Mapoly0092s0004



Description

MYB-LIKE DNA-BINDING PROTEIN MYB

Reference DB

Database ID Description
GO GO:0003682 Chromatin binding
OrthoMCL OG5_127030
PFAM PF00249 Myb-like DNA-binding domain
PANTHER PTHR10641 MYB-LIKE DNA-BINDING PROTEIN MYB
PANTHER PTHR10641:SF221

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
Mp1R-MYB19 transcription factor, MYB Mapoly0092s0004.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0092s0004.1 scaffold_92:13307..14346  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0092s0004.1  

Gene structure:

mRNA scaffold_92:13307..14346  ( - strand )
three_prime_UTR scaffold_92:13307..13629  ( - strand )
CDS scaffold_92:13630..14137  ( - strand )
CDS scaffold_92:14218..14285  ( - strand )
five_prime_UTR scaffold_92:14286..14346  ( - strand )

Sequences:

Gene

>Mapoly0092s0004.1
ATGGTGCAATCATCTTCATCCCCAGACCAAGAAAGAACCCTGGAGTGAAGACGAAGACCTGATGTTGTTTTTGGGTCACCAAAAGTTCGGCAACAGATGGGCGGAGATCACAAAGCTTCTTCCTGGGAGGTAAAGTCATTGTATTTGATGAAACCTGTATTACAAAGGCTCTCTGGCAATTTCCTCATCTAATTGTAGACAATTATCAGGTCCAGCAATGGTATCAAGAACAGGTGGAACAAGACAATGACAAAAAGGGCTGACGCAATGGAGGATTACAGTGAGAAGTGGATCAATAGGAACACATTTGGAGATATGTTGTCCCTTACCGACGATGTGAATCCAAAAGAACTTGAAGCTTCTCAAGATCTTCTAGCTTTGAATGGACAAGCAAATATCGACCTTCAGGCCTCGAATGCTGCGGAGGATCTTCTAGCATTGAATGGACAGGCAAATATCGACCTTCAGGACTCGAATGCGGCGGAGGATCTTCTAGCATTGAATGGACAGGCAAATATCGACCTTCAGGACTCGAATGCTGCGGAGGATCTTCTAGCATTGAATGGACAGGCAAACATCGATCTTCAGGACTCGAATGCTGCGGAGCATCTTCTAGCATTGAATGGACAGGTAAATATCTACCTTCAGGACTCGAATGCTGCGGAGGACCTTCTGGCATTGAACAGCGACTTCGGACTCGCTGTTGGGAGCCGATGAGTTTGACATGAGTGTCGAGACTTTGACTTCTCTCTTTAATGGCAACTTTTTTACACGTAATTCTCAAAGGGCCATGTAATTGTCATAGTCGCTCGTGGGTTGTATGGGTTTGAAGAGGGTCGGTTAGAGAAGCCGTGATTCTGACTTGCTTTACATCGAGACTTTATAAGTTTTATTATGGTGTAAGAGTGTACCAAGCTTGCAATTAGTTTATTACAATTACACTCATACTTTTTCTCCTGTTTATTGTATATTTTAGAAACTCAAATGCACATAATGTTCCAATACTGTAGACTGTCATGACAGTTTATGTTTTCCTCAAG

mRNA

>Mapoly0092s0004.1
ATGGTGCAATCATCTTCATCCCCAGACCAAGAAAGAACCCTGGAGTGAAGACGAAGACCTGATGTTGTTTTTGGGTCACCAAAAGTTCGGCAACAGATGGGCGGAGATCACAAAGCTTCTTCCTGGGAGGTCCAGCAATGGTATCAAGAACAGGTGGAACAAGACAATGACAAAAAGGGCTGACGCAATGGAGGATTACAGTGAGAAGTGGATCAATAGGAACACATTTGGAGATATGTTGTCCCTTACCGACGATGTGAATCCAAAAGAACTTGAAGCTTCTCAAGATCTTCTAGCTTTGAATGGACAAGCAAATATCGACCTTCAGGCCTCGAATGCTGCGGAGGATCTTCTAGCATTGAATGGACAGGCAAATATCGACCTTCAGGACTCGAATGCGGCGGAGGATCTTCTAGCATTGAATGGACAGGCAAATATCGACCTTCAGGACTCGAATGCTGCGGAGGATCTTCTAGCATTGAATGGACAGGCAAACATCGATCTTCAGGACTCGAATGCTGCGGAGCATCTTCTAGCATTGAATGGACAGGTAAATATCTACCTTCAGGACTCGAATGCTGCGGAGGACCTTCTGGCATTGAACAGCGACTTCGGACTCGCTGTTGGGAGCCGATGAGTTTGACATGAGTGTCGAGACTTTGACTTCTCTCTTTAATGGCAACTTTTTTACACGTAATTCTCAAAGGGCCATGTAATTGTCATAGTCGCTCGTGGGTTGTATGGGTTTGAAGAGGGTCGGTTAGAGAAGCCGTGATTCTGACTTGCTTTACATCGAGACTTTATAAGTTTTATTATGGTGTAAGAGTGTACCAAGCTTGCAATTAGTTTATTACAATTACACTCATACTTTTTCTCCTGTTTATTGTATATTTTAGAAACTCAAATGCACATAATGTTCCAATACTGTAGACTGTCATGACAGTTTATGTTTTCCTCAAG

CDS

>Mapoly0092s0004.1
ATGTTGTTTTTGGGTCACCAAAAGTTCGGCAACAGATGGGCGGAGATCACAAAGCTTCTTCCTGGGAGGTCCAGCAATGGTATCAAGAACAGGTGGAACAAGACAATGACAAAAAGGGCTGACGCAATGGAGGATTACAGTGAGAAGTGGATCAATAGGAACACATTTGGAGATATGTTGTCCCTTACCGACGATGTGAATCCAAAAGAACTTGAAGCTTCTCAAGATCTTCTAGCTTTGAATGGACAAGCAAATATCGACCTTCAGGCCTCGAATGCTGCGGAGGATCTTCTAGCATTGAATGGACAGGCAAATATCGACCTTCAGGACTCGAATGCGGCGGAGGATCTTCTAGCATTGAATGGACAGGCAAATATCGACCTTCAGGACTCGAATGCTGCGGAGGATCTTCTAGCATTGAATGGACAGGCAAACATCGATCTTCAGGACTCGAATGCTGCGGAGCATCTTCTAGCATTGAATGGACAGGTAAATATCTACCTTCAGGACTCGAATGCTGCGGAGGACCTTCTGGCATTGAACAGCGACTTCGGACTCGCTGTTGGGAGCCGATGA

Protein

>Mapoly0092s0004.1
MLFLGHQKFGNRWAEITKLLPGRSSNGIKNRWNKTMTKRADAMEDYSEKWINRNTFGDMLSLTDDVNPKELEASQDLLALNGQANIDLQASNAAEDLLALNGQANIDLQDSNAAEDLLALNGQANIDLQDSNAAEDLLALNGQANIDLQDSNAAEHLLALNGQVNIYLQDSNAAEDLLALNSDFGLAVGSR

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>