Mapoly0102s0028



Description

Domain of unknown function (DUF296)

Reference DB

Database ID Description
OrthoMCL OG5_137076
PFAM PF03479 Domain of unknown function (DUF296)
PANTHER PTHR31100 FAMILY NOT NAMED

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpATHOOK1 transcription factor, AThook Mapoly0102s0028.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0102s0028.1 scaffold_102:420823..425237  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0102s0028.1  

Gene structure:

mRNA scaffold_102:420823..425237  ( + strand )
five_prime_UTR scaffold_102:420823..422295  ( + strand )
CDS scaffold_102:422296..423111  ( + strand )
three_prime_UTR scaffold_102:423112..425237  ( + strand )

Sequences:

Gene

>Mapoly0102s0028.1
CTGAGCCTGCTGCTGCTCTAGTCTCTCTCCTCTCTCTTCGGCTTCGCTTACCGAGGCCCAGCGAGGGAAGGAGCTAGCTAGACAGACCAGAAGCAGACTTCTTTCACCTCATCATCACTTGGGGGTTTGCTGCCTGCCCCTACACTTTCACAAGTTTCCGTTTCTCCCTCTCCCTCTCATCTCTTCATCGCTCGCTCGCACTACTCTCTTCTCTTGTTCTCCTTAGCTCCGGTCTTTGGCACTCCTGTCTCCTTTCCGCTTCTCACTTCAGCGGGCTCTGAGTGAGCGAGTGCGTGTGCTTGTGCGTGAGCGAGCGAGCGAGCGAGCGAGAGCGCTGGCTTGCTTCCTTGCTTCTTCCTTTTCCCTCTTCCCTCTTGACTTACTCGCTCACCTCCTCCCTTCGAGTCGAGTCGTAAGGAGCAGGCGATTGGGGCGAGTTCACGCTAAGTGTCCAACGCTTCCCTTGTCCACTTTTATTCTGCTCGGTGCGGGAGCGAGAGGGAGACAGTGCGAGAGACAGTGAGAGGGAGGGAGGGAGGGAGGGAGAGAGTGACAGAGAGAGAGAGAGTGTGCGTTCTCGTGTGGTGTTGTGGGGGGTGTTGTGGGGGAGGAGGGTGCCGGGGGCGGAATTGTCCTCAATGGATTGAGAGAATCGGAGATTTCCCTGTCGCCTCATTCTTTTTGGGATTCGCTCGCGCTGCCAGCGGACGGGTGGGCGGTGAGACGACGTGATAGAGCGGGCGCTCACGTGAATGATTTCGGGCGAGCTCGTATCCGGCTACTGAGCACGGAGCAATGCGTTTTTGGGGGTCCAGGAACAAGTCAGAGGAATTGTGTATGTCATCGAGAGGGGATATCTAGAGTTTATAATCCGACGTAATATATTATCGCTCGCTCGCTCGCTGCCGCTGCTGCCTGTGCTGCGCGCCTCGCATGTCGATTGGGCCCGAGCAGCAGCAACGACGTGGGGGAGGAGGATTTATGGTCTAGTCCGCGCCTCGGCTGGACCCGCCAGGGAGTCGGTGCGTCGCAGCAAATTTTGACATTGGAAGCTATCGAGCGCCGCGGATTAGATCTTCCGACCTGCGGCCCGGCGGAACGATCTCGCACTCCAGCAGCCGCAGCAGCTGGTCACGTGCGCCATCGGGCTCATGTGATAGACACAAGATCCAGCGGAGGGGCACGGATGGAAATTGAGTTCTGGAGCACCCCGATGTGAATTCACAGGCTTCGCAACGCAACGCAACGCAGCTCTCCACTTGCGCGCGGCTCTCTCTCTCTCTCTCTCTCCCTCTCGTCCCGACTCGACCCGACGACGACGACGCGACGACGAGGGTCATCAGCGAGCGCGAGCCTTATGTGAATCGGGTGATCGAACAGATTGGGGAGTAGAGGAGGCGGGGGAGGAAAATTAGCCAGGGGTTATACACAGCAGTCACAACGGCCAAGGTCGCCCGAGGTGGGTATGTGTACATGGCGGGGGTGGATCATGCCACCGGTATCCCTCATGGCCACGACCAAAATCAATCGATGCATCCGCGCGATCAGCAACCGCACACGTCCGAGGACGAGAACAGCGGCAGCAGCGGACCTGGCAGAGGGAAGAAGCGAGGCAAGATTGAGGGGAAGCCTGGCGGGCCGCCTGTGGGGCAGGAGGGCACAGGGGGGCGCAAGCCGCGCGGTAGGCCACCAGGATCGAAAAATAAGCCCAAGCCCCCAATCTACATAACGCGCGACACCGGCAGCGGCATGAGGCCGCATGTGCTCGAGGTGCAAGGGGGCAGCGACGTCGGGGAGAGCGTCGCGGCCTTCGCCCGGAGGCGGGGGCGCGGCGTGTGCGTGCTCGGGGGCAGCGGCACGGTGGCCAACGTCACGCTCCGGCAGCCGGCGGCCCCCGGCGCCACCGTGACCTTCCATGGCCGCTTCGACATTCTGTCGCTGTCGGGCGCGTTTCTGCCCCCGCCGGCGCCGACGAGCGCCGCGGGGCTGACCATCGCGCTGGCCGGGGCCGCCGGGCAGGTCGTGGGGGGCACGGTGGTGGGGGGCCTGCAGGCCGCAGGCCCCGTGCTGGTGATCGCGGCGTCGTTCCAGGGCGCGACGTTCGACCGATTGCCGCTGCCGGACGAGGGCGACGACGGGCAAGGCCATCCCCAAATTACGCAGGGGTCCGAGTACGGCGGTGCGCTGTATAGTGTGAACCCGCAGATGGGTGTCAGTGCATGCCAACTCACGAGTTCGGACGTGAATGTGATGTCCTGGGCCACCGCTCCACGCCCTCCTCCCTACTGAAGAAACGAAAAGTCATTGCTTTGCTCGCCTCCTACCAAGGTCACGCTCGAGTTGTCCTCGACGTCCCCATGCCAGACAGGAGATGGAGATTTGTTCATCAGGGCCCATGCATTGAAACTCCTGCAAGTTTATCATAGACGGCATCAATTCACCCGCTCTCGACTCGACACTGGTTCTCTCTCAGGCTAGGGATGCACATGCAGGCAGGCAGGCAGGCAGGCAGGCAGGCAGTTGCGTGTCGCCGCAGCAGCAGCTGCAGCTGTGTTCTTTTCGTTTCTTCTCCCCCGACGAGCCAGCCACAGCCACAGCCACCGCACCGCACAGCCAGCAGCAGCCGCAGCAGCAGCAGCAGCAGCCCGCCCCACTGTTGTAGTACGCGCCAGGACGACACATTTGGATTGATCTGTACAATATAGAGCAGCGGCCATCTCTCACTTTCACGGTTGTGACGTCCTGCCATTCATCAACCGACCGCTCGCCTCGCTTCGCCTCACGAGTGCGACGCCACAAGCTGAGAGTCTTTCATGGGAGGTTTGAACTTGATTGTGATCACCCTCCCCTTTCCCCTTTCCCACCCTTCCTTAACTTCCGCTTGTCCGTCCTCTATTTTTCTTTTTATTTTTCACTTCCCTTACTTCCCACATCATCTTCTTGACAAACACCACCGATATCGTCATTCCATTCGCCTTCCTCCGTCTCCGACTCCATCTCCACCTCCATTCTACGCTGCGTATACCCTCCTGTCCTGTCCTGACCTGCCCTCGCCTTCCCTTGCCTTGCCTTCCCGTCCGTTTAATTGCTCCATCCCCGTCTCCCTCTCCCTCTCCCCCTCCCTATTTCTGTCTGTCTGCCTCGGGCACACACGCACGTAACTAGGAATGTGGCATCGTAAAGCAGTCAAGTAAATGTAGCAGAAATCGAGAGATAGTACAGTAGATGTGCTGGTCAGGTTTGGCATGGCATAAAGTGCAGTTACGCCCAATTTTTCATTGTTCTTCCTCTCGCTCTTCTGAAGCTGATGCAGCACAGCAACACTTTTATGAACAGGAAGGATGCGCCTGCATTAGTCGGACGACTGAGAGCAAAGCAGGGGATGTAAGGATCAGCTTAATGTAAGGAATTTGCTCGAGTCAAACCGCTCGGTTTGTTGGGTGTGTCTGTGATGGGCGTATGAAGTTTCGACCGGGGCTTGATTCATTATCCCTCAAATAAGCACAAATAAAGCGAAGGACGGCATTGGCGCCCGGCGCCCGCTGCTGCTCGTCGCTTTACCCGGAGAGGAGGGAGGGGGAGAGAGGCGGGACTAAATGTTTGTCAAGTGGGACCTCAGGATCAGATGTAATTCATAGAGCAGTAAAGTAGCAGAAATCATCATCATCATCATCATCATCAGAAATAAAAGGAGATGCGGATTAAAGCATCTATATTTCGAAGCCCTGAGACTGCAGTTTGGTCGGTCCAAACTCCACAATCTCCGTGTCTCTCCGCTCCTTCGATCCTCTCTCGCCCCGTCTCATCCTCCCGCCCAATTCCCCTCGTCTTTTTTCTTTTCTTTTCTGCTCTCCTCTCCTCTCCTCTCCTCTCCTCCCATCTCCCTGTGTCTGCGTAGATCCTGAGGCGGTGTCCCTGTGGGTGGAAGTGAAGGTCCGGTCGCTACTCTACCTGTGCATGGTCTCTCGTCCTCTCCTCGTTCAATCCACTCGTGTGCGTTCTGGTGCTCGAACCATCCATCCCGAGAGGTCTGTCTGAACTCATGCCGTCTGCAACAATGAGGCAGCCATGTGAACACTTCGAGTAGTTGAAATTGTGATTGCTTTATTTACACTAACTTCAGCCGCTTCCCCACCAGCAGGAGTGGTGATCGGGGGTAATGTCATACTTTCGATACTTTTAATAATCGTTTACTTGGAAATTTCAGCCTCTGTGCTATTTTTGCTTTCGAATCCGTGCGCGTCTCATGTTGAATGCTAGATTTTTCCTTCTCGTTCGCCTCCGCCGCTTGAATTTCGTCCGAGTTGAATTCCTTCTTATTTTTGACGATTGCAATTCCGCTACTGGGACGATTTCAATCGCGTGCACAAACGGACCGGACCGGACCAGACCGGACCAGACCAGACCAGGCCAGG

mRNA

>Mapoly0102s0028.1
CTGAGCCTGCTGCTGCTCTAGTCTCTCTCCTCTCTCTTCGGCTTCGCTTACCGAGGCCCAGCGAGGGAAGGAGCTAGCTAGACAGACCAGAAGCAGACTTCTTTCACCTCATCATCACTTGGGGGTTTGCTGCCTGCCCCTACACTTTCACAAGTTTCCGTTTCTCCCTCTCCCTCTCATCTCTTCATCGCTCGCTCGCACTACTCTCTTCTCTTGTTCTCCTTAGCTCCGGTCTTTGGCACTCCTGTCTCCTTTCCGCTTCTCACTTCAGCGGGCTCTGAGTGAGCGAGTGCGTGTGCTTGTGCGTGAGCGAGCGAGCGAGCGAGCGAGAGCGCTGGCTTGCTTCCTTGCTTCTTCCTTTTCCCTCTTCCCTCTTGACTTACTCGCTCACCTCCTCCCTTCGAGTCGAGTCGTAAGGAGCAGGCGATTGGGGCGAGTTCACGCTAAGTGTCCAACGCTTCCCTTGTCCACTTTTATTCTGCTCGGTGCGGGAGCGAGAGGGAGACAGTGCGAGAGACAGTGAGAGGGAGGGAGGGAGGGAGGGAGAGAGTGACAGAGAGAGAGAGAGTGTGCGTTCTCGTGTGGTGTTGTGGGGGGTGTTGTGGGGGAGGAGGGTGCCGGGGGCGGAATTGTCCTCAATGGATTGAGAGAATCGGAGATTTCCCTGTCGCCTCATTCTTTTTGGGATTCGCTCGCGCTGCCAGCGGACGGGTGGGCGGTGAGACGACGTGATAGAGCGGGCGCTCACGTGAATGATTTCGGGCGAGCTCGTATCCGGCTACTGAGCACGGAGCAATGCGTTTTTGGGGGTCCAGGAACAAGTCAGAGGAATTGTGTATGTCATCGAGAGGGGATATCTAGAGTTTATAATCCGACGTAATATATTATCGCTCGCTCGCTCGCTGCCGCTGCTGCCTGTGCTGCGCGCCTCGCATGTCGATTGGGCCCGAGCAGCAGCAACGACGTGGGGGAGGAGGATTTATGGTCTAGTCCGCGCCTCGGCTGGACCCGCCAGGGAGTCGGTGCGTCGCAGCAAATTTTGACATTGGAAGCTATCGAGCGCCGCGGATTAGATCTTCCGACCTGCGGCCCGGCGGAACGATCTCGCACTCCAGCAGCCGCAGCAGCTGGTCACGTGCGCCATCGGGCTCATGTGATAGACACAAGATCCAGCGGAGGGGCACGGATGGAAATTGAGTTCTGGAGCACCCCGATGTGAATTCACAGGCTTCGCAACGCAACGCAACGCAGCTCTCCACTTGCGCGCGGCTCTCTCTCTCTCTCTCTCTCCCTCTCGTCCCGACTCGACCCGACGACGACGACGCGACGACGAGGGTCATCAGCGAGCGCGAGCCTTATGTGAATCGGGTGATCGAACAGATTGGGGAGTAGAGGAGGCGGGGGAGGAAAATTAGCCAGGGGTTATACACAGCAGTCACAACGGCCAAGGTCGCCCGAGGTGGGTATGTGTACATGGCGGGGGTGGATCATGCCACCGGTATCCCTCATGGCCACGACCAAAATCAATCGATGCATCCGCGCGATCAGCAACCGCACACGTCCGAGGACGAGAACAGCGGCAGCAGCGGACCTGGCAGAGGGAAGAAGCGAGGCAAGATTGAGGGGAAGCCTGGCGGGCCGCCTGTGGGGCAGGAGGGCACAGGGGGGCGCAAGCCGCGCGGTAGGCCACCAGGATCGAAAAATAAGCCCAAGCCCCCAATCTACATAACGCGCGACACCGGCAGCGGCATGAGGCCGCATGTGCTCGAGGTGCAAGGGGGCAGCGACGTCGGGGAGAGCGTCGCGGCCTTCGCCCGGAGGCGGGGGCGCGGCGTGTGCGTGCTCGGGGGCAGCGGCACGGTGGCCAACGTCACGCTCCGGCAGCCGGCGGCCCCCGGCGCCACCGTGACCTTCCATGGCCGCTTCGACATTCTGTCGCTGTCGGGCGCGTTTCTGCCCCCGCCGGCGCCGACGAGCGCCGCGGGGCTGACCATCGCGCTGGCCGGGGCCGCCGGGCAGGTCGTGGGGGGCACGGTGGTGGGGGGCCTGCAGGCCGCAGGCCCCGTGCTGGTGATCGCGGCGTCGTTCCAGGGCGCGACGTTCGACCGATTGCCGCTGCCGGACGAGGGCGACGACGGGCAAGGCCATCCCCAAATTACGCAGGGGTCCGAGTACGGCGGTGCGCTGTATAGTGTGAACCCGCAGATGGGTGTCAGTGCATGCCAACTCACGAGTTCGGACGTGAATGTGATGTCCTGGGCCACCGCTCCACGCCCTCCTCCCTACTGAAGAAACGAAAAGTCATTGCTTTGCTCGCCTCCTACCAAGGTCACGCTCGAGTTGTCCTCGACGTCCCCATGCCAGACAGGAGATGGAGATTTGTTCATCAGGGCCCATGCATTGAAACTCCTGCAAGTTTATCATAGACGGCATCAATTCACCCGCTCTCGACTCGACACTGGTTCTCTCTCAGGCTAGGGATGCACATGCAGGCAGGCAGGCAGGCAGGCAGGCAGGCAGTTGCGTGTCGCCGCAGCAGCAGCTGCAGCTGTGTTCTTTTCGTTTCTTCTCCCCCGACGAGCCAGCCACAGCCACAGCCACCGCACCGCACAGCCAGCAGCAGCCGCAGCAGCAGCAGCAGCAGCCCGCCCCACTGTTGTAGTACGCGCCAGGACGACACATTTGGATTGATCTGTACAATATAGAGCAGCGGCCATCTCTCACTTTCACGGTTGTGACGTCCTGCCATTCATCAACCGACCGCTCGCCTCGCTTCGCCTCACGAGTGCGACGCCACAAGCTGAGAGTCTTTCATGGGAGGTTTGAACTTGATTGTGATCACCCTCCCCTTTCCCCTTTCCCACCCTTCCTTAACTTCCGCTTGTCCGTCCTCTATTTTTCTTTTTATTTTTCACTTCCCTTACTTCCCACATCATCTTCTTGACAAACACCACCGATATCGTCATTCCATTCGCCTTCCTCCGTCTCCGACTCCATCTCCACCTCCATTCTACGCTGCGTATACCCTCCTGTCCTGTCCTGACCTGCCCTCGCCTTCCCTTGCCTTGCCTTCCCGTCCGTTTAATTGCTCCATCCCCGTCTCCCTCTCCCTCTCCCCCTCCCTATTTCTGTCTGTCTGCCTCGGGCACACACGCACGTAACTAGGAATGTGGCATCGTAAAGCAGTCAAGTAAATGTAGCAGAAATCGAGAGATAGTACAGTAGATGTGCTGGTCAGGTTTGGCATGGCATAAAGTGCAGTTACGCCCAATTTTTCATTGTTCTTCCTCTCGCTCTTCTGAAGCTGATGCAGCACAGCAACACTTTTATGAACAGGAAGGATGCGCCTGCATTAGTCGGACGACTGAGAGCAAAGCAGGGGATGTAAGGATCAGCTTAATGTAAGGAATTTGCTCGAGTCAAACCGCTCGGTTTGTTGGGTGTGTCTGTGATGGGCGTATGAAGTTTCGACCGGGGCTTGATTCATTATCCCTCAAATAAGCACAAATAAAGCGAAGGACGGCATTGGCGCCCGGCGCCCGCTGCTGCTCGTCGCTTTACCCGGAGAGGAGGGAGGGGGAGAGAGGCGGGACTAAATGTTTGTCAAGTGGGACCTCAGGATCAGATGTAATTCATAGAGCAGTAAAGTAGCAGAAATCATCATCATCATCATCATCATCAGAAATAAAAGGAGATGCGGATTAAAGCATCTATATTTCGAAGCCCTGAGACTGCAGTTTGGTCGGTCCAAACTCCACAATCTCCGTGTCTCTCCGCTCCTTCGATCCTCTCTCGCCCCGTCTCATCCTCCCGCCCAATTCCCCTCGTCTTTTTTCTTTTCTTTTCTGCTCTCCTCTCCTCTCCTCTCCTCTCCTCCCATCTCCCTGTGTCTGCGTAGATCCTGAGGCGGTGTCCCTGTGGGTGGAAGTGAAGGTCCGGTCGCTACTCTACCTGTGCATGGTCTCTCGTCCTCTCCTCGTTCAATCCACTCGTGTGCGTTCTGGTGCTCGAACCATCCATCCCGAGAGGTCTGTCTGAACTCATGCCGTCTGCAACAATGAGGCAGCCATGTGAACACTTCGAGTAGTTGAAATTGTGATTGCTTTATTTACACTAACTTCAGCCGCTTCCCCACCAGCAGGAGTGGTGATCGGGGGTAATGTCATACTTTCGATACTTTTAATAATCGTTTACTTGGAAATTTCAGCCTCTGTGCTATTTTTGCTTTCGAATCCGTGCGCGTCTCATGTTGAATGCTAGATTTTTCCTTCTCGTTCGCCTCCGCCGCTTGAATTTCGTCCGAGTTGAATTCCTTCTTATTTTTGACGATTGCAATTCCGCTACTGGGACGATTTCAATCGCGTGCACAAACGGACCGGACCGGACCAGACCGGACCAGACCAGACCAGGCCAGG

CDS

>Mapoly0102s0028.1
ATGGCGGGGGTGGATCATGCCACCGGTATCCCTCATGGCCACGACCAAAATCAATCGATGCATCCGCGCGATCAGCAACCGCACACGTCCGAGGACGAGAACAGCGGCAGCAGCGGACCTGGCAGAGGGAAGAAGCGAGGCAAGATTGAGGGGAAGCCTGGCGGGCCGCCTGTGGGGCAGGAGGGCACAGGGGGGCGCAAGCCGCGCGGTAGGCCACCAGGATCGAAAAATAAGCCCAAGCCCCCAATCTACATAACGCGCGACACCGGCAGCGGCATGAGGCCGCATGTGCTCGAGGTGCAAGGGGGCAGCGACGTCGGGGAGAGCGTCGCGGCCTTCGCCCGGAGGCGGGGGCGCGGCGTGTGCGTGCTCGGGGGCAGCGGCACGGTGGCCAACGTCACGCTCCGGCAGCCGGCGGCCCCCGGCGCCACCGTGACCTTCCATGGCCGCTTCGACATTCTGTCGCTGTCGGGCGCGTTTCTGCCCCCGCCGGCGCCGACGAGCGCCGCGGGGCTGACCATCGCGCTGGCCGGGGCCGCCGGGCAGGTCGTGGGGGGCACGGTGGTGGGGGGCCTGCAGGCCGCAGGCCCCGTGCTGGTGATCGCGGCGTCGTTCCAGGGCGCGACGTTCGACCGATTGCCGCTGCCGGACGAGGGCGACGACGGGCAAGGCCATCCCCAAATTACGCAGGGGTCCGAGTACGGCGGTGCGCTGTATAGTGTGAACCCGCAGATGGGTGTCAGTGCATGCCAACTCACGAGTTCGGACGTGAATGTGATGTCCTGGGCCACCGCTCCACGCCCTCCTCCCTACTGA

Protein

>Mapoly0102s0028.1
MAGVDHATGIPHGHDQNQSMHPRDQQPHTSEDENSGSSGPGRGKKRGKIEGKPGGPPVGQEGTGGRKPRGRPPGSKNKPKPPIYITRDTGSGMRPHVLEVQGGSDVGESVAAFARRRGRGVCVLGGSGTVANVTLRQPAAPGATVTFHGRFDILSLSGAFLPPPAPTSAAGLTIALAGAAGQVVGGTVVGGLQAAGPVLVIAASFQGATFDRLPLPDEGDDGQGHPQITQGSEYGGALYSVNPQMGVSACQLTSSDVNVMSWATAPRPPPY

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>