Mapoly0097s0062



Description

Protein of unknown function DUF260

Reference DB

Database ID Description
OrthoMCL OG5_177475
PFAM PF03195 Protein of unknown function DUF260
PANTHER PTHR31301 FAMILY NOT NAMED

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpASLBD13 transcription factor, ASL/LBD Mapoly0097s0062.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0097s0062.1 scaffold_97:541783..542874  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0097s0062.1  

Gene structure:

mRNA scaffold_97:541783..542874  ( - strand )
three_prime_UTR scaffold_97:541783..542002  ( - strand )
CDS scaffold_97:542003..542036  ( - strand )
CDS scaffold_97:542443..542846  ( - strand )
five_prime_UTR scaffold_97:542847..542874  ( - strand )

Sequences:

Gene

>Mapoly0097s0062.1
CGCAGACGAGGTTTATCGTCGATGACCGATGGAGCCAAGGAAGAAACAGAGACCTAGTCTCTTTACTTGCGAAGCCTGCAAATTTCTTCGCAAGAAGTGCACGTACGACTGTCCATTAGCGCCACACTTTCCTGCAGATGGACCCTTAAGGTATCCAATAGTGCACACAATTTTGGGGCGCCATAATGTCACCAAGATTTTGCAAAACTTGCCGGAGTTGAGCCGAGCGGATGCAGCAACGACGTTGTATCTCGAGGCCGAGGCAAGGATTAAGGATCCGGTTTGCGGATGCTCTGGCGAAATTTACAGAACCGAGAAAAGGATTACGGAGCTCCAAGCAGAAATTTACAGAGCCGAGAAAAGGATTACGGAGCTGATGCAGCGTATAGACATTTTGGAGGAGAAGATTCGCAAGAGACCGAATGAGGAGGGGTGAGAGTTTTACCGCACACTTCCTGAACAGTATAGAGAATATTCTTCTGGGACTTTGCTAGCTGCTGAATTCTGCCTGAACTTTTGAGATTGCGAGTTGTTGTATTACGCTTGAAATGGCCAGGAGGGTTACCGAAGCACGCATGGAGCTCGGTGATATTCTTTGCCTGGGTTACCGAAGCACGCATGGAGCTCGGTGATATTCTTTGCCTGTCTCATCGTGTCTACAGATCACCATTGACGAAAGTTATTTTTTGTTGTTTCATACTTACAGCGACTGAGATCAAACGAGGCTCACGGTTGAGGTTCATGTGATCGCAGTCCCTGTTAGTCTGATAGAACAAAAAGGCCCGTTTGATTGGAATACCACCAATCTCTAACTGTGCATGTGGTGATGATGTTGCAGGATGGTGGCTGTCACCTTGCAGCTCTTCACGTAAAATTTCTTCAGATAGATCAGAATGGATTTTTAGCTCGTTGCCAGTCTCGAACAATCTTAGAGAGACATAAACCATTGAGGAAGAGTGACTCAACCTCCTGATCTGTACCTCCTTGTTCGAGGTCTTCCTTCCTCGCACATAAACTATTTCCTTATAGAATTCATGGTCGCATGATTGTCATTCTCTAATTCTCGTTTTCTCAATATAATTTTGCTTCTTT

mRNA

>Mapoly0097s0062.1
CGCAGACGAGGTTTATCGTCGATGACCGATGGAGCCAAGGAAGAAACAGAGACCTAGTCTCTTTACTTGCGAAGCCTGCAAATTTCTTCGCAAGAAGTGCACGTACGACTGTCCATTAGCGCCACACTTTCCTGCAGATGGACCCTTAAGGTATCCAATAGTGCACACAATTTTGGGGCGCCATAATGTCACCAAGATTTTGCAAAACTTGCCGGAGTTGAGCCGAGCGGATGCAGCAACGACGTTGTATCTCGAGGCCGAGGCAAGGATTAAGGATCCGGTTTGCGGATGCTCTGGCGAAATTTACAGAACCGAGAAAAGGATTACGGAGCTCCAAGCAGAAATTTACAGAGCCGAGAAAAGGATTACGGAGCTGATGCAGCGTATAGACATTTTGGAGGAGAAGATTCGCAAGAGACCGAATGAGGAGGGGATGGTGGCTGTCACCTTGCAGCTCTTCACGTAAAATTTCTTCAGATAGATCAGAATGGATTTTTAGCTCGTTGCCAGTCTCGAACAATCTTAGAGAGACATAAACCATTGAGGAAGAGTGACTCAACCTCCTGATCTGTACCTCCTTGTTCGAGGTCTTCCTTCCTCGCACATAAACTATTTCCTTATAGAATTCATGGTCGCATGATTGTCATTCTCTAATTCTCGTTTTCTCAATATAATTTTGCTTCTTT

CDS

>Mapoly0097s0062.1
ATGGAGCCAAGGAAGAAACAGAGACCTAGTCTCTTTACTTGCGAAGCCTGCAAATTTCTTCGCAAGAAGTGCACGTACGACTGTCCATTAGCGCCACACTTTCCTGCAGATGGACCCTTAAGGTATCCAATAGTGCACACAATTTTGGGGCGCCATAATGTCACCAAGATTTTGCAAAACTTGCCGGAGTTGAGCCGAGCGGATGCAGCAACGACGTTGTATCTCGAGGCCGAGGCAAGGATTAAGGATCCGGTTTGCGGATGCTCTGGCGAAATTTACAGAACCGAGAAAAGGATTACGGAGCTCCAAGCAGAAATTTACAGAGCCGAGAAAAGGATTACGGAGCTGATGCAGCGTATAGACATTTTGGAGGAGAAGATTCGCAAGAGACCGAATGAGGAGGGGATGGTGGCTGTCACCTTGCAGCTCTTCACGTAA

Protein

>Mapoly0097s0062.1
MEPRKKQRPSLFTCEACKFLRKKCTYDCPLAPHFPADGPLRYPIVHTILGRHNVTKILQNLPELSRADAATTLYLEAEARIKDPVCGCSGEIYRTEKRITELQAEIYRAEKRITELMQRIDILEEKIRKRPNEEGMVAVTLQLFT

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>