Mapoly0110s0001



Description

SERINE/THREONINE-PROTEIN KINASE RIO

Reference DB

Database ID Description
OrthoMCL OG5_150200
PFAM PF12171 Zinc-finger double-stranded RNA-binding
PANTHER PTHR10593 SERINE/THREONINE-PROTEIN KINASE RIO
PANTHER PTHR10593:SF21

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpC2H2-16 transcription factor, C2H2-ZnF Mapoly0110s0001.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0110s0001.1 scaffold_110:5581..6374  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0110s0001.1  

Gene structure:

mRNA scaffold_110:5581..6374  ( - strand )
three_prime_UTR scaffold_110:5581..5844  ( - strand )
CDS scaffold_110:5845..6237  ( - strand )
five_prime_UTR scaffold_110:6238..6374  ( - strand )

Sequences:

Gene

>Mapoly0110s0001.1
CAAACATAGTTCTCAATAACGGGAAATATGTAAAAGCTATAAAACTCGGCCTTGATCCCTTGATCGCATGGCTGCTGGATCGGGAGCAGGTTCTGCCAAGGCCTCGATCAATAATCAATCGATCCTCTCCTGACGTCATGTTTCCTTCGAACTCGGCCTCGGGGTCGCACGGTTCCGAGGATCAGGAAATGGGCGTGAGATCTAGGAGGGGAGCTTCTCGGTACGAGTTCGATGACGGGGAGGGCGAGAATCTGGTCGATGGTTACCAGCTCGTGGAACTGGACGGACAGGAAATTCTGGCCGAGCACACTCACTTCTGCGAGTTGTGCGGGAAGGGATTCAAGAGAGACGCGAACCTGAGGATGCACATGAGGAGCCACGGAGACGAGTACAAAACTCCCGAGGCTCTGGCCAGGCCCCAGAAGCCCATAGACGAGCAGACTCCGGAAATCCCCAAGAGGTTCTCGAGTCCGCACGTCGGCTGCAAGCGCAACGTGAGATTCTGCGTGAGATTAAGATCTAGAAGGTAGCAAGTCGGCTTCACAATATATAGTGAAGCCGATTTCTGTTTCTTCTGGAGGGAAGATAATGGAGGTCTCTCCATTATAGTCCCTTCAGAAGTGTTTCTTCCACTCATCCAGTCTGAACCCATGATCTGCAAGACCGGCAGTTCGCGCCTGCCACATTATGCGCCATGTAACACCTGCCACCGAGGTTATCAAATGTCTTCTCTATTAAATTCAATATCGAGGTAAATTTTTTTGTATACATTGAATACTGGTCCTGTATATTGT

mRNA

>Mapoly0110s0001.1
CAAACATAGTTCTCAATAACGGGAAATATGTAAAAGCTATAAAACTCGGCCTTGATCCCTTGATCGCATGGCTGCTGGATCGGGAGCAGGTTCTGCCAAGGCCTCGATCAATAATCAATCGATCCTCTCCTGACGTCATGTTTCCTTCGAACTCGGCCTCGGGGTCGCACGGTTCCGAGGATCAGGAAATGGGCGTGAGATCTAGGAGGGGAGCTTCTCGGTACGAGTTCGATGACGGGGAGGGCGAGAATCTGGTCGATGGTTACCAGCTCGTGGAACTGGACGGACAGGAAATTCTGGCCGAGCACACTCACTTCTGCGAGTTGTGCGGGAAGGGATTCAAGAGAGACGCGAACCTGAGGATGCACATGAGGAGCCACGGAGACGAGTACAAAACTCCCGAGGCTCTGGCCAGGCCCCAGAAGCCCATAGACGAGCAGACTCCGGAAATCCCCAAGAGGTTCTCGAGTCCGCACGTCGGCTGCAAGCGCAACGTGAGATTCTGCGTGAGATTAAGATCTAGAAGGTAGCAAGTCGGCTTCACAATATATAGTGAAGCCGATTTCTGTTTCTTCTGGAGGGAAGATAATGGAGGTCTCTCCATTATAGTCCCTTCAGAAGTGTTTCTTCCACTCATCCAGTCTGAACCCATGATCTGCAAGACCGGCAGTTCGCGCCTGCCACATTATGCGCCATGTAACACCTGCCACCGAGGTTATCAAATGTCTTCTCTATTAAATTCAATATCGAGGTAAATTTTTTTGTATACATTGAATACTGGTCCTGTATATTGT

CDS

>Mapoly0110s0001.1
ATGTTTCCTTCGAACTCGGCCTCGGGGTCGCACGGTTCCGAGGATCAGGAAATGGGCGTGAGATCTAGGAGGGGAGCTTCTCGGTACGAGTTCGATGACGGGGAGGGCGAGAATCTGGTCGATGGTTACCAGCTCGTGGAACTGGACGGACAGGAAATTCTGGCCGAGCACACTCACTTCTGCGAGTTGTGCGGGAAGGGATTCAAGAGAGACGCGAACCTGAGGATGCACATGAGGAGCCACGGAGACGAGTACAAAACTCCCGAGGCTCTGGCCAGGCCCCAGAAGCCCATAGACGAGCAGACTCCGGAAATCCCCAAGAGGTTCTCGAGTCCGCACGTCGGCTGCAAGCGCAACGTGAGATTCTGCGTGAGATTAAGATCTAGAAGGTAG

Protein

>Mapoly0110s0001.1
MFPSNSASGSHGSEDQEMGVRSRRGASRYEFDDGEGENLVDGYQLVELDGQEILAEHTHFCELCGKGFKRDANLRMHMRSHGDEYKTPEALARPQKPIDEQTPEIPKRFSSPHVGCKRNVRFCVRLRSRR

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>