Mapoly0089s0067



Description

(UnKnown)

Reference DB

Database ID Description
OrthoMCL OG5_178125
PANTHER PTHR31681 FAMILY NOT NAMED
PANTHER PTHR31681:SF1

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpC2H2-14 transcription factor, C2H2-ZnF Mapoly0089s0067.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0089s0067.1 scaffold_89:769374..773326  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0089s0067.1  

Gene structure:

mRNA scaffold_89:769374..773326  ( + strand )
five_prime_UTR scaffold_89:769374..770625  ( + strand )
CDS scaffold_89:770626..771223  ( + strand )
CDS scaffold_89:772173..772798  ( + strand )
three_prime_UTR scaffold_89:772799..773326  ( + strand )

Sequences:

Gene

>Mapoly0089s0067.1
TTGCTTTCTGTTTTTAGAAGATTGGATGATTAGGATTTCCACCTTGTGCGCCACCCTCTGCTCGCTCGCCCCTCTTTCTTTCTCTCTCTCACTCCTCGCTTTGCTTGTGACACTGATTAGAACGCGAGAGTCGGCTGCAAGGGTTCGAGTAATGCTGCTGGCAGCTGGGCTCAGCTTCCCGTGCCTCTTAATGCAAGCCCGGGCCTCCAGCACAGCAGCAGTAGCTTTGTAGTTCCTACGTCTTCTAGTCCGACGCCTCTCCTTCTCTTTCGCCTTTCTCTCTTCTCTCTTCTTCACTAGCCAGCCCCCGCTCCGTGAGAGCTGTAACACTCTTGCTAGATTTCCGACCCTGCAGGCCCCGCAGTGCGCTTCTGCTGTGTTCTGTTCAGAATCCGTCTGGAGTCGAAACTTTCATATTCCTCGGGAGAATCACCTTCGGCGTGAACTTGATAGGTTTCAGTCGAGGCGTGAACAGAAGCTGCTGCCCAAGGATTGTACTGTGGACTGAGATCTGGTCTGGGACCGGTGCTCCCGTGCGCTCCATGTGGCCCTCAAGTTTCAGTCTGATCGATTTGTAAGGATTCAGGAGTCGGGCTGACTTTCTCAACTTGAGAAATGCGGAAGACCGTGACATCCTTCCGGAACTGCTTCTGGTGATGATGTCGATGTCCATGCCATTATGTTCGCCGAGGATGCTGCTCTCACTCCGATTTGACGATCACGTTGGGCTGGCTCATGGAACTGTTGGGGATTGCACCAGTTTCGCCTGCCTGCTTGCCCCTTTATTGGAGGCCGAGAAGAGATAAAGCGCCGCCAAGTTTCGCTCTTCATTTCCCGGACAGACCGACTGACTCACTGACTGGCTGACTTCCGAGCAATTGATTGAGCTGGGCGACGGGGATGGCGTCCCTCGGTGTTCAATTGACGAGAAGACATCAGCAGCAGCCTGCAAACAATTTGCTCGGAGTTTCGTCCCGAACGTGAGCGTTTTGACTTCGGTTCGGTGGGAGACGCAGAGCATCTCTGGACAGAAAGGCGGACCGCTCAACTGCCTTGGGGTTTTTGTTTTTTAATCTCGTCGGGTGGCGTCCTTAGTACCCGACTCATGAATCAGGTCGACGACTGCTTGCACAGCTGACAGAGATTAGTCCCTAAGCCTGCGCAAGGTCTGTAGGACTAGCAGCAACAAATACGGGTCATCGCCGCCGCAAGGTAGAAGCGTAGCAGTGCGAGGATTCGTAGGGAGATTACCATGCCGAGTTCATGGACTTCATGGAAGAGAGCGCTGAGTTGCAAGACAGACCGAGACCAAGTCATTGAGCCTCACTCGATGATTCCGCCTTCTAGCAAGAGCTCAGTGGGGATGAAATCGAAAAAACACTACAGCGCAAGGAGCTGCTCGAGGTCTCTGCTAAGCCTCAGAGACGTCATACACGGGAACACTCGCGTGGTTCACAAACAATCGAGCCCCCGATCAGTGGCCACGAGTGACGATTGTCTGAGACAGGTGTCCCCAGATCTATCCTACTGCGACACCAGGAGCTCGAGCGGAGGAACCCCGTCCGAGGTGGGATCAGTGTTCGGGCGCAGCAATTCCAGGAGCGGCTCCCTGACCTCGACGCCGCTGTCTCACGCCAGCTATGTCTTCAAAGGAACCCCGCTCAGAAAGCTCTCGGGCTGCTATGATTGCAACATGGCCTACGAAACGCTGGATTCCATGCAGCTGGTGTATAGAGAAGGCTCGCTGCACGGTTCCTACTGTGGCTCGCCCAAGGCCGGGTGCCCGAAATGCGGAGAGACCTTCAGCAAAGCCGAGGCCTTGGAGGCACACCACATCTCTCAGCACGCAGGTGAGCATTTCGGCGGAATGTGCCATCTGTCTAGAAGCCACTGAACGCTAATTTGTGCCTCATAATTCCGTCATTCTCCTGCTTCTTTTATGAGGTCGAGGCAGCAAAACCTGTCACTTGGGTAATTCTGGAGCCTGCTAGCTGGGAATTCTATTTTTTCTTAAGTAACCCGGTTCCGTTTTGATATTTTTGTGTGAGAGTAGAACCCCGTTCGATGTGACTCCATAGTGTGCCCTGTTCTGGGTCTGGTCCATTCTGAAGCTTCAGTGTCGCACGAGTTTCGTAATTCTTCTCTATAGAACTGAGAAGCAGATTACGCACAATTTTGAGTCGCTATCTTGCACTTCCGTTCATGTTCCTTACAGTGTACACGTCTTCCTGAGTGTTGGCCTCCTCCGCACGGGACACGTCGTCTCTGCGAATTCCAACATGATAAGCTCATCCAAACCCTTCAGCGTCGCCTGTGGTAACGAGTCGTAGCGGCTCGTTCTACTGCGTGTCTCGGAATCAAAGGACTGACAAAAACTTCGAGAACCGCTTCCCCTTGAAGAGATGTCATGCAGTGCCGAGAGAGGCGGCATGGACACGAGAAGCGCGCGCCGTTCTCGGAATTCATTGTTGTCATATCTAGTCGAACATTCCTGGAACCATGGAAGCTTGTGATGGTCCTACGCGCTCGTTTAGATTACTTCAAGCAGTTGCATTGTCTCGAACAAAGTGTAGGGTCTGTTTCGGCTAGGAACGAGCAGCATTGCGAGCATTTGTTATTTCAAAGGGACGATTCCGACTAGAGAAATTCGCGTGCTGTTCTCGAATATTTGAGGTCTGCGTTGGATCAGGGGCTTCGTTGTCCGCGATGCAAGTGCTGCAACTTGACGCTTGGGAGGGAGAGTTATTATGTGCAAATGATTGACCTCGCAATGTGGTGTGTTTATTCTTTGTGATTCAGTGACTGAGCTCAACAAAGGCGACTCATCTCGGAACGTGGTGGAGATAATCTTTCGCACGAGTTGGCTGAAAAAGGAGCTGCCATGCGGGAAGATCGAGAGGATTCTCAAGGTGCACAACACGCAGAGAATCGTGGCGAAGTTCGAGGAGTATCGAGACGCTGTGAAGGCCAGAGCCGCGAAGATGACCAAAAAGCATCCGCGCTGCATGGCCGACGGAAATGAGCTGCTTCGATTCTACGGAACCTTCCTCCAATGTCAATTGGGAGCTCACGGAGCCTCGAATCTCTGCCTCATGCCCAACTGCCACTGCTGTCAGCTCATCAGATCAGGCTTCCACGCCAAGAAGGAGGCCGGGAGGGGCATCTACACCACCGCCACCAGCGGCAAGGCCCACGATTCCATTGCTCTTCCGGAGGACGATTTGAAGGGCAAACGAGCAATGCTCGTCTGCAGAGTCATCGCCGGCAGGACGCACAAGGCTCTCGACAACGAAGACCTGACATTTCTCCCCACCGGATACGACTCGATTGCCGGCGAGTCAGGCCCGTACGCCAACATCGACGAGCTTCTCGTGTTCAGCAGCAGAGCCGTGTTGCCCTGTTTTGTAGTTATTTACAAGCTTTGAAGAAAAGTCTTCCATCTCTCTCATAGGTGCTTTTTAATGTGGGATCGATGCCGACCGATCGTTCCCAGCACACACAAGATTAGATCGCAGTTTCTTTAGTCCTCCCACCGACATTAGTGACCTGCACAAATGGAATGAACGCCTAGGATAAGTGCACAGATTACTTGCCTTGCCATCCCCCTGCCCCGCCCCGGCCACCGACGGCTTCTCAGTACGATCTCTGTTCGAGCTCAGAAGATTCACTGGCTGTGGATATTTCGTATCTTCTGAAGTCTGATTGAAGTCTTGCGCAATTTGTAGTTCAGGAGAAATCGCCAGGCCTACTAGCTGCACGAGTCGGAATTTTGATCGCTAGTGCAGTAGCTCTGCAATCCATGATTACTGCCGCTGGTCTTCGAATTCTGCGGATTTCAGAACACGCCGAGTCGAAGATACAGCACTTGTAACGTTAATAGATTCATCAGGCAGGTTTGCCTCGCCGCTGACCTGGAATACTTGTTTTATAAAGCCTGTATCATGTTCTAGCTG

mRNA

>Mapoly0089s0067.1
TTGCTTTCTGTTTTTAGAAGATTGGATGATTAGGATTTCCACCTTGTGCGCCACCCTCTGCTCGCTCGCCCCTCTTTCTTTCTCTCTCTCACTCCTCGCTTTGCTTGTGACACTGATTAGAACGCGAGAGTCGGCTGCAAGGGTTCGAGTAATGCTGCTGGCAGCTGGGCTCAGCTTCCCGTGCCTCTTAATGCAAGCCCGGGCCTCCAGCACAGCAGCAGTAGCTTTGTAGTTCCTACGTCTTCTAGTCCGACGCCTCTCCTTCTCTTTCGCCTTTCTCTCTTCTCTCTTCTTCACTAGCCAGCCCCCGCTCCGTGAGAGCTGTAACACTCTTGCTAGATTTCCGACCCTGCAGGCCCCGCAGTGCGCTTCTGCTGTGTTCTGTTCAGAATCCGTCTGGAGTCGAAACTTTCATATTCCTCGGGAGAATCACCTTCGGCGTGAACTTGATAGGTTTCAGTCGAGGCGTGAACAGAAGCTGCTGCCCAAGGATTGTACTGTGGACTGAGATCTGGTCTGGGACCGGTGCTCCCGTGCGCTCCATGTGGCCCTCAAGTTTCAGTCTGATCGATTTGTAAGGATTCAGGAGTCGGGCTGACTTTCTCAACTTGAGAAATGCGGAAGACCGTGACATCCTTCCGGAACTGCTTCTGGTGATGATGTCGATGTCCATGCCATTATGTTCGCCGAGGATGCTGCTCTCACTCCGATTTGACGATCACGTTGGGCTGGCTCATGGAACTGTTGGGGATTGCACCAGTTTCGCCTGCCTGCTTGCCCCTTTATTGGAGGCCGAGAAGAGATAAAGCGCCGCCAAGTTTCGCTCTTCATTTCCCGGACAGACCGACTGACTCACTGACTGGCTGACTTCCGAGCAATTGATTGAGCTGGGCGACGGGGATGGCGTCCCTCGGTGTTCAATTGACGAGAAGACATCAGCAGCAGCCTGCAAACAATTTGCTCGGAGTTTCGTCCCGAACGTGAGCGTTTTGACTTCGGTTCGGTGGGAGACGCAGAGCATCTCTGGACAGAAAGGCGGACCGCTCAACTGCCTTGGGGTTTTTGTTTTTTAATCTCGTCGGGTGGCGTCCTTAGTACCCGACTCATGAATCAGGTCGACGACTGCTTGCACAGCTGACAGAGATTAGTCCCTAAGCCTGCGCAAGGTCTGTAGGACTAGCAGCAACAAATACGGGTCATCGCCGCCGCAAGGTAGAAGCGTAGCAGTGCGAGGATTCGTAGGGAGATTACCATGCCGAGTTCATGGACTTCATGGAAGAGAGCGCTGAGTTGCAAGACAGACCGAGACCAAGTCATTGAGCCTCACTCGATGATTCCGCCTTCTAGCAAGAGCTCAGTGGGGATGAAATCGAAAAAACACTACAGCGCAAGGAGCTGCTCGAGGTCTCTGCTAAGCCTCAGAGACGTCATACACGGGAACACTCGCGTGGTTCACAAACAATCGAGCCCCCGATCAGTGGCCACGAGTGACGATTGTCTGAGACAGGTGTCCCCAGATCTATCCTACTGCGACACCAGGAGCTCGAGCGGAGGAACCCCGTCCGAGGTGGGATCAGTGTTCGGGCGCAGCAATTCCAGGAGCGGCTCCCTGACCTCGACGCCGCTGTCTCACGCCAGCTATGTCTTCAAAGGAACCCCGCTCAGAAAGCTCTCGGGCTGCTATGATTGCAACATGGCCTACGAAACGCTGGATTCCATGCAGCTGGTGTATAGAGAAGGCTCGCTGCACGGTTCCTACTGTGGCTCGCCCAAGGCCGGGTGCCCGAAATGCGGAGAGACCTTCAGCAAAGCCGAGGCCTTGGAGGCACACCACATCTCTCAGCACGCAGTGACTGAGCTCAACAAAGGCGACTCATCTCGGAACGTGGTGGAGATAATCTTTCGCACGAGTTGGCTGAAAAAGGAGCTGCCATGCGGGAAGATCGAGAGGATTCTCAAGGTGCACAACACGCAGAGAATCGTGGCGAAGTTCGAGGAGTATCGAGACGCTGTGAAGGCCAGAGCCGCGAAGATGACCAAAAAGCATCCGCGCTGCATGGCCGACGGAAATGAGCTGCTTCGATTCTACGGAACCTTCCTCCAATGTCAATTGGGAGCTCACGGAGCCTCGAATCTCTGCCTCATGCCCAACTGCCACTGCTGTCAGCTCATCAGATCAGGCTTCCACGCCAAGAAGGAGGCCGGGAGGGGCATCTACACCACCGCCACCAGCGGCAAGGCCCACGATTCCATTGCTCTTCCGGAGGACGATTTGAAGGGCAAACGAGCAATGCTCGTCTGCAGAGTCATCGCCGGCAGGACGCACAAGGCTCTCGACAACGAAGACCTGACATTTCTCCCCACCGGATACGACTCGATTGCCGGCGAGTCAGGCCCGTACGCCAACATCGACGAGCTTCTCGTGTTCAGCAGCAGAGCCGTGTTGCCCTGTTTTGTAGTTATTTACAAGCTTTGAAGAAAAGTCTTCCATCTCTCTCATAGGTGCTTTTTAATGTGGGATCGATGCCGACCGATCGTTCCCAGCACACACAAGATTAGATCGCAGTTTCTTTAGTCCTCCCACCGACATTAGTGACCTGCACAAATGGAATGAACGCCTAGGATAAGTGCACAGATTACTTGCCTTGCCATCCCCCTGCCCCGCCCCGGCCACCGACGGCTTCTCAGTACGATCTCTGTTCGAGCTCAGAAGATTCACTGGCTGTGGATATTTCGTATCTTCTGAAGTCTGATTGAAGTCTTGCGCAATTTGTAGTTCAGGAGAAATCGCCAGGCCTACTAGCTGCACGAGTCGGAATTTTGATCGCTAGTGCAGTAGCTCTGCAATCCATGATTACTGCCGCTGGTCTTCGAATTCTGCGGATTTCAGAACACGCCGAGTCGAAGATACAGCACTTGTAACGTTAATAGATTCATCAGGCAGGTTTGCCTCGCCGCTGACCTGGAATACTTGTTTTATAAAGCCTGTATCATGTTCTAGCTG

CDS

>Mapoly0089s0067.1
ATGCCGAGTTCATGGACTTCATGGAAGAGAGCGCTGAGTTGCAAGACAGACCGAGACCAAGTCATTGAGCCTCACTCGATGATTCCGCCTTCTAGCAAGAGCTCAGTGGGGATGAAATCGAAAAAACACTACAGCGCAAGGAGCTGCTCGAGGTCTCTGCTAAGCCTCAGAGACGTCATACACGGGAACACTCGCGTGGTTCACAAACAATCGAGCCCCCGATCAGTGGCCACGAGTGACGATTGTCTGAGACAGGTGTCCCCAGATCTATCCTACTGCGACACCAGGAGCTCGAGCGGAGGAACCCCGTCCGAGGTGGGATCAGTGTTCGGGCGCAGCAATTCCAGGAGCGGCTCCCTGACCTCGACGCCGCTGTCTCACGCCAGCTATGTCTTCAAAGGAACCCCGCTCAGAAAGCTCTCGGGCTGCTATGATTGCAACATGGCCTACGAAACGCTGGATTCCATGCAGCTGGTGTATAGAGAAGGCTCGCTGCACGGTTCCTACTGTGGCTCGCCCAAGGCCGGGTGCCCGAAATGCGGAGAGACCTTCAGCAAAGCCGAGGCCTTGGAGGCACACCACATCTCTCAGCACGCAGTGACTGAGCTCAACAAAGGCGACTCATCTCGGAACGTGGTGGAGATAATCTTTCGCACGAGTTGGCTGAAAAAGGAGCTGCCATGCGGGAAGATCGAGAGGATTCTCAAGGTGCACAACACGCAGAGAATCGTGGCGAAGTTCGAGGAGTATCGAGACGCTGTGAAGGCCAGAGCCGCGAAGATGACCAAAAAGCATCCGCGCTGCATGGCCGACGGAAATGAGCTGCTTCGATTCTACGGAACCTTCCTCCAATGTCAATTGGGAGCTCACGGAGCCTCGAATCTCTGCCTCATGCCCAACTGCCACTGCTGTCAGCTCATCAGATCAGGCTTCCACGCCAAGAAGGAGGCCGGGAGGGGCATCTACACCACCGCCACCAGCGGCAAGGCCCACGATTCCATTGCTCTTCCGGAGGACGATTTGAAGGGCAAACGAGCAATGCTCGTCTGCAGAGTCATCGCCGGCAGGACGCACAAGGCTCTCGACAACGAAGACCTGACATTTCTCCCCACCGGATACGACTCGATTGCCGGCGAGTCAGGCCCGTACGCCAACATCGACGAGCTTCTCGTGTTCAGCAGCAGAGCCGTGTTGCCCTGTTTTGTAGTTATTTACAAGCTTTGA

Protein

>Mapoly0089s0067.1
MPSSWTSWKRALSCKTDRDQVIEPHSMIPPSSKSSVGMKSKKHYSARSCSRSLLSLRDVIHGNTRVVHKQSSPRSVATSDDCLRQVSPDLSYCDTRSSSGGTPSEVGSVFGRSNSRSGSLTSTPLSHASYVFKGTPLRKLSGCYDCNMAYETLDSMQLVYREGSLHGSYCGSPKAGCPKCGETFSKAEALEAHHISQHAVTELNKGDSSRNVVEIIFRTSWLKKELPCGKIERILKVHNTQRIVAKFEEYRDAVKARAAKMTKKHPRCMADGNELLRFYGTFLQCQLGAHGASNLCLMPNCHCCQLIRSGFHAKKEAGRGIYTTATSGKAHDSIALPEDDLKGKRAMLVCRVIAGRTHKALDNEDLTFLPTGYDSIAGESGPYANIDELLVFSSRAVLPCFVVIYKL

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>