGCATGCGGGCGAGCTGGCGAGCGGGCGAGAGTGAGTAGGAGAGTGGAATCGTAAAACCCCAGGAGTTTACAAATAGGGAATCGATCGAGGGCAGCAACTTTTGGCTTCTCCGCGGACACGAGAAGAGGAAGACGATGAAGCAGAAGTTGCTCACGGGGTTGTACTCTTCTTTTCTTCGACGACCTTGGACCTCTCGAACATGCCGCTCTTTGAAACACCATCATCATCACCAACCATCCTTCTTTTCTTCGAAGACCTTGGACCTCTTGAACTTGCCGCTCTTCGAGACACCATCATCATCAGCATCGGCCTTCCAGAAGGAGGATTCAGCTTACGGATGAGCTTGTTCCAGCTTCTAGGCACACTCTTTCGGCTGCAGGTGGCAGCAGTGGCGGAGACCGAGGACGAGAACGATTCCATGACGGAGGGAGCGGGCTTTGGCTGATTGACGAACGAGGATCGATTAATCAACATCGACGAGGACGACGACGACGACAGTGGGTGCGGAGAGGAGGATGGTGCGAATTGTATGTGATTAAAATCCGTTCTTAGACGTGAGTCGCTGTGAAGTCGTAGTGAGTATTAGATGAGTCGGTGAAGTCGGTAGCTGGTGCTGCGAAGATGGATGTTATGATGCAAGCTGTTCGTTCGGGGAGCTTTTTTAGAGAGATTTTTTAGACTGCATCGAAACGAACAAAGATCGAATCCTCGAAGATGTTTAATGGCCGTGACATATACGAAATCATTCTTTCAAAAAGTAGAATTAATAAGTGAGTCAGCAGCTGTCAATTGCAATTGCTATCAAGGGAAGAGGCAATTGATCCAAGATGAGGAAAGCTCCCGTGCATATATACATTGATGATGAGTTTCCCTCTCTGCAATTAGACTCGTGGCCCGTTGATAACCATCCATATCTGTGTTGTGAATAATTTTATATTTGAAAAATCGAGGTGTTGTTGGTCCTTGACACCCTCGCTCACGGTGCCCAAGGAACTGTCGCACCTTTCACTGTAACTGGGATTTTCATTTTTGGCATGAATAGCAGCTGCTCGCAAGCAGCGCGAGCAGCTAGCAGCGGGTCACTTTCTGTCTGTCTGTCACTCCGCCCTCCTTTTCTCCTCCTCCTTTCGGTACCTGCTTGCCACTGCTTACCGCATGCACCCCAGTTCCGACCTGTCTTGACATTGTCACCGTAGCTTTCCGGTCAATTTCCCTTTCTCGGACCCGGAATGCCACGTCCATGGTGTTGAGCCCCTGATCCGCCCCAGGTCCACTGCAGATCATGTGCATCCGTCTGTTCTTTTCCAAAGTCCATCGAGTGTCTCGTTCAGATGATACATTTTGAACTTATACAGCCCCAATCAGTCACAGCTGGCTCGCTCGCTCGCTCGCTCGGAGGGAGAGAGAAAGCCGAGGTTTGCAGCCATGATGGTGCAAGCTCAGCTCAGCTCAGCTCGCAAGAGCCAGCAGCTGCGCTCGTTGGTGTAAAATTTCGCGCCTTCAGGAAGGACTGGGCGAAAAGAGGCTCGTCGTGAGATAGGGAGGG

mRNA

>Mapoly0084s0052.1
GCAAGCTCCTGCGGCATCAATGAGTGTTGTGTACACCAACCGCAGTTTGCTTCTCCAAGGCTTACCTGACCGGTGGACATTCCTGCGGCCCCGACGCCCGACGCCCGTGAGAGAGAGTGCCCTGTATCGGGGACATAGACTTTTCACTGCTGTATAAGTATATAACCATGGAGAGTATACCGCAAGCTCCAGCACGGCTCTAACACGTAGATTTATTGATTGGGATTCTCTGATACATGTACAGCACTAGAGTCTGTTCTGGTCTGATCTGATTCAGACAGCAATTGCAACCGAGAAGCTGCGTGCTGTTGTGCCAACCACAGTCGAATTCGTCCTGCTCTACAAGGATACCACCACTGATACCACTTCTCCTGAGGCTCTTGTTCTTCCACTACTAGTACAATCGCGCGATTGCAAGTTCAGTAGAAGACGGCCAGCGCCGAGCGAGAGAGAGAGAGAGAGAGTACTTCGGGTAGAGAAGGGGTGAGACTAGAATTAAGCGACTTGGGGACGGAGAGGAGAGGACCGAGGTGGCGGTCTGGGGAAGCGGTGGGGAAGTACTACTGAGGGGCACATGTGTGCAGTCGTCTGCTGATCTCGCGGTGGCGTGCACACAAGCACATGAACGGCAGCAAAGCGCAAGGGGGAAGCCATCTTCGCGGAGCGAGCTCCGTCGTCTGCACTCTCCCTCCCTCCTTCTCTCCCTCTTTCTTTTCCCCCTCGCGAGCCAGCCATCTGGAACAGCACAGACAGACAGATGACAGAGTCGTTTACTTAATTTGTGGACTTTTCCGGGCTTGAGTGTGTTTCGCCACCAAATCGTCGCCTCTCAGACTCGCTTAACTCCGCGCCTTCGCTGGCCCCCTCCGGCCCTGCGGCCCTCCCTCCCTGCCTGAGCCCGGCCCTCACCTCACCTGGCTTCCCGTCCCGTGCCTGGCCTGGGCTGGGCTGGCCTCGGGCTCGGGCTCGTCCGTCTTGCTTGTTCATGTTCTGAGAGCATTTGACGAGACTCGTCATTGCTGCTGCTGCTGCTGCTGCTGCTCCGGCTGCCTACCACTATTTCAACAGGACCCGCTTCCTTCTTTCGCCTCTGTGTCTGTCTGCCCGCCTGTCTGTCCCTCCGCATTCATCACTGAACGCGTTTCCTTCCCCGACACTCTCAAGTGCTGGTAGAGAAACAAACATTCCGCATCTTCTGCTGTTCCATCGGGCCTCGTCTCGTCCTCCTCCTCCTCCGTCGTCGTGCCCCTACTGCTGCTTCTGCTTCTGGTTCTGGCCCCGGAGCTGCTGCTAGTGCTAGCGCTGGTAGAAGTAGTAGTGCCCACAGCATTCGGTCTCCTCTCTCTCGCTCTCTCTCTCTCTCTCTCTCTCTCTCTTGCTCGCTCGCTTGACGCACGACCACGAGACGAGGGCAGCGGAGGGGAGTGGGGGAGGGGAGGGGTGACGGGACGACGTGCTCATGTTGCTATGGTATGAAATACGAGAAAGCCTGGATCAACTCGAACATTGTAAATATCCTGAAATCTGCTGCTGTTTCTGCTGCTGCCGGTTACGGGCCGAGCATCAGGCGGAGGCGGAGGAGGAAGAGGACGTGCAGCATCAGCGTCGGCATCAGCAGAGAGGAGGCCGAGTAGTACTTGCTGCACATTTACGTTTATTACAGCTCTAATGAGGAATCCAGGGAGTACAGGAACAGGCTCAGGAATGGTGATTAGAAGCGCGCTCGTATCGTGGCTGCGATTCCTAGTTTTGGCATTCCTCGTGTGCAGCTCGGACGCATCTCGTGGACTTAGGCTCAGTTTGAGAGGTGGTGGGCAAGTAGACGCGTCGCCGGGCACAATCCATGAGCAGCAGCTGGGCACCGAGCCCGCGGTGCAGCAGCTGCTGCTGCTGCCGGAGCACACCCTCAGGAGATTACTGGCCGGGGCCGAAGCGACCTTAAACACGGGGGATTTCGAGGAGATTTCCGAATGCAATTTGGAGAATTTGCACGAGTGCGCGCCCCCGGCGCTCGGGTCTCAATTTCCCACCTTCGAGTCCAAGAAGGAGGTGCCCAATGGTCCCAACCCGCTTCACAACTAGCGTGATTGATTGGCCGGTAGGATTTTCTGTATTCACGATCACACCCATACCCGAGAGGAGGAGGACGGCTGCAGAGATTTAGATTCCTCCCACCGGACGACAGCAACAATGTAGAGCTGGGATGCACCTACCGACCCGGACAGACAGCCAGCCAGAGCTCGCATCCCTCAGCCTCCCAGAGCCGCGTTCTTTTCTTCGACTTGTATCATTCATTCTGTAAACCTGAAGAACGAATTCGACTCACCACCACTCTTGGGAACACTGTCTCACGAGGATTCGTCGGCTGTGCGTGTGGATCTAATCTATCATCGCTGGAATTCCAGAACCAGGCCGTGCCCGTGCTCGTGGCTCGCTCGGCCTCGCCGTTCAGTCGGTCCATCCACCATCACCTACACCATCAGATTAATAAATGAAAATCCTCGTGGGAGGGAGCGCCCTCGGAGCAAGGGCAGTTTAGACAGAGATCGCATAGAAGAAGAAGAAGTGGAAGAAGAAGAAGACGAAGACGAAGGGAAGACACCTTTTGGTAGACAGCGCCTATAGTGTTACATTAGTACTGTAAAGTACTTACATGAGTACTTGCTCAGCTTCATTCACATTACCAATTTTTTCATACAGCTGTTTTGTCGCTCGAGTTTCCATCGTTACTGTCGGTCGTCGTTGTCGCCGCCGCCGTTGCTGCTGCTGCTGCTGCTGTGAACCAGGGAAAGATTTCATCATGAGTGTGCACGAGGACGTGGGAGAGAGGGAGAGTGGGAGAGGAGAGGCGAGCAGATTTGTTGACTTGGACGCGCAGTGAGTGAGTGGGTTGAGCTATTGCAGTATCACGACCATTTTATCCATCTATCCATTCAATTCGATCGAGGGGCATGCGGGCGAGCTGGCGAGCGGGCGAGAGTGAGTAGGAGAGTGGAATCGTAAAACCCCAGGAGTTTACAAATAGGGAATCGATCGAGGGCAGCAACTTTTGGCTTCTCCGCGGACACGAGAAGAGGAAGACGATGAAGCAGAAGTTGCTCACGGGGTTGTACTCTTCTTTTCTTCGACGACCTTGGACCTCTCGAACATGCCGCTCTTTGAAACACCATCATCATCACCAACCATCCTTCTTTTCTTCGAAGACCTTGGACCTCTTGAACTTGCCGCTCTTCGAGACACCATCATCATCAGCATCGGCCTTCCAGAAGGAGGATTCAGCTTACGGATGAGCTTGTTCCAGCTTCTAGGCACACTCTTTCGGCTGCAGGTGGCAGCAGTGGCGGAGACCGAGGACGAGAACGATTCCATGACGGAGGGAGCGGGCTTTGGCTGATTGACGAACGAGGATCGATTAATCAACATCGACGAGGACGACGACGACGACAGTGGGTGCGGAGAGGAGGATGGTGCGAATTGTATGTGATTAAAATCCGTTCTTAGACGTGAGTCGCTGTGAAGTCGTAGTGAGTATTAGATGAGTCGGTGAAGTCGGTAGCTGGTGCTGCGAAGATGGATGTTATGATGCAAGCTGTTCGTTCGGGGAGCTTTTTTAGAGAGATTTTTTAGACTGCATCGAAACGAACAAAGATCGAATCCTCGAAGATGTTTAATGGCCGTGACATATACGAAATCATTCTTTCAAAAAGTAGAATTAATAAGTGAGTCAGCAGCTGTCAATTGCAATTGCTATCAAGGGAAGAGGCAATTGATCCAAGATGAGGAAAGCTCCCGTGCATATATACATTGATGATGAGTTTCCCTCTCTGCAATTAGACTCGTGGCCCGTTGATAACCATCCATATCTGTGTTGTGAATAATTTTATATTTGAAAAATCGAGGTGTTGTTGGTCCTTGACACCCTCGCTCACGGTGCCCAAGGAACTGTCGCACCTTTCACTGTAACTGGGATTTTCATTTTTGGCATGAATAGCAGCTGCTCGCAAGCAGCGCGAGCAGCTAGCAGCGGGTCACTTTCTGTCTGTCTGTCACTCCGCCCTCCTTTTCTCCTCCTCCTTTCGGTACCTGCTTGCCACTGCTTACCGCATGCACCCCAGTTCCGACCTGTCTTGACATTGTCACCGTAGCTTTCCGGTCAATTTCCCTTTCTCGGACCCGGAATGCCACGTCCATGGTGTTGAGCCCCTGATCCGCCCCAGGTCCACTGCAGATCATGTGCATCCGTCTGTTCTTTTCCAAAGTCCATCGAGTGTCTCGTTCAGATGATACATTTTGAACTTATACAGCCCCAATCAGTCACAGCTGGCTCGCTCGCTCGCTCGCTCGGAGGGAGAGAGAAAGCCGAGGTTTGCAGCCATGATGGTGCAAGCTCAGCTCAGCTCAGCTCGCAAGAGCCAGCAGCTGCGCTCGTTGGTGTAAAATTTCGCGCCTTCAGGAAGGACTGGGCGAAAAGAGGCTCGTCGTGAGATAGGGAGGG

CDS

>Mapoly0084s0052.1
ATGAGGAATCCAGGGAGTACAGGAACAGGCTCAGGAATGGTGATTAGAAGCGCGCTCGTATCGTGGCTGCGATTCCTAGTTTTGGCATTCCTCGTGTGCAGCTCGGACGCATCTCGTGGACTTAGGCTCAGTTTGAGAGGTGGTGGGCAAGTAGACGCGTCGCCGGGCACAATCCATGAGCAGCAGCTGGGCACCGAGCCCGCGGTGCAGCAGCTGCTGCTGCTGCCGGAGCACACCCTCAGGAGATTACTGGCCGGGGCCGAAGCGACCTTAAACACGGGGGATTTCGAGGAGATTTCCGAATGCAATTTGGAGAATTTGCACGAGTGCGCGCCCCCGGCGCTCGGGTCTCAATTTCCCACCTTCGAGTCCAAGAAGGAGGTGCCCAATGGTCCCAACCCGCTTCACAACTAG

Protein

>Mapoly0084s0052.1
MRNPGSTGTGSGMVIRSALVSWLRFLVLAFLVCSSDASRGLRLSLRGGGQVDASPGTIHEQQLGTEPAVQQLLLLPEHTLRRLLAGAEATLNTGDFEEISECNLENLHECAPPALGSQFPTFESKKEVPNGPNPLHN

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>