Mapoly0090s0091



Description

MYB-LIKE DNA-BINDING PROTEIN MYB

Reference DB

Database ID Description
GO GO:0003682 Chromatin binding
OrthoMCL OG5_143094
PFAM PF00249 Myb-like DNA-binding domain
PANTHER PTHR10641 MYB-LIKE DNA-BINDING PROTEIN MYB
PANTHER PTHR10641:SF498

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
Mp1R-MYB17 transcription factor, MYB Mapoly0090s0091.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0090s0091.1 scaffold_90:827974..831294  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0090s0091.1  

Gene structure:

mRNA scaffold_90:827974..831294  ( + strand )
five_prime_UTR scaffold_90:827974..828851  ( + strand )
CDS scaffold_90:828852..828978  ( + strand )
CDS scaffold_90:830652..830842  ( + strand )
three_prime_UTR scaffold_90:830843..831294  ( + strand )

Sequences:

Gene

>Mapoly0090s0091.1
AGAAAAAACTCGGGCGCCGCTGCTGCTCATCCTCCAGCTTTTCTTTCTTTCGCTTTATTTGAAATCCCTAGGTTTTCTCCTTCCTCTTTCCTTGAGGGTTTACTCAAGTGCTTGCTGTTGCTGCCGCTGCTGTGTGAGCCGTGCCCCCTTCCCAACGGGTGAAGAAAAAAGGCAAGAGGAGGAGGGCCTGGATACTTGAGCCACTTTTTCTATTGCTTAAGTGTCTGCAGGCAGGAAAGGCTCTTATCCCCAGTCTTTTCCCATCTTTCCCTGTTAAACTCGTGACAGCAGTCTGTTAGATGTACAGAGTGGAGCGAGCAAGGACCTGAATTGCTGGCTGGCTGGCCTTCAACCTTTTCTCTTGCCTCTACTCGTTTCTCCTCCTCGTGAGACCAGGCTCGTCGCCTCGTCTGCTTAATCTCCTCGTCTGCATCTTCCTAGTTCTTCTTCTTATCTTTTCACGTTTCCATCTCATTTACCATCCGGACCAACCAGTTGTTGAAAGTTGTTCTTCTATCACTCCCTCCCTCCCGCCCACCACCCCTCATCCTCCCTCCTTCCGCTAACCAGCCCGCCAGCCAACCTGCGCGTGTGTGTCGGGCGAAACCTGCCGATTCACGCAATCCATCCAGTGCAGTCGGAGCTTCACTTGGCCCTTTAAGAGAGCACACAATCGTCTGAAGTACCTCACAACATACCTACTCGATTATAAGAGAGGGAGCTGAGGGCCTTCAGAAGCAGACACATACAAGCAAACATCACAGCAAGTACTCCAGAGCGACACAGAAATCTCGACTTACCGGTCGTGGACAGTTTGACCTTCGGGATCCTCTGCTGAGTGGCATAGATTTTTTCTTTGCCCACGCACAATCACAGAGATGGGAAGCACGGGCCACATGAAGAAGAAGAAAAGACCATGGACCCAGGACGAAGATGAACAACTTTGCAGATTTATGACCAACAACGATCAGGCGCTCTGCTGGGAGGAAGTTCCCAAGCTTGCAGGTTTGTTTTTCTCATCTATGTCATGTCGATCCTAGGTCGCCTGAATTTTTCCTTCGTACAATCAAGGCCCACTCTGTACTTGTCTCCTTCTCTGCGACGGTTGAATTGGTTTTTTTTCGGCGAGCGAGCCCTCTGCCGACGGCACGCAAGGGCTCGTACAGATGGTCTACCGTGCTCCATGATGACCGTCGCTTCACGATATCAATCGCTGCACGGTCCTTGCAGCGCAATTTACCGGCCTTGCAACAGGCGTTACGACGTTTCTGTTACTGTCTGGATCCCCCGAAACGAACATGTTCTCCCGATCATGTTACCCATGCGATTTACCCTCGTGCTTAGTGTGAATCGCTCCCAAGTCTTTCTGCTGAAATTCTCTTGCCAGCTCCAGCAGTTTTACCGTCCGTTCCTGACCGGCCTGCCAGATGAATTAGAGGGCATCGAGAGGCAGCCTGGATTGAACAAGCTTTCGCCCAGATTTTTTTGTGAGCATAGAATGCTGCAGATACGATGTGTCCCTTTCCCTTAGTAAACTGAACATATGCTACCCAGTTCAAGACTAGCTCAGAACTCTGACTTGTACTTTTAGGGATATAATGTGTTCTATTTAGAGGGTGAACATGTCCCGTAGATCTCCATTGGAGCCTGCTTGTTCCATTATTGAGCTCTGCGCTGCGGCTTCCATCCCGAGGTGTTAAAGCTCTCTTGCTTGGGTTGCAACGGACGAGAAATCCAGTGAAATTCCGGGATGTGCAGGATTTTAGCCGCACTACAGCAGATTAATTAAAGATTGAGCTATCATTGAATGGAATGCTTCCGCGAGGTTGGCCTGGCACTGTAGATGGGGAGTCGTCAGTTATCGCTCAGAGAGCTGCTGTGACAAAAAAGACAGTGCGTAGGTACACTCACACGGGGGTGCTATTTTTTGTTCTGACTCGGGTCAGAAGAGCCACATTTCTAACACGGTGCTGGACTCTAGTTGGTGATGTGTACCGCTCCCGTTGCCTTTGCATGCTATCACATGTGTACGCTATATCTAAAGTAATTAGCCTCTGCACCAACGGTAGCGAGTTGCAATTCAGCTACCTCGTCAACTCTCTTGGGAATTGTCACAGGTTATGACGGGCAGTTTTCAACGCATAAATTTTACATGCTGAAATTGGCGTGCCGGCTGCACAGAAAATCGTGCAACAATTAGTTTCCCCGTCGTGAAGTCGCACGTGCGACATCGACATCTCACAATTTTTTTCGCTCTAAGTGGGGAATGCGCTCTCAGGAGTGTTATTGTCCTTATCTCTTCGAAAGGTCCCTCGGTTTCATATGTGTCGAATAGCTTCACTTCACAGGTGGAGACTGAAATATGCACTGGAAAGACATCCTTCCGCTTTCTCCATCTCGATTGTTCACAATTCTAACTAACGCTGCCTCACGGCCCGATTCAGGAGAATATTGCTCGCATCCGTCGAGGGTCATGAAAGGCATGTAGATGCCTAGAGCTTGTACCTGTAGCTTGGATCTTAGTCTTGGCAGTTGCTTCCTTCAGCAGTAGAGCACTGACTGCTTCGCAATGATTGACAAATTCTAATCATGTTCGAATCTGAAATTGTATCTGATACAGCACAAATTCGCATTCTTGATACGTATCTTGACGGGGAGCTTATTTGTTGAATGCGCAGGACTCTTAAGAAGTGGTAAAAGCTGTCGAACGCGTTGGAACTATTTACGGCCACGAGCTCGAGAGTTTATGGGCCTGGAGCTCTTCGGTCAGTGGGGCGAAATGTCGGACGAAGTCGATCAACCGATGTCTGATGAATCAGATGAGACGAAATCCTACTACGACGATGACGAACAATCAGCCGAGAGCTGACTGTCAGCTAGATGTGGGAGTTGAAACCTCTGACCGTTCGAATTGAATGCATCTATAAGACATGTACACCACATTTCCCTCAGCGCGGGGAGAAGTAGAACCTTGAGGTCCAGAGAAAATGCTGACCAAACAGTCCAATCAGCTGGTGCGGGCCCATTAGTCATACTTAGGAAGTAGAAACTATACTGTTTTGTCAAGGGTAGCGGCAAAGATGAAGATCTTGCTGCGTTTAGTACAGATAGGTAGATAAATCCAAGGGGCTCGGGCTGTAAGTTCTCTCGTCTCTACAGTTCACACTATTTTTGCTCTCATATGAAAAGCTTCATATGGGCGAGAGTTCAACTTTCTTCCTTGGATTACTAGCCTAGCATAATAGCTTTAGTTATCAGATAGAAAGCACCTCCTCAGCTCATTGTTACACTGTATGTAATTGCGGCGGAGTAAACAGCGCT

mRNA

>Mapoly0090s0091.1
AGAAAAAACTCGGGCGCCGCTGCTGCTCATCCTCCAGCTTTTCTTTCTTTCGCTTTATTTGAAATCCCTAGGTTTTCTCCTTCCTCTTTCCTTGAGGGTTTACTCAAGTGCTTGCTGTTGCTGCCGCTGCTGTGTGAGCCGTGCCCCCTTCCCAACGGGTGAAGAAAAAAGGCAAGAGGAGGAGGGCCTGGATACTTGAGCCACTTTTTCTATTGCTTAAGTGTCTGCAGGCAGGAAAGGCTCTTATCCCCAGTCTTTTCCCATCTTTCCCTGTTAAACTCGTGACAGCAGTCTGTTAGATGTACAGAGTGGAGCGAGCAAGGACCTGAATTGCTGGCTGGCTGGCCTTCAACCTTTTCTCTTGCCTCTACTCGTTTCTCCTCCTCGTGAGACCAGGCTCGTCGCCTCGTCTGCTTAATCTCCTCGTCTGCATCTTCCTAGTTCTTCTTCTTATCTTTTCACGTTTCCATCTCATTTACCATCCGGACCAACCAGTTGTTGAAAGTTGTTCTTCTATCACTCCCTCCCTCCCGCCCACCACCCCTCATCCTCCCTCCTTCCGCTAACCAGCCCGCCAGCCAACCTGCGCGTGTGTGTCGGGCGAAACCTGCCGATTCACGCAATCCATCCAGTGCAGTCGGAGCTTCACTTGGCCCTTTAAGAGAGCACACAATCGTCTGAAGTACCTCACAACATACCTACTCGATTATAAGAGAGGGAGCTGAGGGCCTTCAGAAGCAGACACATACAAGCAAACATCACAGCAAGTACTCCAGAGCGACACAGAAATCTCGACTTACCGGTCGTGGACAGTTTGACCTTCGGGATCCTCTGCTGAGTGGCATAGATTTTTTCTTTGCCCACGCACAATCACAGAGATGGGAAGCACGGGCCACATGAAGAAGAAGAAAAGACCATGGACCCAGGACGAAGATGAACAACTTTGCAGATTTATGACCAACAACGATCAGGCGCTCTGCTGGGAGGAAGTTCCCAAGCTTGCAGGACTCTTAAGAAGTGGTAAAAGCTGTCGAACGCGTTGGAACTATTTACGGCCACGAGCTCGAGAGTTTATGGGCCTGGAGCTCTTCGGTCAGTGGGGCGAAATGTCGGACGAAGTCGATCAACCGATGTCTGATGAATCAGATGAGACGAAATCCTACTACGACGATGACGAACAATCAGCCGAGAGCTGACTGTCAGCTAGATGTGGGAGTTGAAACCTCTGACCGTTCGAATTGAATGCATCTATAAGACATGTACACCACATTTCCCTCAGCGCGGGGAGAAGTAGAACCTTGAGGTCCAGAGAAAATGCTGACCAAACAGTCCAATCAGCTGGTGCGGGCCCATTAGTCATACTTAGGAAGTAGAAACTATACTGTTTTGTCAAGGGTAGCGGCAAAGATGAAGATCTTGCTGCGTTTAGTACAGATAGGTAGATAAATCCAAGGGGCTCGGGCTGTAAGTTCTCTCGTCTCTACAGTTCACACTATTTTTGCTCTCATATGAAAAGCTTCATATGGGCGAGAGTTCAACTTTCTTCCTTGGATTACTAGCCTAGCATAATAGCTTTAGTTATCAGATAGAAAGCACCTCCTCAGCTCATTGTTACACTGTATGTAATTGCGGCGGAGTAAACAGCGCT

CDS

>Mapoly0090s0091.1
ATGGGAAGCACGGGCCACATGAAGAAGAAGAAAAGACCATGGACCCAGGACGAAGATGAACAACTTTGCAGATTTATGACCAACAACGATCAGGCGCTCTGCTGGGAGGAAGTTCCCAAGCTTGCAGGACTCTTAAGAAGTGGTAAAAGCTGTCGAACGCGTTGGAACTATTTACGGCCACGAGCTCGAGAGTTTATGGGCCTGGAGCTCTTCGGTCAGTGGGGCGAAATGTCGGACGAAGTCGATCAACCGATGTCTGATGAATCAGATGAGACGAAATCCTACTACGACGATGACGAACAATCAGCCGAGAGCTGA

Protein

>Mapoly0090s0091.1
MGSTGHMKKKKRPWTQDEDEQLCRFMTNNDQALCWEEVPKLAGLLRSGKSCRTRWNYLRPRAREFMGLELFGQWGEMSDEVDQPMSDESDETKSYYDDDEQSAES

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>