Mapoly0129s0042



Description

ADP RIBOSYLATION FACTOR-RELATED

Reference DB

Database ID Description
GO GO:0005525 GTP binding
KEGGORTH K07977 Arf/Sar family, other
KOG KOG0075 GTP-binding ADP-ribosylation factor-like protein
OrthoMCL OG5_129025
PFAM PF00025 ADP-ribosylation factor family
PANTHER PTHR11711 ADP RIBOSYLATION FACTOR-RELATED
PANTHER PTHR11711:SF152

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpARFLA SAR/ARF GTPase Mapoly0129s0042.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0129s0042.1 scaffold_129:326249..330370  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0129s0042.1  

Gene structure:

mRNA scaffold_129:326249..330370  ( + strand )
five_prime_UTR scaffold_129:326249..327017  ( + strand )
CDS scaffold_129:327018..327055  ( + strand )
CDS scaffold_129:328373..328454  ( + strand )
CDS scaffold_129:328675..328707  ( + strand )
CDS scaffold_129:329008..329129  ( + strand )
CDS scaffold_129:329237..329398  ( + strand )
CDS scaffold_129:329541..329667  ( + strand )
three_prime_UTR scaffold_129:329668..330370  ( + strand )

Sequences:

Gene

>Mapoly0129s0042.1
GCCACCATACATTTGTCTGAGCGACGGGCGCTTCCTCGGCACTCCCTTCGGCCAGTCACATCTGCTGCTCGCTTCGTCCTGCTCCATCTCCATCTCCTTAATTCCTTCCTTCCCTCCGTCCCCACTTCCGGGAATTGATTTGGCTTTCTTTGCGTGCGTGTGTTTGCGAGATCGTCGTGTGCTTGATTGATCTCTCATCTCCTTCCTCCCTCTCTCCCTCCTCCTCCTGCTGCTCCTGCCGCTGTTGCTGCTGCTCGAGCCTCTGTGATCGGTTGGTTACTGGGCGTGTGTGTGTGTGTGTGTCTGGGAGGATCCGAGTGCCTCCGAGGGCACAGCGTCAGAGATTGAGAGAACGAGAGAAAGAGGGAGAGGGAGGAGGAGGAGCAGCTGCGCAGGAGAAGGCTCGTCCGCCACTGTTGCCTCTGCCGGACGGACGGGACGGAGCGAGATTGTGTGCATCTGGTTGCCTTGTGGGCCTCTCGGTGTTGTTGATCTTTCGATCATCGGAGAGCGGAGGAGGCCGGAGGGAGTTCGCAGGGCCGCGGGTCGAGAGACAGAGACGGCGGGCGGGCGAGGGTGAGAGTGAGAGAGAGAGAGAGAGCGCTCGAGAGGGACGAGGGACGAGGGACGAGGAGCTGAGATTCATTCGGGCGCAGGACAGAGCTTGAGGCCGCAGCTTGAGTTAAATACGAGCGGGGGCAGAGCCGTGGAGGAAACGAGGTCGCCCGAGTTTGCCCCTTTGCATGTGTAGGGATAGTGGAAGAACACGATGGGGCTCTGGGAATCCTTTCTCAATTGGCTCCGCAGGTACTACTGCCCTCGACTGCCGATTGAATCGCCCGAACCCTCTTCTTGCTTCGCCCCTCCTTCCCCCCTTGCAAGTCGAACCCTGTTCTGCGTCGTTGTTGGTCTCCCGCTCGCTCGCTCCGAGGTCCCGTGCCGTGACCTAGTTGCTTGTTGTTGAGCGAAAGTATGGCGGGCCGCGTCGTTGTGCTCGAGGGCTGGAAGTTTGGGTTGAAGTGGTGGCTTGGTCTTCTGGCTTCGCGCTCTGACTGTCGTGGAAGCGTGCATAAAGGAACAGCTTGCATACCCTTGCCGTTTTGCATCCTCACTTCGGTGGAACATGTGCTCGGACATTAGCTCTCCGTCGATGTGTACAGTTAGTGCCAGAGCGAAGAAAATTTTTTCGGAATGCGATATTCCGGCGAAGAGATCGGGCGATTCCTGTCCGCAGTCTCACAGATGCACTCAGTGAACGCACGATTGCATGTTTAGATGTGTTGTTTCGCTTTTTCGCACTCTTTTGGATCAGCCATGACTCTCGGACGCAGAGATGTGGAATTCGTGCAACGTTCACTCGGATCTGTCCCTCCTACGGCTTTGTTTGTCGGTCTGCCTGGTAAATTCCCGTTCAGAGCAGTCAGTCTTGGAGCATATACGTCGAGGAACCAAGTTTCTGCAGCAGGAATTGAGTCCACGCAGTGTCTTCCTTTGTGAGCCCTGAAATTCACGAAGCCTTTGTGTGATGTACAAGCGTATTTAACTAGTGTACGCACCTCTATTCAAATGCTTTCCGATTCGTAATTCGGGTCGTGAATCCATCTGGACTTGTTTCTTCTCAGTCCATTCTTGGGAACGGGATTGTCGTATCAACTTGGAAACCGATGTTTTCTGATATGCTCATCCTGAATAATATACAAGTAACTACAAAGATCATCAGTCGGATCCAACCGGGAGAAGGAAGAAGATGTAGTAGCTTGCTACTACGCTAATTACAGAACGAGTGTCCTTGATCTCGCTGGAAGGACGAAGCTGATATGAACTAAGTCAGGCTTAAAAGTCAACAGGACCTGTTTTTTTTCTAGTCATCTCCGTTTTCTGCAGTTTCGGTCAGGAGCTCTTGAATTCCGTGTGGCAGTCTATGCTTGATCTTTGTCGGACTTTGCGTGCGTTCCTGCTCAGATGGGTTTTTTTCTGTCTGCGTTGTAGCTACATACTAGCTGACCACGGCCGTGACTATGTGCTGAATAAGAGAGCATCCTGATGACATGTCTTGAGCGTTTGTTCCAAATCATGGAATCCCTTGTTCCTTCGACACTCATTCTTGTTTGGGGTGGTCTGCAGCTTGTTTTTCAAGCAGGAAATGGAGCTCTCGCTAATTGGGCTTCAAAATGCGGGGAAAACATCATTAGTCAATGTGATAGCGGTAAGCTGTGCGCAAAGTCTTGTTATTGTTTGCTGTTGTTGTTTCTAGCGATCGTTATTAATATTTTTGTGTTAGTTCATATTTCAGTGTATGAATGTCGGGCAGTATATTTTTTAAATTTACCTCCTCCGGCTGTGTGATTTTCCCTTTTGTAATGTGCGTAAACCCAAGTTGACTCACCTACGGTTCCTTTTGTCTCTATGTGCGTTGGACTAAGCAGACTGGAGGCTACACTGAGGACATGATCCCTACGGTAAGGGAGTCTCAAACTTATGAAAATGATCGTCTTTCTTTACAGTCCTTGATTGGCGAAGATTAGGCAGCGGTCTTATAAAGTTCTCGAATTGGAATATACCAGCTAGTCAATTGTGCCAGTGTTTTCTACGTTGCATCTTAGACCCCATGTGGACGACACCTCCTATGAAGCAAGATAGAATATGTTCGGGATTTGTTAGGTCACCATTAAGCTTAAGCTTATGTCACTTGAGTGAGGGCTTGTAGTCTGTTTGCTAGGTATATGTCAACTAACGCGATAGAGGTAATCTCGTTACAGGTAGGGTTCAACATGCGCAAGGTCTCAAAGGGCAACGTAACTATCAAGTTGTGGGATCTTGGAGGCCAACCTCGTTTCCGTAGTATGTGGGAGCGTTACTGCAGAGGAGTGTCTGCCATCGTGTAAGTGCCTCATGCCGTCAATGTTTGGTTCATTCCTGTCTCGAGCTTTTTTTGTTTGTAGAAGGTAATGCCACTGCTTCACTGATTTGGCCCTTTCCATATCGCAGTTACGTGGTTGATGCAGCCGATCGGGACACCATTCCTATATCTAAAAGCGAATTACATGATCTGCTGGGCAAGCCGTCACTCAATGGAATCCCGTTGCTGGTTCTGGGCAACAAGATTGATAAAGAGAATGCTCTTTCCATGCAGGCACTTTCCGAGCAGATGTAAGTTTCTGTGACGTTCTGCTATATATGAAAAAATTTCATGTAAAGTCTGGAGGGTCTGTAACTTGTGGTCGATAAGGAGTTCGATGAGCGAAAGATTCACGTGTACTAAGATCTTGACTTTCATATGTGGGTAATCCAGGGACTTGGCAAGGCTTGCCGAAAGAGACAGCAGAGAGGTTTGCTGCTACACCATCTCATGCAAGAACAGCACAAATATCAACGACGTCATAAATTGGTTGATCAAGCACTCAAAAACCAAGAGCTGATCGTTGTATCAAAGAAGAGTCGGGGAGGTCAAACATAGGTGGTAGTTTTTTTTTCCCACATTATAACTTTTCCGGATGTCTTAACCTGGAAGTAAGACGTGGCCGAAGTTTACTGTTTGCGAAGTCCGCAATTTTAGCAACGTGCAACGCAGATTGCTGCACAAAATCTAGTTTTCTTGATTCGGAACTGTTGAATATCTGAGCAAATTGGCACTCTAGATCACACCTGCAGTTGCCAATGTCGTCGATCTGAAGAGAACTTCGCAAGGGTTGTATTGATTGCATTGGGCAAGCTTGCCCAAATTCTTTCTAGTTTACAGGGCTGTAAGCTAGGCCTGTTCACACTGTCTTATACAGTGTTTGTTACTTCTACCTGTAATAATGTATTTTGCTCATCTGTGGATAACTTCTTACCACAGTGCTCAGCTCCGTAGCGAGTGAGTGTCTTCTGCATCCCAGAGAGCGCGTGGACATTAGGGGGTTTGCAGAGGAAGTAAATTCTACCCGGAACGAGTTGTGGGTTTTCTGCTCTTTTTTTTAGAGTTTTTGTTGAGATCTCACGTGGCCGCGGTTTTCTCTATGTCCGTGGGTGTCTCCTTCTGTAAAAGGCAGAGTTGTTATGTATGAAAGTTTTGGCGGGTTGCCAAGTAAAACTGTTGAGCGAAGCCATTGTAGCGTTGAGACTGAGAGTTGCATTTGATTG

mRNA

>Mapoly0129s0042.1
GCCACCATACATTTGTCTGAGCGACGGGCGCTTCCTCGGCACTCCCTTCGGCCAGTCACATCTGCTGCTCGCTTCGTCCTGCTCCATCTCCATCTCCTTAATTCCTTCCTTCCCTCCGTCCCCACTTCCGGGAATTGATTTGGCTTTCTTTGCGTGCGTGTGTTTGCGAGATCGTCGTGTGCTTGATTGATCTCTCATCTCCTTCCTCCCTCTCTCCCTCCTCCTCCTGCTGCTCCTGCCGCTGTTGCTGCTGCTCGAGCCTCTGTGATCGGTTGGTTACTGGGCGTGTGTGTGTGTGTGTGTCTGGGAGGATCCGAGTGCCTCCGAGGGCACAGCGTCAGAGATTGAGAGAACGAGAGAAAGAGGGAGAGGGAGGAGGAGGAGCAGCTGCGCAGGAGAAGGCTCGTCCGCCACTGTTGCCTCTGCCGGACGGACGGGACGGAGCGAGATTGTGTGCATCTGGTTGCCTTGTGGGCCTCTCGGTGTTGTTGATCTTTCGATCATCGGAGAGCGGAGGAGGCCGGAGGGAGTTCGCAGGGCCGCGGGTCGAGAGACAGAGACGGCGGGCGGGCGAGGGTGAGAGTGAGAGAGAGAGAGAGAGCGCTCGAGAGGGACGAGGGACGAGGGACGAGGAGCTGAGATTCATTCGGGCGCAGGACAGAGCTTGAGGCCGCAGCTTGAGTTAAATACGAGCGGGGGCAGAGCCGTGGAGGAAACGAGGTCGCCCGAGTTTGCCCCTTTGCATGTGTAGGGATAGTGGAAGAACACGATGGGGCTCTGGGAATCCTTTCTCAATTGGCTCCGCAGCTTGTTTTTCAAGCAGGAAATGGAGCTCTCGCTAATTGGGCTTCAAAATGCGGGGAAAACATCATTAGTCAATGTGATAGCGACTGGAGGCTACACTGAGGACATGATCCCTACGGTAGGGTTCAACATGCGCAAGGTCTCAAAGGGCAACGTAACTATCAAGTTGTGGGATCTTGGAGGCCAACCTCGTTTCCGTAGTATGTGGGAGCGTTACTGCAGAGGAGTGTCTGCCATCGTTTACGTGGTTGATGCAGCCGATCGGGACACCATTCCTATATCTAAAAGCGAATTACATGATCTGCTGGGCAAGCCGTCACTCAATGGAATCCCGTTGCTGGTTCTGGGCAACAAGATTGATAAAGAGAATGCTCTTTCCATGCAGGCACTTTCCGAGCAGATGGACTTGGCAAGGCTTGCCGAAAGAGACAGCAGAGAGGTTTGCTGCTACACCATCTCATGCAAGAACAGCACAAATATCAACGACGTCATAAATTGGTTGATCAAGCACTCAAAAACCAAGAGCTGATCGTTGTATCAAAGAAGAGTCGGGGAGGTCAAACATAGGTGGTAGTTTTTTTTTCCCACATTATAACTTTTCCGGATGTCTTAACCTGGAAGTAAGACGTGGCCGAAGTTTACTGTTTGCGAAGTCCGCAATTTTAGCAACGTGCAACGCAGATTGCTGCACAAAATCTAGTTTTCTTGATTCGGAACTGTTGAATATCTGAGCAAATTGGCACTCTAGATCACACCTGCAGTTGCCAATGTCGTCGATCTGAAGAGAACTTCGCAAGGGTTGTATTGATTGCATTGGGCAAGCTTGCCCAAATTCTTTCTAGTTTACAGGGCTGTAAGCTAGGCCTGTTCACACTGTCTTATACAGTGTTTGTTACTTCTACCTGTAATAATGTATTTTGCTCATCTGTGGATAACTTCTTACCACAGTGCTCAGCTCCGTAGCGAGTGAGTGTCTTCTGCATCCCAGAGAGCGCGTGGACATTAGGGGGTTTGCAGAGGAAGTAAATTCTACCCGGAACGAGTTGTGGGTTTTCTGCTCTTTTTTTTAGAGTTTTTGTTGAGATCTCACGTGGCCGCGGTTTTCTCTATGTCCGTGGGTGTCTCCTTCTGTAAAAGGCAGAGTTGTTATGTATGAAAGTTTTGGCGGGTTGCCAAGTAAAACTGTTGAGCGAAGCCATTGTAGCGTTGAGACTGAGAGTTGCATTTGATTG

CDS

>Mapoly0129s0042.1
ATGGGGCTCTGGGAATCCTTTCTCAATTGGCTCCGCAGCTTGTTTTTCAAGCAGGAAATGGAGCTCTCGCTAATTGGGCTTCAAAATGCGGGGAAAACATCATTAGTCAATGTGATAGCGACTGGAGGCTACACTGAGGACATGATCCCTACGGTAGGGTTCAACATGCGCAAGGTCTCAAAGGGCAACGTAACTATCAAGTTGTGGGATCTTGGAGGCCAACCTCGTTTCCGTAGTATGTGGGAGCGTTACTGCAGAGGAGTGTCTGCCATCGTTTACGTGGTTGATGCAGCCGATCGGGACACCATTCCTATATCTAAAAGCGAATTACATGATCTGCTGGGCAAGCCGTCACTCAATGGAATCCCGTTGCTGGTTCTGGGCAACAAGATTGATAAAGAGAATGCTCTTTCCATGCAGGCACTTTCCGAGCAGATGGACTTGGCAAGGCTTGCCGAAAGAGACAGCAGAGAGGTTTGCTGCTACACCATCTCATGCAAGAACAGCACAAATATCAACGACGTCATAAATTGGTTGATCAAGCACTCAAAAACCAAGAGCTGA

Protein

>Mapoly0129s0042.1
MGLWESFLNWLRSLFFKQEMELSLIGLQNAGKTSLVNVIATGGYTEDMIPTVGFNMRKVSKGNVTIKLWDLGGQPRFRSMWERYCRGVSAIVYVVDAADRDTIPISKSELHDLLGKPSLNGIPLLVLGNKIDKENALSMQALSEQMDLARLAERDSREVCCYTISCKNSTNINDVINWLIKHSKTKS

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>