Mapoly0129s0052



Description

Domain of unknown function (DUF296)

Reference DB

Database ID Description
OrthoMCL OG5_139537
PFAM PF03479 Domain of unknown function (DUF296)
PANTHER PTHR31500 FAMILY NOT NAMED
PANTHER PTHR31500:SF0 SUBFAMILY NOT NAMED

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpATHOOK2 transcription factor, AThook Mapoly0129s0052.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0129s0052.1 scaffold_129:470963..473644  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
Mapoly0129s0052.2 scaffold_129:470650..473644  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
Mapoly0129s0052.3 scaffold_129:470650..473644  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
Mapoly0129s0052.4 scaffold_129:470976..473644  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0129s0052.1  

Gene structure:

mRNA scaffold_129:470963..473644  ( + strand )
five_prime_UTR scaffold_129:470963..471121  ( + strand )
CDS scaffold_129:471122..471830  ( + strand )
CDS scaffold_129:472078..472136  ( + strand )
CDS scaffold_129:472239..472373  ( + strand )
CDS scaffold_129:472604..472765  ( + strand )
CDS scaffold_129:472993..473049  ( + strand )
three_prime_UTR scaffold_129:473050..473644  ( + strand )

Sequences:

Gene

>Mapoly0129s0052.1
AACACGGCAGCTTTGTGATTTTGATCTGTGGATGCATTGAATTCTAGAATTCCTCGAATAGGGATACAATTTTTGGTTTAAGATTTCCGGTCTGAACTTCGAAGACTTCGGAGTCTCACGCTTTTTGTATTTTGTGGGGGGCGTATTTCTAGATACTTCATGATTGATACCGATCCCCCGTTGGATGAGCAAGTCCTGTCGAGAAGCATGGGAACAAGTTTGGGTGCTGTTGACGATTTGTGTGTTCAATCTGCCTCTACCGCTGCTACTCCTGCAGATGTCGAAGAAACTGCATTGAACGCGGAGGAGGAGGAGCCAGTGGAGATGCCGAAGAAGAAGAAACGAGGGCGTCCGAGAAAGAATGTCGCGACGAGAGCACCATGCAATGATCTTACGCCGGCAGCAATTCCTTCCCCAATTGCTTCTCGAACACCCGATGAAGAGGTCAAAGCAGATCACTTCAGCTTGGAAACCACGCCTCATGTTTCCACCCCTTCGAATTCAGAGCTGCCAAGTAGTGCAATTACAACATCAGGCCTGCCTTGCTCATACCCCGACCCTTATTCAAACACGGATTCTGATGTCAAAGTGGAAGAGGGAGGAGCTTTAGAATATCCACAAGTAAAGCGTCGGCGTGGACGCCCTCCCAAATATCAGAAAATGATAGAGAAGAAGTCTGGTGCAGCTAAGCAAAAAATTCGAAGCTTGTCCAAGAAACAGCAGCAGAGCCGCGAGGAGGAAGATTCTTGCAATAGCGATAAGGACGGACGATCCCAAGTCAAGAAGCGAGGTCCAGGACGTCCTCCTGGTTCCGGAAAGAAAAAATTTCTGAAGAGTGACTCGCCTTCATCAACTGGAGGTGGATCAGGTTTGTGCTCCAGTTTCAGTCTTTGTTTCGCTACAAGATAGTTGGCAAAAGGCGAATCGTTACGTCTCGTCATGATTCAGTGCGTAAAACACCACGTCTGAAACATAAGGATCGAATGTTCTGCTCCATTCATTAGATAGAGGGCGGGCTTTTAGCCGCTTGATATTGGTTCGTCCAAGTGTGTCAAAGAATTCATGCTTCTGGTTTCAATGTGCTTGAAACACATGCTCATAGTTTGCTGGTGTAGGTGTTCATCGTCAAGCATTACCCATCGAGGCTCAGATTCTACATATTCTTCCGGAAGAGGTTGGTGAATTTTCCAGCAGCGTGCTCGCTTCCCTTTTGCATTTCTTTCTTGTGCTGTCCTGATGTTGCTGAGTTTTGTGATTTTTTTTTCCCATAAACAAGGATGTAGCAAAGGTGGTGACCGATTTCTGTCAGAACGCTGGCCTTCCAATGTGTGTGATGTCTGCAAATGGTGAGATATCCACTATCCACTTCAAGAATGAAGTGAAACCCCGAGACGTTAGCACCATTCACCAGGTGATAATTCACGCATGAAAGAGCGACGAAAATTGTATCAGTTGTGGAAATTGTACATTCTAGTATGGTAAATTTGTCTGAATTTTTCTGGCGAATTTTTCCGTCTTTATTTAATAGTCTTGAGAATATACACAACCTCAACCATACTCGAGGTTGTGTGAAGCTTTCGAATTCCTGTGTTACGAGGGTGCAAGGCTCCTGAGAAGCAACTGACATGAAACTGTTAGCAGGGCCTGCGCGAGATCATTTCTATGTCTGGATGCGTCATGCCTCTAGATGGCGAAGGAGATAAGAGGTGGATTAGCAGATTCACAGTCTTGCTCGCTGACAGTGAAGGTCGAATCGTTGGAGGAGGTATTTCAGACTCCATGATTGCCGCATCCAAGGTGCAGGTAATATGCGTGTGCCATCCAAAGTGTGCGGTGATCCTCTAGCGAGATCTATCGGCTTCTGTCATTTAGCAAGATCGTTTCAATTTGGTTCAATAAATAGGGAATTGAAATGCTTACGATGTGTCAATCATTGCTAAATCATCTCAATATTGTCAATTGTAAAGCCCGTTGAATTCTCTTGGAGAATTTATATGTGGATCTCTTACACGTTTCTTGTGCCAATACAGGTGATTCTCGGGAGCTATCCTATTGCGGATGCACAAAATCATGAGGCTTCTGATTAGCTTAGCACAAAGAACAGGTTGGGAATCCGTAAAAGACAATTTAGCACATTACGTGCCTGCAGTTAGACTCAGTAGATTACATGCCTGAAATGTAAGTATATGGTTATGGCTTCGACACGAGGGTGACGAATAATTCATAATCACAACGGGAGAGACATATTATAGCTGCACGCATCTAAGACCCAGATATCACCAACACTGGTTCTCTTGCGACAGAAAAGTCATGCTAACGTATCTTTTCCGCAATATTGCTTTTCCATCTACGAACGAGACATTTGTCATTCATATCTTTTTCTGTTCCCAAGGTGTAGACCTTGGGAAAGAAAGTCGGATGTAGCCGGTTGTTAGACTTGAGTCACATAAAGTAGATGTGCACTGGATTATCATAGATTTGTAAGTTAGAATTAGAGTGTTCGCAATGCTTCACGACTCAGCAGGTGGAAACTGCCGCTTACATGTACGCAGTGAAGTCTATTTGAATGCGAGGAATACAGCAGAAGATGCTAAAATGAAATTACAGTGGATTCGGCTCGGACAACTGGACTATTATGAGTGATCAACAGGATCACTCATGCGTCACGATTCTTTCATAACG

mRNA

>Mapoly0129s0052.1
AACACGGCAGCTTTGTGATTTTGATCTGTGGATGCATTGAATTCTAGAATTCCTCGAATAGGGATACAATTTTTGGTTTAAGATTTCCGGTCTGAACTTCGAAGACTTCGGAGTCTCACGCTTTTTGTATTTTGTGGGGGGCGTATTTCTAGATACTTCATGATTGATACCGATCCCCCGTTGGATGAGCAAGTCCTGTCGAGAAGCATGGGAACAAGTTTGGGTGCTGTTGACGATTTGTGTGTTCAATCTGCCTCTACCGCTGCTACTCCTGCAGATGTCGAAGAAACTGCATTGAACGCGGAGGAGGAGGAGCCAGTGGAGATGCCGAAGAAGAAGAAACGAGGGCGTCCGAGAAAGAATGTCGCGACGAGAGCACCATGCAATGATCTTACGCCGGCAGCAATTCCTTCCCCAATTGCTTCTCGAACACCCGATGAAGAGGTCAAAGCAGATCACTTCAGCTTGGAAACCACGCCTCATGTTTCCACCCCTTCGAATTCAGAGCTGCCAAGTAGTGCAATTACAACATCAGGCCTGCCTTGCTCATACCCCGACCCTTATTCAAACACGGATTCTGATGTCAAAGTGGAAGAGGGAGGAGCTTTAGAATATCCACAAGTAAAGCGTCGGCGTGGACGCCCTCCCAAATATCAGAAAATGATAGAGAAGAAGTCTGGTGCAGCTAAGCAAAAAATTCGAAGCTTGTCCAAGAAACAGCAGCAGAGCCGCGAGGAGGAAGATTCTTGCAATAGCGATAAGGACGGACGATCCCAAGTCAAGAAGCGAGGTCCAGGACGTCCTCCTGGTTCCGGAAAGAAAAAATTTCTGAAGAGTGACTCGCCTTCATCAACTGGAGGTGGATCAGGTGTTCATCGTCAAGCATTACCCATCGAGGCTCAGATTCTACATATTCTTCCGGAAGAGGATGTAGCAAAGGTGGTGACCGATTTCTGTCAGAACGCTGGCCTTCCAATGTGTGTGATGTCTGCAAATGGTGAGATATCCACTATCCACTTCAAGAATGAAGTGAAACCCCGAGACGTTAGCACCATTCACCAGGGCCTGCGCGAGATCATTTCTATGTCTGGATGCGTCATGCCTCTAGATGGCGAAGGAGATAAGAGGTGGATTAGCAGATTCACAGTCTTGCTCGCTGACAGTGAAGGTCGAATCGTTGGAGGAGGTATTTCAGACTCCATGATTGCCGCATCCAAGGTGCAGGTGATTCTCGGGAGCTATCCTATTGCGGATGCACAAAATCATGAGGCTTCTGATTAGCTTAGCACAAAGAACAGGTTGGGAATCCGTAAAAGACAATTTAGCACATTACGTGCCTGCAGTTAGACTCAGTAGATTACATGCCTGAAATGTAAGTATATGGTTATGGCTTCGACACGAGGGTGACGAATAATTCATAATCACAACGGGAGAGACATATTATAGCTGCACGCATCTAAGACCCAGATATCACCAACACTGGTTCTCTTGCGACAGAAAAGTCATGCTAACGTATCTTTTCCGCAATATTGCTTTTCCATCTACGAACGAGACATTTGTCATTCATATCTTTTTCTGTTCCCAAGGTGTAGACCTTGGGAAAGAAAGTCGGATGTAGCCGGTTGTTAGACTTGAGTCACATAAAGTAGATGTGCACTGGATTATCATAGATTTGTAAGTTAGAATTAGAGTGTTCGCAATGCTTCACGACTCAGCAGGTGGAAACTGCCGCTTACATGTACGCAGTGAAGTCTATTTGAATGCGAGGAATACAGCAGAAGATGCTAAAATGAAATTACAGTGGATTCGGCTCGGACAACTGGACTATTATGAGTGATCAACAGGATCACTCATGCGTCACGATTCTTTCATAACG

CDS

>Mapoly0129s0052.1
ATGATTGATACCGATCCCCCGTTGGATGAGCAAGTCCTGTCGAGAAGCATGGGAACAAGTTTGGGTGCTGTTGACGATTTGTGTGTTCAATCTGCCTCTACCGCTGCTACTCCTGCAGATGTCGAAGAAACTGCATTGAACGCGGAGGAGGAGGAGCCAGTGGAGATGCCGAAGAAGAAGAAACGAGGGCGTCCGAGAAAGAATGTCGCGACGAGAGCACCATGCAATGATCTTACGCCGGCAGCAATTCCTTCCCCAATTGCTTCTCGAACACCCGATGAAGAGGTCAAAGCAGATCACTTCAGCTTGGAAACCACGCCTCATGTTTCCACCCCTTCGAATTCAGAGCTGCCAAGTAGTGCAATTACAACATCAGGCCTGCCTTGCTCATACCCCGACCCTTATTCAAACACGGATTCTGATGTCAAAGTGGAAGAGGGAGGAGCTTTAGAATATCCACAAGTAAAGCGTCGGCGTGGACGCCCTCCCAAATATCAGAAAATGATAGAGAAGAAGTCTGGTGCAGCTAAGCAAAAAATTCGAAGCTTGTCCAAGAAACAGCAGCAGAGCCGCGAGGAGGAAGATTCTTGCAATAGCGATAAGGACGGACGATCCCAAGTCAAGAAGCGAGGTCCAGGACGTCCTCCTGGTTCCGGAAAGAAAAAATTTCTGAAGAGTGACTCGCCTTCATCAACTGGAGGTGGATCAGGTGTTCATCGTCAAGCATTACCCATCGAGGCTCAGATTCTACATATTCTTCCGGAAGAGGATGTAGCAAAGGTGGTGACCGATTTCTGTCAGAACGCTGGCCTTCCAATGTGTGTGATGTCTGCAAATGGTGAGATATCCACTATCCACTTCAAGAATGAAGTGAAACCCCGAGACGTTAGCACCATTCACCAGGGCCTGCGCGAGATCATTTCTATGTCTGGATGCGTCATGCCTCTAGATGGCGAAGGAGATAAGAGGTGGATTAGCAGATTCACAGTCTTGCTCGCTGACAGTGAAGGTCGAATCGTTGGAGGAGGTATTTCAGACTCCATGATTGCCGCATCCAAGGTGCAGGTGATTCTCGGGAGCTATCCTATTGCGGATGCACAAAATCATGAGGCTTCTGATTAG

Protein

>Mapoly0129s0052.1
MIDTDPPLDEQVLSRSMGTSLGAVDDLCVQSASTAATPADVEETALNAEEEEPVEMPKKKKRGRPRKNVATRAPCNDLTPAAIPSPIASRTPDEEVKADHFSLETTPHVSTPSNSELPSSAITTSGLPCSYPDPYSNTDSDVKVEEGGALEYPQVKRRRGRPPKYQKMIEKKSGAAKQKIRSLSKKQQQSREEEDSCNSDKDGRSQVKKRGPGRPPGSGKKKFLKSDSPSSTGGGSGVHRQALPIEAQILHILPEEDVAKVVTDFCQNAGLPMCVMSANGEISTIHFKNEVKPRDVSTIHQGLREIISMSGCVMPLDGEGDKRWISRFTVLLADSEGRIVGGGISDSMIAASKVQVILGSYPIADAQNHEASD

Mapoly0129s0052.2  

Gene structure:

mRNA scaffold_129:470650..473644  ( + strand )
five_prime_UTR scaffold_129:470650..470930  ( + strand )
CDS scaffold_129:470931..470946  ( + strand )
CDS scaffold_129:471240..471830  ( + strand )
CDS scaffold_129:472078..472136  ( + strand )
CDS scaffold_129:472239..472373  ( + strand )
CDS scaffold_129:472604..472765  ( + strand )
CDS scaffold_129:472993..473049  ( + strand )
three_prime_UTR scaffold_129:473050..473644  ( + strand )

Sequences:

Gene

>Mapoly0129s0052.2
ACTCATTAACTTGATCTAGATCAAGCTTATAAGTTGGATTTCTGGATTAGCTATTTTAACACGGATGGTAACGACATATGGAAATGAATTAAGGTTTCAATTCTTGTCCATTTTTCCGCTGCGCTTCCCTCTAATTCTGCTTGTCGAAGTCAAGAAGAAATACGAAATAGAGAGTTGAACTTCTTGCTGACGTCCATTAGGCTAATTAATCTTGCTTCATATGAAGCTTGTATTATTACGGTCTGGTCTTATCTAGAGAAGAGCAGGTGTAAATTGTGGTCATGGGCGAGAGTGGAGGTGAGCATGACGATAAAACACGGCAGCTTTGTGATTTTGATCTGTGGATGCATTGAATTCTAGAATTCCTCGAATAGGGATACAATTTTTGGTTTAAGATTTCCGGTCTGAACTTCGAAGACTTCGGAGTCTCACGCTTTTTGTATTTTGTGGGGGGCGTATTTCTAGATACTTCATGATTGATACCGATCCCCCGTTGGATGAGCAAGTCCTGTCGAGAAGCATGGGAACAAGTTTGGGTGCTGTTGACGATTTGTGTGTTCAATCTGCCTCTACCGCTGCTACTCCTGCAGATGTCGAAGAAACTGCATTGAACGCGGAGGAGGAGGAGCCAGTGGAGATGCCGAAGAAGAAGAAACGAGGGCGTCCGAGAAAGAATGTCGCGACGAGAGCACCATGCAATGATCTTACGCCGGCAGCAATTCCTTCCCCAATTGCTTCTCGAACACCCGATGAAGAGGTCAAAGCAGATCACTTCAGCTTGGAAACCACGCCTCATGTTTCCACCCCTTCGAATTCAGAGCTGCCAAGTAGTGCAATTACAACATCAGGCCTGCCTTGCTCATACCCCGACCCTTATTCAAACACGGATTCTGATGTCAAAGTGGAAGAGGGAGGAGCTTTAGAATATCCACAAGTAAAGCGTCGGCGTGGACGCCCTCCCAAATATCAGAAAATGATAGAGAAGAAGTCTGGTGCAGCTAAGCAAAAAATTCGAAGCTTGTCCAAGAAACAGCAGCAGAGCCGCGAGGAGGAAGATTCTTGCAATAGCGATAAGGACGGACGATCCCAAGTCAAGAAGCGAGGTCCAGGACGTCCTCCTGGTTCCGGAAAGAAAAAATTTCTGAAGAGTGACTCGCCTTCATCAACTGGAGGTGGATCAGGTTTGTGCTCCAGTTTCAGTCTTTGTTTCGCTACAAGATAGTTGGCAAAAGGCGAATCGTTACGTCTCGTCATGATTCAGTGCGTAAAACACCACGTCTGAAACATAAGGATCGAATGTTCTGCTCCATTCATTAGATAGAGGGCGGGCTTTTAGCCGCTTGATATTGGTTCGTCCAAGTGTGTCAAAGAATTCATGCTTCTGGTTTCAATGTGCTTGAAACACATGCTCATAGTTTGCTGGTGTAGGTGTTCATCGTCAAGCATTACCCATCGAGGCTCAGATTCTACATATTCTTCCGGAAGAGGTTGGTGAATTTTCCAGCAGCGTGCTCGCTTCCCTTTTGCATTTCTTTCTTGTGCTGTCCTGATGTTGCTGAGTTTTGTGATTTTTTTTTCCCATAAACAAGGATGTAGCAAAGGTGGTGACCGATTTCTGTCAGAACGCTGGCCTTCCAATGTGTGTGATGTCTGCAAATGGTGAGATATCCACTATCCACTTCAAGAATGAAGTGAAACCCCGAGACGTTAGCACCATTCACCAGGTGATAATTCACGCATGAAAGAGCGACGAAAATTGTATCAGTTGTGGAAATTGTACATTCTAGTATGGTAAATTTGTCTGAATTTTTCTGGCGAATTTTTCCGTCTTTATTTAATAGTCTTGAGAATATACACAACCTCAACCATACTCGAGGTTGTGTGAAGCTTTCGAATTCCTGTGTTACGAGGGTGCAAGGCTCCTGAGAAGCAACTGACATGAAACTGTTAGCAGGGCCTGCGCGAGATCATTTCTATGTCTGGATGCGTCATGCCTCTAGATGGCGAAGGAGATAAGAGGTGGATTAGCAGATTCACAGTCTTGCTCGCTGACAGTGAAGGTCGAATCGTTGGAGGAGGTATTTCAGACTCCATGATTGCCGCATCCAAGGTGCAGGTAATATGCGTGTGCCATCCAAAGTGTGCGGTGATCCTCTAGCGAGATCTATCGGCTTCTGTCATTTAGCAAGATCGTTTCAATTTGGTTCAATAAATAGGGAATTGAAATGCTTACGATGTGTCAATCATTGCTAAATCATCTCAATATTGTCAATTGTAAAGCCCGTTGAATTCTCTTGGAGAATTTATATGTGGATCTCTTACACGTTTCTTGTGCCAATACAGGTGATTCTCGGGAGCTATCCTATTGCGGATGCACAAAATCATGAGGCTTCTGATTAGCTTAGCACAAAGAACAGGTTGGGAATCCGTAAAAGACAATTTAGCACATTACGTGCCTGCAGTTAGACTCAGTAGATTACATGCCTGAAATGTAAGTATATGGTTATGGCTTCGACACGAGGGTGACGAATAATTCATAATCACAACGGGAGAGACATATTATAGCTGCACGCATCTAAGACCCAGATATCACCAACACTGGTTCTCTTGCGACAGAAAAGTCATGCTAACGTATCTTTTCCGCAATATTGCTTTTCCATCTACGAACGAGACATTTGTCATTCATATCTTTTTCTGTTCCCAAGGTGTAGACCTTGGGAAAGAAAGTCGGATGTAGCCGGTTGTTAGACTTGAGTCACATAAAGTAGATGTGCACTGGATTATCATAGATTTGTAAGTTAGAATTAGAGTGTTCGCAATGCTTCACGACTCAGCAGGTGGAAACTGCCGCTTACATGTACGCAGTGAAGTCTATTTGAATGCGAGGAATACAGCAGAAGATGCTAAAATGAAATTACAGTGGATTCGGCTCGGACAACTGGACTATTATGAGTGATCAACAGGATCACTCATGCGTCACGATTCTTTCATAACG

mRNA

>Mapoly0129s0052.2
ACTCATTAACTTGATCTAGATCAAGCTTATAAGTTGGATTTCTGGATTAGCTATTTTAACACGGATGGTAACGACATATGGAAATGAATTAAGGTTTCAATTCTTGTCCATTTTTCCGCTGCGCTTCCCTCTAATTCTGCTTGTCGAAGTCAAGAAGAAATACGAAATAGAGAGTTGAACTTCTTGCTGACGTCCATTAGGCTAATTAATCTTGCTTCATATGAAGCTTGTATTATTACGGTCTGGTCTTATCTAGAGAAGAGCAGGTGTAAATTGTGGTCATGGGCGAGAGTGGAGATGTCGAAGAAACTGCATTGAACGCGGAGGAGGAGGAGCCAGTGGAGATGCCGAAGAAGAAGAAACGAGGGCGTCCGAGAAAGAATGTCGCGACGAGAGCACCATGCAATGATCTTACGCCGGCAGCAATTCCTTCCCCAATTGCTTCTCGAACACCCGATGAAGAGGTCAAAGCAGATCACTTCAGCTTGGAAACCACGCCTCATGTTTCCACCCCTTCGAATTCAGAGCTGCCAAGTAGTGCAATTACAACATCAGGCCTGCCTTGCTCATACCCCGACCCTTATTCAAACACGGATTCTGATGTCAAAGTGGAAGAGGGAGGAGCTTTAGAATATCCACAAGTAAAGCGTCGGCGTGGACGCCCTCCCAAATATCAGAAAATGATAGAGAAGAAGTCTGGTGCAGCTAAGCAAAAAATTCGAAGCTTGTCCAAGAAACAGCAGCAGAGCCGCGAGGAGGAAGATTCTTGCAATAGCGATAAGGACGGACGATCCCAAGTCAAGAAGCGAGGTCCAGGACGTCCTCCTGGTTCCGGAAAGAAAAAATTTCTGAAGAGTGACTCGCCTTCATCAACTGGAGGTGGATCAGGTGTTCATCGTCAAGCATTACCCATCGAGGCTCAGATTCTACATATTCTTCCGGAAGAGGATGTAGCAAAGGTGGTGACCGATTTCTGTCAGAACGCTGGCCTTCCAATGTGTGTGATGTCTGCAAATGGTGAGATATCCACTATCCACTTCAAGAATGAAGTGAAACCCCGAGACGTTAGCACCATTCACCAGGGCCTGCGCGAGATCATTTCTATGTCTGGATGCGTCATGCCTCTAGATGGCGAAGGAGATAAGAGGTGGATTAGCAGATTCACAGTCTTGCTCGCTGACAGTGAAGGTCGAATCGTTGGAGGAGGTATTTCAGACTCCATGATTGCCGCATCCAAGGTGCAGGTGATTCTCGGGAGCTATCCTATTGCGGATGCACAAAATCATGAGGCTTCTGATTAGCTTAGCACAAAGAACAGGTTGGGAATCCGTAAAAGACAATTTAGCACATTACGTGCCTGCAGTTAGACTCAGTAGATTACATGCCTGAAATGTAAGTATATGGTTATGGCTTCGACACGAGGGTGACGAATAATTCATAATCACAACGGGAGAGACATATTATAGCTGCACGCATCTAAGACCCAGATATCACCAACACTGGTTCTCTTGCGACAGAAAAGTCATGCTAACGTATCTTTTCCGCAATATTGCTTTTCCATCTACGAACGAGACATTTGTCATTCATATCTTTTTCTGTTCCCAAGGTGTAGACCTTGGGAAAGAAAGTCGGATGTAGCCGGTTGTTAGACTTGAGTCACATAAAGTAGATGTGCACTGGATTATCATAGATTTGTAAGTTAGAATTAGAGTGTTCGCAATGCTTCACGACTCAGCAGGTGGAAACTGCCGCTTACATGTACGCAGTGAAGTCTATTTGAATGCGAGGAATACAGCAGAAGATGCTAAAATGAAATTACAGTGGATTCGGCTCGGACAACTGGACTATTATGAGTGATCAACAGGATCACTCATGCGTCACGATTCTTTCATAACG

CDS

>Mapoly0129s0052.2
ATGGGCGAGAGTGGAGATGTCGAAGAAACTGCATTGAACGCGGAGGAGGAGGAGCCAGTGGAGATGCCGAAGAAGAAGAAACGAGGGCGTCCGAGAAAGAATGTCGCGACGAGAGCACCATGCAATGATCTTACGCCGGCAGCAATTCCTTCCCCAATTGCTTCTCGAACACCCGATGAAGAGGTCAAAGCAGATCACTTCAGCTTGGAAACCACGCCTCATGTTTCCACCCCTTCGAATTCAGAGCTGCCAAGTAGTGCAATTACAACATCAGGCCTGCCTTGCTCATACCCCGACCCTTATTCAAACACGGATTCTGATGTCAAAGTGGAAGAGGGAGGAGCTTTAGAATATCCACAAGTAAAGCGTCGGCGTGGACGCCCTCCCAAATATCAGAAAATGATAGAGAAGAAGTCTGGTGCAGCTAAGCAAAAAATTCGAAGCTTGTCCAAGAAACAGCAGCAGAGCCGCGAGGAGGAAGATTCTTGCAATAGCGATAAGGACGGACGATCCCAAGTCAAGAAGCGAGGTCCAGGACGTCCTCCTGGTTCCGGAAAGAAAAAATTTCTGAAGAGTGACTCGCCTTCATCAACTGGAGGTGGATCAGGTGTTCATCGTCAAGCATTACCCATCGAGGCTCAGATTCTACATATTCTTCCGGAAGAGGATGTAGCAAAGGTGGTGACCGATTTCTGTCAGAACGCTGGCCTTCCAATGTGTGTGATGTCTGCAAATGGTGAGATATCCACTATCCACTTCAAGAATGAAGTGAAACCCCGAGACGTTAGCACCATTCACCAGGGCCTGCGCGAGATCATTTCTATGTCTGGATGCGTCATGCCTCTAGATGGCGAAGGAGATAAGAGGTGGATTAGCAGATTCACAGTCTTGCTCGCTGACAGTGAAGGTCGAATCGTTGGAGGAGGTATTTCAGACTCCATGATTGCCGCATCCAAGGTGCAGGTGATTCTCGGGAGCTATCCTATTGCGGATGCACAAAATCATGAGGCTTCTGATTAG

Protein

>Mapoly0129s0052.2
MGESGDVEETALNAEEEEPVEMPKKKKRGRPRKNVATRAPCNDLTPAAIPSPIASRTPDEEVKADHFSLETTPHVSTPSNSELPSSAITTSGLPCSYPDPYSNTDSDVKVEEGGALEYPQVKRRRGRPPKYQKMIEKKSGAAKQKIRSLSKKQQQSREEEDSCNSDKDGRSQVKKRGPGRPPGSGKKKFLKSDSPSSTGGGSGVHRQALPIEAQILHILPEEDVAKVVTDFCQNAGLPMCVMSANGEISTIHFKNEVKPRDVSTIHQGLREIISMSGCVMPLDGEGDKRWISRFTVLLADSEGRIVGGGISDSMIAASKVQVILGSYPIADAQNHEASD

Mapoly0129s0052.3  

Gene structure:

mRNA scaffold_129:470650..473644  ( + strand )
five_prime_UTR scaffold_129:470650..470930  ( + strand )
CDS scaffold_129:470931..470946  ( + strand )
CDS scaffold_129:471240..471830  ( + strand )
CDS scaffold_129:472078..472136  ( + strand )
CDS scaffold_129:472604..472765  ( + strand )
CDS scaffold_129:472993..473049  ( + strand )
three_prime_UTR scaffold_129:473050..473644  ( + strand )

Sequences:

Gene

>Mapoly0129s0052.3
ACTCATTAACTTGATCTAGATCAAGCTTATAAGTTGGATTTCTGGATTAGCTATTTTAACACGGATGGTAACGACATATGGAAATGAATTAAGGTTTCAATTCTTGTCCATTTTTCCGCTGCGCTTCCCTCTAATTCTGCTTGTCGAAGTCAAGAAGAAATACGAAATAGAGAGTTGAACTTCTTGCTGACGTCCATTAGGCTAATTAATCTTGCTTCATATGAAGCTTGTATTATTACGGTCTGGTCTTATCTAGAGAAGAGCAGGTGTAAATTGTGGTCATGGGCGAGAGTGGAGGTGAGCATGACGATAAAACACGGCAGCTTTGTGATTTTGATCTGTGGATGCATTGAATTCTAGAATTCCTCGAATAGGGATACAATTTTTGGTTTAAGATTTCCGGTCTGAACTTCGAAGACTTCGGAGTCTCACGCTTTTTGTATTTTGTGGGGGGCGTATTTCTAGATACTTCATGATTGATACCGATCCCCCGTTGGATGAGCAAGTCCTGTCGAGAAGCATGGGAACAAGTTTGGGTGCTGTTGACGATTTGTGTGTTCAATCTGCCTCTACCGCTGCTACTCCTGCAGATGTCGAAGAAACTGCATTGAACGCGGAGGAGGAGGAGCCAGTGGAGATGCCGAAGAAGAAGAAACGAGGGCGTCCGAGAAAGAATGTCGCGACGAGAGCACCATGCAATGATCTTACGCCGGCAGCAATTCCTTCCCCAATTGCTTCTCGAACACCCGATGAAGAGGTCAAAGCAGATCACTTCAGCTTGGAAACCACGCCTCATGTTTCCACCCCTTCGAATTCAGAGCTGCCAAGTAGTGCAATTACAACATCAGGCCTGCCTTGCTCATACCCCGACCCTTATTCAAACACGGATTCTGATGTCAAAGTGGAAGAGGGAGGAGCTTTAGAATATCCACAAGTAAAGCGTCGGCGTGGACGCCCTCCCAAATATCAGAAAATGATAGAGAAGAAGTCTGGTGCAGCTAAGCAAAAAATTCGAAGCTTGTCCAAGAAACAGCAGCAGAGCCGCGAGGAGGAAGATTCTTGCAATAGCGATAAGGACGGACGATCCCAAGTCAAGAAGCGAGGTCCAGGACGTCCTCCTGGTTCCGGAAAGAAAAAATTTCTGAAGAGTGACTCGCCTTCATCAACTGGAGGTGGATCAGGTTTGTGCTCCAGTTTCAGTCTTTGTTTCGCTACAAGATAGTTGGCAAAAGGCGAATCGTTACGTCTCGTCATGATTCAGTGCGTAAAACACCACGTCTGAAACATAAGGATCGAATGTTCTGCTCCATTCATTAGATAGAGGGCGGGCTTTTAGCCGCTTGATATTGGTTCGTCCAAGTGTGTCAAAGAATTCATGCTTCTGGTTTCAATGTGCTTGAAACACATGCTCATAGTTTGCTGGTGTAGGTGTTCATCGTCAAGCATTACCCATCGAGGCTCAGATTCTACATATTCTTCCGGAAGAGGTTGGTGAATTTTCCAGCAGCGTGCTCGCTTCCCTTTTGCATTTCTTTCTTGTGCTGTCCTGATGTTGCTGAGTTTTGTGATTTTTTTTTCCCATAAACAAGGATGTAGCAAAGGTGGTGACCGATTTCTGTCAGAACGCTGGCCTTCCAATGTGTGTGATGTCTGCAAATGGTGAGATATCCACTATCCACTTCAAGAATGAAGTGAAACCCCGAGACGTTAGCACCATTCACCAGGTGATAATTCACGCATGAAAGAGCGACGAAAATTGTATCAGTTGTGGAAATTGTACATTCTAGTATGGTAAATTTGTCTGAATTTTTCTGGCGAATTTTTCCGTCTTTATTTAATAGTCTTGAGAATATACACAACCTCAACCATACTCGAGGTTGTGTGAAGCTTTCGAATTCCTGTGTTACGAGGGTGCAAGGCTCCTGAGAAGCAACTGACATGAAACTGTTAGCAGGGCCTGCGCGAGATCATTTCTATGTCTGGATGCGTCATGCCTCTAGATGGCGAAGGAGATAAGAGGTGGATTAGCAGATTCACAGTCTTGCTCGCTGACAGTGAAGGTCGAATCGTTGGAGGAGGTATTTCAGACTCCATGATTGCCGCATCCAAGGTGCAGGTAATATGCGTGTGCCATCCAAAGTGTGCGGTGATCCTCTAGCGAGATCTATCGGCTTCTGTCATTTAGCAAGATCGTTTCAATTTGGTTCAATAAATAGGGAATTGAAATGCTTACGATGTGTCAATCATTGCTAAATCATCTCAATATTGTCAATTGTAAAGCCCGTTGAATTCTCTTGGAGAATTTATATGTGGATCTCTTACACGTTTCTTGTGCCAATACAGGTGATTCTCGGGAGCTATCCTATTGCGGATGCACAAAATCATGAGGCTTCTGATTAGCTTAGCACAAAGAACAGGTTGGGAATCCGTAAAAGACAATTTAGCACATTACGTGCCTGCAGTTAGACTCAGTAGATTACATGCCTGAAATGTAAGTATATGGTTATGGCTTCGACACGAGGGTGACGAATAATTCATAATCACAACGGGAGAGACATATTATAGCTGCACGCATCTAAGACCCAGATATCACCAACACTGGTTCTCTTGCGACAGAAAAGTCATGCTAACGTATCTTTTCCGCAATATTGCTTTTCCATCTACGAACGAGACATTTGTCATTCATATCTTTTTCTGTTCCCAAGGTGTAGACCTTGGGAAAGAAAGTCGGATGTAGCCGGTTGTTAGACTTGAGTCACATAAAGTAGATGTGCACTGGATTATCATAGATTTGTAAGTTAGAATTAGAGTGTTCGCAATGCTTCACGACTCAGCAGGTGGAAACTGCCGCTTACATGTACGCAGTGAAGTCTATTTGAATGCGAGGAATACAGCAGAAGATGCTAAAATGAAATTACAGTGGATTCGGCTCGGACAACTGGACTATTATGAGTGATCAACAGGATCACTCATGCGTCACGATTCTTTCATAACG

mRNA

>Mapoly0129s0052.3
ACTCATTAACTTGATCTAGATCAAGCTTATAAGTTGGATTTCTGGATTAGCTATTTTAACACGGATGGTAACGACATATGGAAATGAATTAAGGTTTCAATTCTTGTCCATTTTTCCGCTGCGCTTCCCTCTAATTCTGCTTGTCGAAGTCAAGAAGAAATACGAAATAGAGAGTTGAACTTCTTGCTGACGTCCATTAGGCTAATTAATCTTGCTTCATATGAAGCTTGTATTATTACGGTCTGGTCTTATCTAGAGAAGAGCAGGTGTAAATTGTGGTCATGGGCGAGAGTGGAGATGTCGAAGAAACTGCATTGAACGCGGAGGAGGAGGAGCCAGTGGAGATGCCGAAGAAGAAGAAACGAGGGCGTCCGAGAAAGAATGTCGCGACGAGAGCACCATGCAATGATCTTACGCCGGCAGCAATTCCTTCCCCAATTGCTTCTCGAACACCCGATGAAGAGGTCAAAGCAGATCACTTCAGCTTGGAAACCACGCCTCATGTTTCCACCCCTTCGAATTCAGAGCTGCCAAGTAGTGCAATTACAACATCAGGCCTGCCTTGCTCATACCCCGACCCTTATTCAAACACGGATTCTGATGTCAAAGTGGAAGAGGGAGGAGCTTTAGAATATCCACAAGTAAAGCGTCGGCGTGGACGCCCTCCCAAATATCAGAAAATGATAGAGAAGAAGTCTGGTGCAGCTAAGCAAAAAATTCGAAGCTTGTCCAAGAAACAGCAGCAGAGCCGCGAGGAGGAAGATTCTTGCAATAGCGATAAGGACGGACGATCCCAAGTCAAGAAGCGAGGTCCAGGACGTCCTCCTGGTTCCGGAAAGAAAAAATTTCTGAAGAGTGACTCGCCTTCATCAACTGGAGGTGGATCAGGTGTTCATCGTCAAGCATTACCCATCGAGGCTCAGATTCTACATATTCTTCCGGAAGAGGGCCTGCGCGAGATCATTTCTATGTCTGGATGCGTCATGCCTCTAGATGGCGAAGGAGATAAGAGGTGGATTAGCAGATTCACAGTCTTGCTCGCTGACAGTGAAGGTCGAATCGTTGGAGGAGGTATTTCAGACTCCATGATTGCCGCATCCAAGGTGCAGGTGATTCTCGGGAGCTATCCTATTGCGGATGCACAAAATCATGAGGCTTCTGATTAGCTTAGCACAAAGAACAGGTTGGGAATCCGTAAAAGACAATTTAGCACATTACGTGCCTGCAGTTAGACTCAGTAGATTACATGCCTGAAATGTAAGTATATGGTTATGGCTTCGACACGAGGGTGACGAATAATTCATAATCACAACGGGAGAGACATATTATAGCTGCACGCATCTAAGACCCAGATATCACCAACACTGGTTCTCTTGCGACAGAAAAGTCATGCTAACGTATCTTTTCCGCAATATTGCTTTTCCATCTACGAACGAGACATTTGTCATTCATATCTTTTTCTGTTCCCAAGGTGTAGACCTTGGGAAAGAAAGTCGGATGTAGCCGGTTGTTAGACTTGAGTCACATAAAGTAGATGTGCACTGGATTATCATAGATTTGTAAGTTAGAATTAGAGTGTTCGCAATGCTTCACGACTCAGCAGGTGGAAACTGCCGCTTACATGTACGCAGTGAAGTCTATTTGAATGCGAGGAATACAGCAGAAGATGCTAAAATGAAATTACAGTGGATTCGGCTCGGACAACTGGACTATTATGAGTGATCAACAGGATCACTCATGCGTCACGATTCTTTCATAACG

CDS

>Mapoly0129s0052.3
ATGGGCGAGAGTGGAGATGTCGAAGAAACTGCATTGAACGCGGAGGAGGAGGAGCCAGTGGAGATGCCGAAGAAGAAGAAACGAGGGCGTCCGAGAAAGAATGTCGCGACGAGAGCACCATGCAATGATCTTACGCCGGCAGCAATTCCTTCCCCAATTGCTTCTCGAACACCCGATGAAGAGGTCAAAGCAGATCACTTCAGCTTGGAAACCACGCCTCATGTTTCCACCCCTTCGAATTCAGAGCTGCCAAGTAGTGCAATTACAACATCAGGCCTGCCTTGCTCATACCCCGACCCTTATTCAAACACGGATTCTGATGTCAAAGTGGAAGAGGGAGGAGCTTTAGAATATCCACAAGTAAAGCGTCGGCGTGGACGCCCTCCCAAATATCAGAAAATGATAGAGAAGAAGTCTGGTGCAGCTAAGCAAAAAATTCGAAGCTTGTCCAAGAAACAGCAGCAGAGCCGCGAGGAGGAAGATTCTTGCAATAGCGATAAGGACGGACGATCCCAAGTCAAGAAGCGAGGTCCAGGACGTCCTCCTGGTTCCGGAAAGAAAAAATTTCTGAAGAGTGACTCGCCTTCATCAACTGGAGGTGGATCAGGTGTTCATCGTCAAGCATTACCCATCGAGGCTCAGATTCTACATATTCTTCCGGAAGAGGGCCTGCGCGAGATCATTTCTATGTCTGGATGCGTCATGCCTCTAGATGGCGAAGGAGATAAGAGGTGGATTAGCAGATTCACAGTCTTGCTCGCTGACAGTGAAGGTCGAATCGTTGGAGGAGGTATTTCAGACTCCATGATTGCCGCATCCAAGGTGCAGGTGATTCTCGGGAGCTATCCTATTGCGGATGCACAAAATCATGAGGCTTCTGATTAG

Protein

>Mapoly0129s0052.3
MGESGDVEETALNAEEEEPVEMPKKKKRGRPRKNVATRAPCNDLTPAAIPSPIASRTPDEEVKADHFSLETTPHVSTPSNSELPSSAITTSGLPCSYPDPYSNTDSDVKVEEGGALEYPQVKRRRGRPPKYQKMIEKKSGAAKQKIRSLSKKQQQSREEEDSCNSDKDGRSQVKKRGPGRPPGSGKKKFLKSDSPSSTGGGSGVHRQALPIEAQILHILPEEGLREIISMSGCVMPLDGEGDKRWISRFTVLLADSEGRIVGGGISDSMIAASKVQVILGSYPIADAQNHEASD

Mapoly0129s0052.4  

Gene structure:

mRNA scaffold_129:470976..473644  ( + strand )
five_prime_UTR scaffold_129:470976..471121  ( + strand )
CDS scaffold_129:471122..471830  ( + strand )
CDS scaffold_129:472078..472136  ( + strand )
CDS scaffold_129:472604..472765  ( + strand )
CDS scaffold_129:472993..473049  ( + strand )
three_prime_UTR scaffold_129:473050..473644  ( + strand )

Sequences:

Gene

>Mapoly0129s0052.4
TGTGATTTTGATCTGTGGATGCATTGAATTCTAGAATTCCTCGAATAGGGATACAATTTTTGGTTTAAGATTTCCGGTCTGAACTTCGAAGACTTCGGAGTCTCACGCTTTTTGTATTTTGTGGGGGGCGTATTTCTAGATACTTCATGATTGATACCGATCCCCCGTTGGATGAGCAAGTCCTGTCGAGAAGCATGGGAACAAGTTTGGGTGCTGTTGACGATTTGTGTGTTCAATCTGCCTCTACCGCTGCTACTCCTGCAGATGTCGAAGAAACTGCATTGAACGCGGAGGAGGAGGAGCCAGTGGAGATGCCGAAGAAGAAGAAACGAGGGCGTCCGAGAAAGAATGTCGCGACGAGAGCACCATGCAATGATCTTACGCCGGCAGCAATTCCTTCCCCAATTGCTTCTCGAACACCCGATGAAGAGGTCAAAGCAGATCACTTCAGCTTGGAAACCACGCCTCATGTTTCCACCCCTTCGAATTCAGAGCTGCCAAGTAGTGCAATTACAACATCAGGCCTGCCTTGCTCATACCCCGACCCTTATTCAAACACGGATTCTGATGTCAAAGTGGAAGAGGGAGGAGCTTTAGAATATCCACAAGTAAAGCGTCGGCGTGGACGCCCTCCCAAATATCAGAAAATGATAGAGAAGAAGTCTGGTGCAGCTAAGCAAAAAATTCGAAGCTTGTCCAAGAAACAGCAGCAGAGCCGCGAGGAGGAAGATTCTTGCAATAGCGATAAGGACGGACGATCCCAAGTCAAGAAGCGAGGTCCAGGACGTCCTCCTGGTTCCGGAAAGAAAAAATTTCTGAAGAGTGACTCGCCTTCATCAACTGGAGGTGGATCAGGTTTGTGCTCCAGTTTCAGTCTTTGTTTCGCTACAAGATAGTTGGCAAAAGGCGAATCGTTACGTCTCGTCATGATTCAGTGCGTAAAACACCACGTCTGAAACATAAGGATCGAATGTTCTGCTCCATTCATTAGATAGAGGGCGGGCTTTTAGCCGCTTGATATTGGTTCGTCCAAGTGTGTCAAAGAATTCATGCTTCTGGTTTCAATGTGCTTGAAACACATGCTCATAGTTTGCTGGTGTAGGTGTTCATCGTCAAGCATTACCCATCGAGGCTCAGATTCTACATATTCTTCCGGAAGAGGTTGGTGAATTTTCCAGCAGCGTGCTCGCTTCCCTTTTGCATTTCTTTCTTGTGCTGTCCTGATGTTGCTGAGTTTTGTGATTTTTTTTTCCCATAAACAAGGATGTAGCAAAGGTGGTGACCGATTTCTGTCAGAACGCTGGCCTTCCAATGTGTGTGATGTCTGCAAATGGTGAGATATCCACTATCCACTTCAAGAATGAAGTGAAACCCCGAGACGTTAGCACCATTCACCAGGTGATAATTCACGCATGAAAGAGCGACGAAAATTGTATCAGTTGTGGAAATTGTACATTCTAGTATGGTAAATTTGTCTGAATTTTTCTGGCGAATTTTTCCGTCTTTATTTAATAGTCTTGAGAATATACACAACCTCAACCATACTCGAGGTTGTGTGAAGCTTTCGAATTCCTGTGTTACGAGGGTGCAAGGCTCCTGAGAAGCAACTGACATGAAACTGTTAGCAGGGCCTGCGCGAGATCATTTCTATGTCTGGATGCGTCATGCCTCTAGATGGCGAAGGAGATAAGAGGTGGATTAGCAGATTCACAGTCTTGCTCGCTGACAGTGAAGGTCGAATCGTTGGAGGAGGTATTTCAGACTCCATGATTGCCGCATCCAAGGTGCAGGTAATATGCGTGTGCCATCCAAAGTGTGCGGTGATCCTCTAGCGAGATCTATCGGCTTCTGTCATTTAGCAAGATCGTTTCAATTTGGTTCAATAAATAGGGAATTGAAATGCTTACGATGTGTCAATCATTGCTAAATCATCTCAATATTGTCAATTGTAAAGCCCGTTGAATTCTCTTGGAGAATTTATATGTGGATCTCTTACACGTTTCTTGTGCCAATACAGGTGATTCTCGGGAGCTATCCTATTGCGGATGCACAAAATCATGAGGCTTCTGATTAGCTTAGCACAAAGAACAGGTTGGGAATCCGTAAAAGACAATTTAGCACATTACGTGCCTGCAGTTAGACTCAGTAGATTACATGCCTGAAATGTAAGTATATGGTTATGGCTTCGACACGAGGGTGACGAATAATTCATAATCACAACGGGAGAGACATATTATAGCTGCACGCATCTAAGACCCAGATATCACCAACACTGGTTCTCTTGCGACAGAAAAGTCATGCTAACGTATCTTTTCCGCAATATTGCTTTTCCATCTACGAACGAGACATTTGTCATTCATATCTTTTTCTGTTCCCAAGGTGTAGACCTTGGGAAAGAAAGTCGGATGTAGCCGGTTGTTAGACTTGAGTCACATAAAGTAGATGTGCACTGGATTATCATAGATTTGTAAGTTAGAATTAGAGTGTTCGCAATGCTTCACGACTCAGCAGGTGGAAACTGCCGCTTACATGTACGCAGTGAAGTCTATTTGAATGCGAGGAATACAGCAGAAGATGCTAAAATGAAATTACAGTGGATTCGGCTCGGACAACTGGACTATTATGAGTGATCAACAGGATCACTCATGCGTCACGATTCTTTCATAACG

mRNA

>Mapoly0129s0052.4
TGTGATTTTGATCTGTGGATGCATTGAATTCTAGAATTCCTCGAATAGGGATACAATTTTTGGTTTAAGATTTCCGGTCTGAACTTCGAAGACTTCGGAGTCTCACGCTTTTTGTATTTTGTGGGGGGCGTATTTCTAGATACTTCATGATTGATACCGATCCCCCGTTGGATGAGCAAGTCCTGTCGAGAAGCATGGGAACAAGTTTGGGTGCTGTTGACGATTTGTGTGTTCAATCTGCCTCTACCGCTGCTACTCCTGCAGATGTCGAAGAAACTGCATTGAACGCGGAGGAGGAGGAGCCAGTGGAGATGCCGAAGAAGAAGAAACGAGGGCGTCCGAGAAAGAATGTCGCGACGAGAGCACCATGCAATGATCTTACGCCGGCAGCAATTCCTTCCCCAATTGCTTCTCGAACACCCGATGAAGAGGTCAAAGCAGATCACTTCAGCTTGGAAACCACGCCTCATGTTTCCACCCCTTCGAATTCAGAGCTGCCAAGTAGTGCAATTACAACATCAGGCCTGCCTTGCTCATACCCCGACCCTTATTCAAACACGGATTCTGATGTCAAAGTGGAAGAGGGAGGAGCTTTAGAATATCCACAAGTAAAGCGTCGGCGTGGACGCCCTCCCAAATATCAGAAAATGATAGAGAAGAAGTCTGGTGCAGCTAAGCAAAAAATTCGAAGCTTGTCCAAGAAACAGCAGCAGAGCCGCGAGGAGGAAGATTCTTGCAATAGCGATAAGGACGGACGATCCCAAGTCAAGAAGCGAGGTCCAGGACGTCCTCCTGGTTCCGGAAAGAAAAAATTTCTGAAGAGTGACTCGCCTTCATCAACTGGAGGTGGATCAGGTGTTCATCGTCAAGCATTACCCATCGAGGCTCAGATTCTACATATTCTTCCGGAAGAGGGCCTGCGCGAGATCATTTCTATGTCTGGATGCGTCATGCCTCTAGATGGCGAAGGAGATAAGAGGTGGATTAGCAGATTCACAGTCTTGCTCGCTGACAGTGAAGGTCGAATCGTTGGAGGAGGTATTTCAGACTCCATGATTGCCGCATCCAAGGTGCAGGTGATTCTCGGGAGCTATCCTATTGCGGATGCACAAAATCATGAGGCTTCTGATTAGCTTAGCACAAAGAACAGGTTGGGAATCCGTAAAAGACAATTTAGCACATTACGTGCCTGCAGTTAGACTCAGTAGATTACATGCCTGAAATGTAAGTATATGGTTATGGCTTCGACACGAGGGTGACGAATAATTCATAATCACAACGGGAGAGACATATTATAGCTGCACGCATCTAAGACCCAGATATCACCAACACTGGTTCTCTTGCGACAGAAAAGTCATGCTAACGTATCTTTTCCGCAATATTGCTTTTCCATCTACGAACGAGACATTTGTCATTCATATCTTTTTCTGTTCCCAAGGTGTAGACCTTGGGAAAGAAAGTCGGATGTAGCCGGTTGTTAGACTTGAGTCACATAAAGTAGATGTGCACTGGATTATCATAGATTTGTAAGTTAGAATTAGAGTGTTCGCAATGCTTCACGACTCAGCAGGTGGAAACTGCCGCTTACATGTACGCAGTGAAGTCTATTTGAATGCGAGGAATACAGCAGAAGATGCTAAAATGAAATTACAGTGGATTCGGCTCGGACAACTGGACTATTATGAGTGATCAACAGGATCACTCATGCGTCACGATTCTTTCATAACG

CDS

>Mapoly0129s0052.4
ATGATTGATACCGATCCCCCGTTGGATGAGCAAGTCCTGTCGAGAAGCATGGGAACAAGTTTGGGTGCTGTTGACGATTTGTGTGTTCAATCTGCCTCTACCGCTGCTACTCCTGCAGATGTCGAAGAAACTGCATTGAACGCGGAGGAGGAGGAGCCAGTGGAGATGCCGAAGAAGAAGAAACGAGGGCGTCCGAGAAAGAATGTCGCGACGAGAGCACCATGCAATGATCTTACGCCGGCAGCAATTCCTTCCCCAATTGCTTCTCGAACACCCGATGAAGAGGTCAAAGCAGATCACTTCAGCTTGGAAACCACGCCTCATGTTTCCACCCCTTCGAATTCAGAGCTGCCAAGTAGTGCAATTACAACATCAGGCCTGCCTTGCTCATACCCCGACCCTTATTCAAACACGGATTCTGATGTCAAAGTGGAAGAGGGAGGAGCTTTAGAATATCCACAAGTAAAGCGTCGGCGTGGACGCCCTCCCAAATATCAGAAAATGATAGAGAAGAAGTCTGGTGCAGCTAAGCAAAAAATTCGAAGCTTGTCCAAGAAACAGCAGCAGAGCCGCGAGGAGGAAGATTCTTGCAATAGCGATAAGGACGGACGATCCCAAGTCAAGAAGCGAGGTCCAGGACGTCCTCCTGGTTCCGGAAAGAAAAAATTTCTGAAGAGTGACTCGCCTTCATCAACTGGAGGTGGATCAGGTGTTCATCGTCAAGCATTACCCATCGAGGCTCAGATTCTACATATTCTTCCGGAAGAGGGCCTGCGCGAGATCATTTCTATGTCTGGATGCGTCATGCCTCTAGATGGCGAAGGAGATAAGAGGTGGATTAGCAGATTCACAGTCTTGCTCGCTGACAGTGAAGGTCGAATCGTTGGAGGAGGTATTTCAGACTCCATGATTGCCGCATCCAAGGTGCAGGTGATTCTCGGGAGCTATCCTATTGCGGATGCACAAAATCATGAGGCTTCTGATTAG

Protein

>Mapoly0129s0052.4
MIDTDPPLDEQVLSRSMGTSLGAVDDLCVQSASTAATPADVEETALNAEEEEPVEMPKKKKRGRPRKNVATRAPCNDLTPAAIPSPIASRTPDEEVKADHFSLETTPHVSTPSNSELPSSAITTSGLPCSYPDPYSNTDSDVKVEEGGALEYPQVKRRRGRPPKYQKMIEKKSGAAKQKIRSLSKKQQQSREEEDSCNSDKDGRSQVKKRGPGRPPGSGKKKFLKSDSPSSTGGGSGVHRQALPIEAQILHILPEEGLREIISMSGCVMPLDGEGDKRWISRFTVLLADSEGRIVGGGISDSMIAASKVQVILGSYPIADAQNHEASD

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>