Mapoly0134s0007



Description

Domain of unknown function (DUF4281)

Reference DB

Database ID Description
OrthoMCL OG5_141691
PFAM PF14108 Domain of unknown function (DUF4281)

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpABA4 neoxanthin synthase Mapoly0134s0007.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0134s0007.1 scaffold_134:65189..69438  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
Mapoly0134s0007.2 scaffold_134:65189..69532  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
Mapoly0134s0007.3 scaffold_134:65257..69418  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0134s0007.1  

Gene structure:

mRNA scaffold_134:65189..69438  ( - strand )
three_prime_UTR scaffold_134:65189..66063  ( - strand )
CDS scaffold_134:66064..66138  ( - strand )
CDS scaffold_134:66338..66443  ( - strand )
CDS scaffold_134:66593..66681  ( - strand )
CDS scaffold_134:66877..67005  ( - strand )
CDS scaffold_134:67257..67438  ( - strand )
CDS scaffold_134:67692..67923  ( - strand )
CDS scaffold_134:68758..68802  ( - strand )
five_prime_UTR scaffold_134:68803..69438  ( - strand )

Sequences:

Gene

>Mapoly0134s0007.1
GGGACGGGACGGGGCGAGAGGGGGAATTGCTCGTCGCTGTGGTGCTCGTCTTGCGCAGGCAGCAAGGCAGGCAGGAGGCGGCGGCAGCAGCAGCAGCAGCAGGACCACAATCCTGATGGTGGTCGAGATGATGCACGGGCCTCTCTTCTAAATTTATCAGCTGCGCTCGCACGGACAATTCTTTTGTCCTCGACCTCGGCTCTTTCATTTTAGCGGCACCGAGTGGTCGTCGTCGTCGTCGAGGATTCGACATTCTAAATGTTCTAGCTCACGATGTGACAGCGGAGGAGCATAGAGAGAGAGAGAAGTCAACAAGTACAGTGACAGTGTCGGACAGAGAGGAAGACCGAACCGAGACGCCAAATCGAGAGTGGCCTTTGATAGGCTCGTGCGCGGGAGCTCGAGAATTCTGTTTCGCAGGAGGAGGAGGAGTATAAATAGGCAGAAGATGGCCGAGCGAGGCCGAGTGAGTTCAATCGCTGCTGCTGCTGCTGCTGCTGCTGACAGCTGAGGAGCCCACATTGGCCCGGTCGGTCGCGAGCATCGGACAAGCAGCTGGGAACTGTGCAGAGGCCAGGAGGCAGCTGCTCGTTGCAGAATTGCAACAGTCGACGGTCCTGTGGATGCGATATTTCCATGGCGCAGTCTCTGTGCATCGCGAGTGCTCCTGTGGCGACTCAGGTACCGATTATCTGGGGGCCCCTCATCTGCTGTTAGGTCCTGTGAGCGAGCGAGCGAGTGATCGACTGATTGCATCATCGGCTCACGCTTGCATGCACGTCGGCCCCGGGCCTTCTCTTCGTCGTCGTCGACGATGGAGTATGTGGGTCGCATGCTGCGAGAGTCGGCTGTCGCTCACAGTGCCGTGACGACCGAGGGGGTGATCTGTCGCCTCGTCTTTGGTCCTCCCGGATTCACAAATCCTGCCACTCGGTGCAAACCAGGGACGGGAGCTCGCCCCTCCTCGCCTCTGGATGTCGATGTCGATGATCCTCACGACAGGAAATCCGGCTCCGCTTTTTCTCGCCCCCCCGCATAAATTCGCGCGCTGCGCTCGCTCTGTCCACACCTGCTTGCGCTTTACGCTGCGCTTCGTCTGCACTTTTGCGAGGAAAAGTTTCGTGTGCACGTAGCTCGCTCAAAGCGCAAAAGCGCATGCGCCAGCGCCGAGGCCTTCGTTCGTTCGAGCGCATTTTTTGTTGGCGGGAAGGGTTGGGTTTGCGCGTTCGAACTTGAATTCAGGGAATGCGAGTTCGATGACGATTATGAACACCCTCTGCTCCAGAGCCCTCCAGTTGTCGAATGCATTAGTGACCACGAATCAGGCGAAGATGCAGGTCCATATCCTGGCGACGACGTCTTCGGTGTTGGTCCGGTTTATGAGCGATTGCAATTTCGGGTTAGGCCTCGCAGTTGTGCATGCTGTCAGTGCTCACGGGAAGACCCCAAATCCTTCTCCGGAGGTCTAATTCATGTCGTTGGTTCCCTTCTTGCTTTGGTGATTGTGTTCCCTAGGCCATTAGGAGCGTCAGAGGGGACACGCAAGCTTCGACCTCTGTTCTGCCGTCAGTAGTTCAGTGCAGTACGAGGTCACGCAATTCTGCTCCGAGGTTATGGAGGAATCGAATCGAGAAGCTGCCGAAGACGCTGTTCCTCGACGGAAACTCGGGTCTACCAGAGCTTCGGAAACTCACCACCGTCTCGTCACCCTTGAAGCAAGCTTCGAGAGGGCAGGTTTCCGCTTCATGTAAGTGGGGTGAAGGAATGAAATTCCTCCCTTGTACTGGCCTTTGATGATTCCCTCGATCGACTGGAGAGATGATAGCCAATTTGAGCTCGAGAAAGTCGTTTTGCAACTCGCCACTGATTCTTGAGAAATGTTTCTTTTCGAGTCCAGTCTCGTCGGTGCCAGTCACCCTCTCGGTCTAACTTGAATCACTACTTCAAATTGTGGTTCCTGGGGACTTTCATGAGCCTTACCGTTTCTTGTTTATAAAAAGTGCCCGTGCCAGGTCCGATCTCGGTGGAGCTAGTCACTCAATCTGACTTATGCTACTTGTCCACAATAGTGCCAGTGCCAGGACCAGCGTCAGTGGAGCTAGCCGCCAACCTGTTCACACTAGCAACTGCGATCGTCGTGCCGTTCTACACGGTCATGATTCTTGCTCCCAAGTGGGAATGGGTAAGCGGTCCGTCAATCACTGCTTTCCCTCCTCATTCGTTGAAAATTGTTGCTCTTCCCGATTCAGGAGCGAGCGCATGTTCCCCACTTTGTCAGCCTATCCCATATCCTGGATCAGTTGCTGACAGGGAGGGAGGACCATGAGAGTTTGCTCTAGTCCTGGCAGCTTGGACAGATCACGTAATGCTTACACTTCGTCTGCATGCTCTCTCTCGGTGATCTGATTGCTTTTACCTTCCGTGATGCCTCAGACCGACAGGTTGATGCGAAGTGAGATACCGTATTTGATTCTCGGAGCTGGTTACATTTACCTTCTGGCTTTATCCTGGACCCCGGAAACTCTGGGACTAATGTTCTCCAGCAAGTACTGGCTCCCTGAGGTAAGAAATTCACCTGAGCATGATTGTGATGCCGTGAGGTATGAGGTAGAGTATAGGACTTGCATATAGTCCACGCGACTGGGTTTGCTTTCTTATCACGTGAGCCACTCGGTTGAAAGATCTGAAGAAGGTGATCAGGATCAGATTTAACAGACGATAATCATAGACCTGCCTTGCCTTCTGGGCGTCTTTCAGCTTCCCGGCATTACTCGGATGTTCTCCAGCACCATAACGGTGGCATCTGCTTGGCTACACTTACTAGCAGCAGACCTTTTTGCTGGCAGGTATGACTGGACTCACCTCTTGTTCAAATCATCACGTTTTTAGCTTAACTTGTTGAAATGCTCATGCCCTGGTAATTCATTCAAAACGTAGATAACGCCTGGATTTGTATGAAACTGCCTGAATTCTGAGTGGAGTGTGTCTTTGCCAGACAAGTTTTCCTCGACGGAGCGAAACATAACGTTGAGACGCGACATTCTTTGGTTCTGTGTTTGATGATGTGCCCCATTGGCATTTTCTCTCATCTAATCACGAAGGTAAGGCACTCTCTTCACCTGCTTACAATGTCCAACTTTTCCGTTCCTGCCCAAAGTGTGTGTTCTCAAGTGGTGTGAAGGATTGCGAAGGTGGGAGCTGTGACACAGTCTGGTCCGGTCTAAAGGGAGTATGATCTTGCTTAGGGGTATGGTCGTCTGCGGCTGATGAAACTGCCTTGCACAATTATTATGCTTGCAGAACTTAACACTCTTCATGCGAAGAAGGAACGAAGGTGAGAACGTGAAGAAAGTGAAGCAGATTCCTCCATACTAGGCTGACATTTTTTCATCAATCTTTTCAACTCGCACATCGTGTCACAACGAAAGCACGAGTTGTATTTGTACACAAAGCATGTATTTTTAATGACTCTACAGAGAAAGAGTACTTTAGCCATTCAGCATGGACTTGCGTCTTGTGGTGAGTACGATTCTGGTGTCGCCTCCTTTCTGTATCACAGTGTACTTCACATGCTTCTGTCTCCTGATCGAGACCGATGCACTGATATCCAACAATTGTCGATCACGGTCTGCTCGGACAGAAGTAAGCAGCGAGATTACATAATTGCAATACTCTACAAACCATCAAGTATTCTAGTGTGAACTCGGTCTAGAAGCTCAAACTCGTGTTAGAACCAGACCAGACCAGAAGGTGTGCTTATCAACATTTCCAAAACCCCCGAGGGCTGTTTTTTCTAAATCACACCTCACAGGTAATTTACATCATCACCTAGGCATACATATCACTCGAAGCCATACATCGATTCCAGAGCTGGACTCATGGTCACGAACCAAAGCAAAATCAGGTTGTTGCTATGTCACAGCAACCTGTAGATGAATTTTCGGCTTACTGTCTTGAGTGTGCTGAGAGGAGAGCTAGGTAGAAGAACCCACTCCACCAGGTCGCAATGCAGACGGACAGCATAACGAAAGGCTTGTTCTCATCGTGGGACTTGCACTGTGTGCCACTGCACGGCACTTTCACAAACCTTTAAGCCATCGTGTACCTTCACTGTACTGCAGTTGGAAACGTCGAACCCAAATTTATGACCTGAGTGCCTCAGTTTAGACCGTACAAGCCAGGAACAGATTCAAGTGTTCGAAAATCTGTGTTTATTCATCTGATGTAAGTTTTGATGAATTTTCCGTTTT

mRNA

>Mapoly0134s0007.1
GGGACGGGACGGGGCGAGAGGGGGAATTGCTCGTCGCTGTGGTGCTCGTCTTGCGCAGGCAGCAAGGCAGGCAGGAGGCGGCGGCAGCAGCAGCAGCAGCAGGACCACAATCCTGATGGTGGTCGAGATGATGCACGGGCCTCTCTTCTAAATTTATCAGCTGCGCTCGCACGGACAATTCTTTTGTCCTCGACCTCGGCTCTTTCATTTTAGCGGCACCGAGTGGTCGTCGTCGTCGTCGAGGATTCGACATTCTAAATGTTCTAGCTCACGATGTGACAGCGGAGGAGCATAGAGAGAGAGAGAAGTCAACAAGTACAGTGACAGTGTCGGACAGAGAGGAAGACCGAACCGAGACGCCAAATCGAGAGTGGCCTTTGATAGGCTCGTGCGCGGGAGCTCGAGAATTCTGTTTCGCAGGAGGAGGAGGAGTATAAATAGGCAGAAGATGGCCGAGCGAGGCCGAGTGAGTTCAATCGCTGCTGCTGCTGCTGCTGCTGCTGACAGCTGAGGAGCCCACATTGGCCCGGTCGGTCGCGAGCATCGGACAAGCAGCTGGGAACTGTGCAGAGGCCAGGAGGCAGCTGCTCGTTGCAGAATTGCAACAGTCGACGGTCCTGTGGATGCGATATTTCCATGGCGCAGTCTCTGTGCATCGCGAGTGCTCCTGTGGCGACTCAGGCCATTAGGAGCGTCAGAGGGGACACGCAAGCTTCGACCTCTGTTCTGCCGTCAGTAGTTCAGTGCAGTACGAGGTCACGCAATTCTGCTCCGAGGTTATGGAGGAATCGAATCGAGAAGCTGCCGAAGACGCTGTTCCTCGACGGAAACTCGGGTCTACCAGAGCTTCGGAAACTCACCACCGTCTCGTCACCCTTGAAGCAAGCTTCGAGAGGGCAGGTTTCCGCTTCATTGCCCGTGCCAGGTCCGATCTCGGTGGAGCTAGTCACTCAATCTGACTTATGCTACTTGTCCACAATAGTGCCAGTGCCAGGACCAGCGTCAGTGGAGCTAGCCGCCAACCTGTTCACACTAGCAACTGCGATCGTCGTGCCGTTCTACACGGTCATGATTCTTGCTCCCAAGTGGGAATGGACCGACAGGTTGATGCGAAGTGAGATACCGTATTTGATTCTCGGAGCTGGTTACATTTACCTTCTGGCTTTATCCTGGACCCCGGAAACTCTGGGACTAATGTTCTCCAGCAAGTACTGGCTCCCTGAGCTTCCCGGCATTACTCGGATGTTCTCCAGCACCATAACGGTGGCATCTGCTTGGCTACACTTACTAGCAGCAGACCTTTTTGCTGGCAGACAAGTTTTCCTCGACGGAGCGAAACATAACGTTGAGACGCGACATTCTTTGGTTCTGTGTTTGATGATGTGCCCCATTGGCATTTTCTCTCATCTAATCACGAAGAACTTAACACTCTTCATGCGAAGAAGGAACGAAGGTGAGAACGTGAAGAAAGTGAAGCAGATTCCTCCATACTAGGCTGACATTTTTTCATCAATCTTTTCAACTCGCACATCGTGTCACAACGAAAGCACGAGTTGTATTTGTACACAAAGCATGTATTTTTAATGACTCTACAGAGAAAGAGTACTTTAGCCATTCAGCATGGACTTGCGTCTTGTGGTGAGTACGATTCTGGTGTCGCCTCCTTTCTGTATCACAGTGTACTTCACATGCTTCTGTCTCCTGATCGAGACCGATGCACTGATATCCAACAATTGTCGATCACGGTCTGCTCGGACAGAAGTAAGCAGCGAGATTACATAATTGCAATACTCTACAAACCATCAAGTATTCTAGTGTGAACTCGGTCTAGAAGCTCAAACTCGTGTTAGAACCAGACCAGACCAGAAGGTGTGCTTATCAACATTTCCAAAACCCCCGAGGGCTGTTTTTTCTAAATCACACCTCACAGGTAATTTACATCATCACCTAGGCATACATATCACTCGAAGCCATACATCGATTCCAGAGCTGGACTCATGGTCACGAACCAAAGCAAAATCAGGTTGTTGCTATGTCACAGCAACCTGTAGATGAATTTTCGGCTTACTGTCTTGAGTGTGCTGAGAGGAGAGCTAGGTAGAAGAACCCACTCCACCAGGTCGCAATGCAGACGGACAGCATAACGAAAGGCTTGTTCTCATCGTGGGACTTGCACTGTGTGCCACTGCACGGCACTTTCACAAACCTTTAAGCCATCGTGTACCTTCACTGTACTGCAGTTGGAAACGTCGAACCCAAATTTATGACCTGAGTGCCTCAGTTTAGACCGTACAAGCCAGGAACAGATTCAAGTGTTCGAAAATCTGTGTTTATTCATCTGATGTAAGTTTTGATGAATTTTCCGTTTT

CDS

>Mapoly0134s0007.1
ATGGCGCAGTCTCTGTGCATCGCGAGTGCTCCTGTGGCGACTCAGGCCATTAGGAGCGTCAGAGGGGACACGCAAGCTTCGACCTCTGTTCTGCCGTCAGTAGTTCAGTGCAGTACGAGGTCACGCAATTCTGCTCCGAGGTTATGGAGGAATCGAATCGAGAAGCTGCCGAAGACGCTGTTCCTCGACGGAAACTCGGGTCTACCAGAGCTTCGGAAACTCACCACCGTCTCGTCACCCTTGAAGCAAGCTTCGAGAGGGCAGGTTTCCGCTTCATTGCCCGTGCCAGGTCCGATCTCGGTGGAGCTAGTCACTCAATCTGACTTATGCTACTTGTCCACAATAGTGCCAGTGCCAGGACCAGCGTCAGTGGAGCTAGCCGCCAACCTGTTCACACTAGCAACTGCGATCGTCGTGCCGTTCTACACGGTCATGATTCTTGCTCCCAAGTGGGAATGGACCGACAGGTTGATGCGAAGTGAGATACCGTATTTGATTCTCGGAGCTGGTTACATTTACCTTCTGGCTTTATCCTGGACCCCGGAAACTCTGGGACTAATGTTCTCCAGCAAGTACTGGCTCCCTGAGCTTCCCGGCATTACTCGGATGTTCTCCAGCACCATAACGGTGGCATCTGCTTGGCTACACTTACTAGCAGCAGACCTTTTTGCTGGCAGACAAGTTTTCCTCGACGGAGCGAAACATAACGTTGAGACGCGACATTCTTTGGTTCTGTGTTTGATGATGTGCCCCATTGGCATTTTCTCTCATCTAATCACGAAGAACTTAACACTCTTCATGCGAAGAAGGAACGAAGGTGAGAACGTGAAGAAAGTGAAGCAGATTCCTCCATACTAG

Protein

>Mapoly0134s0007.1
MAQSLCIASAPVATQAIRSVRGDTQASTSVLPSVVQCSTRSRNSAPRLWRNRIEKLPKTLFLDGNSGLPELRKLTTVSSPLKQASRGQVSASLPVPGPISVELVTQSDLCYLSTIVPVPGPASVELAANLFTLATAIVVPFYTVMILAPKWEWTDRLMRSEIPYLILGAGYIYLLALSWTPETLGLMFSSKYWLPELPGITRMFSSTITVASAWLHLLAADLFAGRQVFLDGAKHNVETRHSLVLCLMMCPIGIFSHLITKNLTLFMRRRNEGENVKKVKQIPPY

Mapoly0134s0007.2  

Gene structure:

mRNA scaffold_134:65189..69532  ( - strand )
three_prime_UTR scaffold_134:65189..66063  ( - strand )
CDS scaffold_134:66064..66138  ( - strand )
CDS scaffold_134:66338..66443  ( - strand )
CDS scaffold_134:66593..66681  ( - strand )
CDS scaffold_134:66877..67005  ( - strand )
CDS scaffold_134:67257..67369  ( - strand )
CDS scaffold_134:67692..67923  ( - strand )
CDS scaffold_134:68758..68802  ( - strand )
five_prime_UTR scaffold_134:68803..69532  ( - strand )

Sequences:

Gene

>Mapoly0134s0007.2
CCGGCAATGTGCCTCTATCCGCGACACTCCACTCCACTGCACTCCACTGCCCGGTGACCGACTCACCCGCTGACTCAGTGACCGGCCACCGGACGGGACGGGACGGGGCGAGAGGGGGAATTGCTCGTCGCTGTGGTGCTCGTCTTGCGCAGGCAGCAAGGCAGGCAGGAGGCGGCGGCAGCAGCAGCAGCAGCAGGACCACAATCCTGATGGTGGTCGAGATGATGCACGGGCCTCTCTTCTAAATTTATCAGCTGCGCTCGCACGGACAATTCTTTTGTCCTCGACCTCGGCTCTTTCATTTTAGCGGCACCGAGTGGTCGTCGTCGTCGTCGAGGATTCGACATTCTAAATGTTCTAGCTCACGATGTGACAGCGGAGGAGCATAGAGAGAGAGAGAAGTCAACAAGTACAGTGACAGTGTCGGACAGAGAGGAAGACCGAACCGAGACGCCAAATCGAGAGTGGCCTTTGATAGGCTCGTGCGCGGGAGCTCGAGAATTCTGTTTCGCAGGAGGAGGAGGAGTATAAATAGGCAGAAGATGGCCGAGCGAGGCCGAGTGAGTTCAATCGCTGCTGCTGCTGCTGCTGCTGCTGACAGCTGAGGAGCCCACATTGGCCCGGTCGGTCGCGAGCATCGGACAAGCAGCTGGGAACTGTGCAGAGGCCAGGAGGCAGCTGCTCGTTGCAGAATTGCAACAGTCGACGGTCCTGTGGATGCGATATTTCCATGGCGCAGTCTCTGTGCATCGCGAGTGCTCCTGTGGCGACTCAGGTACCGATTATCTGGGGGCCCCTCATCTGCTGTTAGGTCCTGTGAGCGAGCGAGCGAGTGATCGACTGATTGCATCATCGGCTCACGCTTGCATGCACGTCGGCCCCGGGCCTTCTCTTCGTCGTCGTCGACGATGGAGTATGTGGGTCGCATGCTGCGAGAGTCGGCTGTCGCTCACAGTGCCGTGACGACCGAGGGGGTGATCTGTCGCCTCGTCTTTGGTCCTCCCGGATTCACAAATCCTGCCACTCGGTGCAAACCAGGGACGGGAGCTCGCCCCTCCTCGCCTCTGGATGTCGATGTCGATGATCCTCACGACAGGAAATCCGGCTCCGCTTTTTCTCGCCCCCCCGCATAAATTCGCGCGCTGCGCTCGCTCTGTCCACACCTGCTTGCGCTTTACGCTGCGCTTCGTCTGCACTTTTGCGAGGAAAAGTTTCGTGTGCACGTAGCTCGCTCAAAGCGCAAAAGCGCATGCGCCAGCGCCGAGGCCTTCGTTCGTTCGAGCGCATTTTTTGTTGGCGGGAAGGGTTGGGTTTGCGCGTTCGAACTTGAATTCAGGGAATGCGAGTTCGATGACGATTATGAACACCCTCTGCTCCAGAGCCCTCCAGTTGTCGAATGCATTAGTGACCACGAATCAGGCGAAGATGCAGGTCCATATCCTGGCGACGACGTCTTCGGTGTTGGTCCGGTTTATGAGCGATTGCAATTTCGGGTTAGGCCTCGCAGTTGTGCATGCTGTCAGTGCTCACGGGAAGACCCCAAATCCTTCTCCGGAGGTCTAATTCATGTCGTTGGTTCCCTTCTTGCTTTGGTGATTGTGTTCCCTAGGCCATTAGGAGCGTCAGAGGGGACACGCAAGCTTCGACCTCTGTTCTGCCGTCAGTAGTTCAGTGCAGTACGAGGTCACGCAATTCTGCTCCGAGGTTATGGAGGAATCGAATCGAGAAGCTGCCGAAGACGCTGTTCCTCGACGGAAACTCGGGTCTACCAGAGCTTCGGAAACTCACCACCGTCTCGTCACCCTTGAAGCAAGCTTCGAGAGGGCAGGTTTCCGCTTCATGTAAGTGGGGTGAAGGAATGAAATTCCTCCCTTGTACTGGCCTTTGATGATTCCCTCGATCGACTGGAGAGATGATAGCCAATTTGAGCTCGAGAAAGTCGTTTTGCAACTCGCCACTGATTCTTGAGAAATGTTTCTTTTCGAGTCCAGTCTCGTCGGTGCCAGTCACCCTCTCGGTCTAACTTGAATCACTACTTCAAATTGTGGTTCCTGGGGACTTTCATGAGCCTTACCGTTTCTTGTTTATAAAAAGTGCCCGTGCCAGGTCCGATCTCGGTGGAGCTAGTCACTCAATCTGACTTATGCTACTTGTCCACAATAGTGCCAGTGCCAGGACCAGCGTCAGTGGAGCTAGCCGCCAACCTGTTCACACTAGCAACTGCGATCGTCGTGCCGTTCTACACGGTCATGATTCTTGCTCCCAAGTGGGAATGGGTAAGCGGTCCGTCAATCACTGCTTTCCCTCCTCATTCGTTGAAAATTGTTGCTCTTCCCGATTCAGGAGCGAGCGCATGTTCCCCACTTTGTCAGCCTATCCCATATCCTGGATCAGTTGCTGACAGGGAGGGAGGACCATGAGAGTTTGCTCTAGTCCTGGCAGCTTGGACAGATCACGTAATGCTTACACTTCGTCTGCATGCTCTCTCTCGGTGATCTGATTGCTTTTACCTTCCGTGATGCCTCAGACCGACAGGTTGATGCGAAGTGAGATACCGTATTTGATTCTCGGAGCTGGTTACATTTACCTTCTGGCTTTATCCTGGACCCCGGAAACTCTGGGACTAATGTTCTCCAGCAAGTACTGGCTCCCTGAGGTAAGAAATTCACCTGAGCATGATTGTGATGCCGTGAGGTATGAGGTAGAGTATAGGACTTGCATATAGTCCACGCGACTGGGTTTGCTTTCTTATCACGTGAGCCACTCGGTTGAAAGATCTGAAGAAGGTGATCAGGATCAGATTTAACAGACGATAATCATAGACCTGCCTTGCCTTCTGGGCGTCTTTCAGCTTCCCGGCATTACTCGGATGTTCTCCAGCACCATAACGGTGGCATCTGCTTGGCTACACTTACTAGCAGCAGACCTTTTTGCTGGCAGGTATGACTGGACTCACCTCTTGTTCAAATCATCACGTTTTTAGCTTAACTTGTTGAAATGCTCATGCCCTGGTAATTCATTCAAAACGTAGATAACGCCTGGATTTGTATGAAACTGCCTGAATTCTGAGTGGAGTGTGTCTTTGCCAGACAAGTTTTCCTCGACGGAGCGAAACATAACGTTGAGACGCGACATTCTTTGGTTCTGTGTTTGATGATGTGCCCCATTGGCATTTTCTCTCATCTAATCACGAAGGTAAGGCACTCTCTTCACCTGCTTACAATGTCCAACTTTTCCGTTCCTGCCCAAAGTGTGTGTTCTCAAGTGGTGTGAAGGATTGCGAAGGTGGGAGCTGTGACACAGTCTGGTCCGGTCTAAAGGGAGTATGATCTTGCTTAGGGGTATGGTCGTCTGCGGCTGATGAAACTGCCTTGCACAATTATTATGCTTGCAGAACTTAACACTCTTCATGCGAAGAAGGAACGAAGGTGAGAACGTGAAGAAAGTGAAGCAGATTCCTCCATACTAGGCTGACATTTTTTCATCAATCTTTTCAACTCGCACATCGTGTCACAACGAAAGCACGAGTTGTATTTGTACACAAAGCATGTATTTTTAATGACTCTACAGAGAAAGAGTACTTTAGCCATTCAGCATGGACTTGCGTCTTGTGGTGAGTACGATTCTGGTGTCGCCTCCTTTCTGTATCACAGTGTACTTCACATGCTTCTGTCTCCTGATCGAGACCGATGCACTGATATCCAACAATTGTCGATCACGGTCTGCTCGGACAGAAGTAAGCAGCGAGATTACATAATTGCAATACTCTACAAACCATCAAGTATTCTAGTGTGAACTCGGTCTAGAAGCTCAAACTCGTGTTAGAACCAGACCAGACCAGAAGGTGTGCTTATCAACATTTCCAAAACCCCCGAGGGCTGTTTTTTCTAAATCACACCTCACAGGTAATTTACATCATCACCTAGGCATACATATCACTCGAAGCCATACATCGATTCCAGAGCTGGACTCATGGTCACGAACCAAAGCAAAATCAGGTTGTTGCTATGTCACAGCAACCTGTAGATGAATTTTCGGCTTACTGTCTTGAGTGTGCTGAGAGGAGAGCTAGGTAGAAGAACCCACTCCACCAGGTCGCAATGCAGACGGACAGCATAACGAAAGGCTTGTTCTCATCGTGGGACTTGCACTGTGTGCCACTGCACGGCACTTTCACAAACCTTTAAGCCATCGTGTACCTTCACTGTACTGCAGTTGGAAACGTCGAACCCAAATTTATGACCTGAGTGCCTCAGTTTAGACCGTACAAGCCAGGAACAGATTCAAGTGTTCGAAAATCTGTGTTTATTCATCTGATGTAAGTTTTGATGAATTTTCCGTTTT

mRNA

>Mapoly0134s0007.2
CCGGCAATGTGCCTCTATCCGCGACACTCCACTCCACTGCACTCCACTGCCCGGTGACCGACTCACCCGCTGACTCAGTGACCGGCCACCGGACGGGACGGGACGGGGCGAGAGGGGGAATTGCTCGTCGCTGTGGTGCTCGTCTTGCGCAGGCAGCAAGGCAGGCAGGAGGCGGCGGCAGCAGCAGCAGCAGCAGGACCACAATCCTGATGGTGGTCGAGATGATGCACGGGCCTCTCTTCTAAATTTATCAGCTGCGCTCGCACGGACAATTCTTTTGTCCTCGACCTCGGCTCTTTCATTTTAGCGGCACCGAGTGGTCGTCGTCGTCGTCGAGGATTCGACATTCTAAATGTTCTAGCTCACGATGTGACAGCGGAGGAGCATAGAGAGAGAGAGAAGTCAACAAGTACAGTGACAGTGTCGGACAGAGAGGAAGACCGAACCGAGACGCCAAATCGAGAGTGGCCTTTGATAGGCTCGTGCGCGGGAGCTCGAGAATTCTGTTTCGCAGGAGGAGGAGGAGTATAAATAGGCAGAAGATGGCCGAGCGAGGCCGAGTGAGTTCAATCGCTGCTGCTGCTGCTGCTGCTGCTGACAGCTGAGGAGCCCACATTGGCCCGGTCGGTCGCGAGCATCGGACAAGCAGCTGGGAACTGTGCAGAGGCCAGGAGGCAGCTGCTCGTTGCAGAATTGCAACAGTCGACGGTCCTGTGGATGCGATATTTCCATGGCGCAGTCTCTGTGCATCGCGAGTGCTCCTGTGGCGACTCAGGCCATTAGGAGCGTCAGAGGGGACACGCAAGCTTCGACCTCTGTTCTGCCGTCAGTAGTTCAGTGCAGTACGAGGTCACGCAATTCTGCTCCGAGGTTATGGAGGAATCGAATCGAGAAGCTGCCGAAGACGCTGTTCCTCGACGGAAACTCGGGTCTACCAGAGCTTCGGAAACTCACCACCGTCTCGTCACCCTTGAAGCAAGCTTCGAGAGGGCAGGTTTCCGCTTCATTGCCAGTGCCAGGACCAGCGTCAGTGGAGCTAGCCGCCAACCTGTTCACACTAGCAACTGCGATCGTCGTGCCGTTCTACACGGTCATGATTCTTGCTCCCAAGTGGGAATGGACCGACAGGTTGATGCGAAGTGAGATACCGTATTTGATTCTCGGAGCTGGTTACATTTACCTTCTGGCTTTATCCTGGACCCCGGAAACTCTGGGACTAATGTTCTCCAGCAAGTACTGGCTCCCTGAGCTTCCCGGCATTACTCGGATGTTCTCCAGCACCATAACGGTGGCATCTGCTTGGCTACACTTACTAGCAGCAGACCTTTTTGCTGGCAGACAAGTTTTCCTCGACGGAGCGAAACATAACGTTGAGACGCGACATTCTTTGGTTCTGTGTTTGATGATGTGCCCCATTGGCATTTTCTCTCATCTAATCACGAAGAACTTAACACTCTTCATGCGAAGAAGGAACGAAGGTGAGAACGTGAAGAAAGTGAAGCAGATTCCTCCATACTAGGCTGACATTTTTTCATCAATCTTTTCAACTCGCACATCGTGTCACAACGAAAGCACGAGTTGTATTTGTACACAAAGCATGTATTTTTAATGACTCTACAGAGAAAGAGTACTTTAGCCATTCAGCATGGACTTGCGTCTTGTGGTGAGTACGATTCTGGTGTCGCCTCCTTTCTGTATCACAGTGTACTTCACATGCTTCTGTCTCCTGATCGAGACCGATGCACTGATATCCAACAATTGTCGATCACGGTCTGCTCGGACAGAAGTAAGCAGCGAGATTACATAATTGCAATACTCTACAAACCATCAAGTATTCTAGTGTGAACTCGGTCTAGAAGCTCAAACTCGTGTTAGAACCAGACCAGACCAGAAGGTGTGCTTATCAACATTTCCAAAACCCCCGAGGGCTGTTTTTTCTAAATCACACCTCACAGGTAATTTACATCATCACCTAGGCATACATATCACTCGAAGCCATACATCGATTCCAGAGCTGGACTCATGGTCACGAACCAAAGCAAAATCAGGTTGTTGCTATGTCACAGCAACCTGTAGATGAATTTTCGGCTTACTGTCTTGAGTGTGCTGAGAGGAGAGCTAGGTAGAAGAACCCACTCCACCAGGTCGCAATGCAGACGGACAGCATAACGAAAGGCTTGTTCTCATCGTGGGACTTGCACTGTGTGCCACTGCACGGCACTTTCACAAACCTTTAAGCCATCGTGTACCTTCACTGTACTGCAGTTGGAAACGTCGAACCCAAATTTATGACCTGAGTGCCTCAGTTTAGACCGTACAAGCCAGGAACAGATTCAAGTGTTCGAAAATCTGTGTTTATTCATCTGATGTAAGTTTTGATGAATTTTCCGTTTT

CDS

>Mapoly0134s0007.2
ATGGCGCAGTCTCTGTGCATCGCGAGTGCTCCTGTGGCGACTCAGGCCATTAGGAGCGTCAGAGGGGACACGCAAGCTTCGACCTCTGTTCTGCCGTCAGTAGTTCAGTGCAGTACGAGGTCACGCAATTCTGCTCCGAGGTTATGGAGGAATCGAATCGAGAAGCTGCCGAAGACGCTGTTCCTCGACGGAAACTCGGGTCTACCAGAGCTTCGGAAACTCACCACCGTCTCGTCACCCTTGAAGCAAGCTTCGAGAGGGCAGGTTTCCGCTTCATTGCCAGTGCCAGGACCAGCGTCAGTGGAGCTAGCCGCCAACCTGTTCACACTAGCAACTGCGATCGTCGTGCCGTTCTACACGGTCATGATTCTTGCTCCCAAGTGGGAATGGACCGACAGGTTGATGCGAAGTGAGATACCGTATTTGATTCTCGGAGCTGGTTACATTTACCTTCTGGCTTTATCCTGGACCCCGGAAACTCTGGGACTAATGTTCTCCAGCAAGTACTGGCTCCCTGAGCTTCCCGGCATTACTCGGATGTTCTCCAGCACCATAACGGTGGCATCTGCTTGGCTACACTTACTAGCAGCAGACCTTTTTGCTGGCAGACAAGTTTTCCTCGACGGAGCGAAACATAACGTTGAGACGCGACATTCTTTGGTTCTGTGTTTGATGATGTGCCCCATTGGCATTTTCTCTCATCTAATCACGAAGAACTTAACACTCTTCATGCGAAGAAGGAACGAAGGTGAGAACGTGAAGAAAGTGAAGCAGATTCCTCCATACTAG

Protein

>Mapoly0134s0007.2
MAQSLCIASAPVATQAIRSVRGDTQASTSVLPSVVQCSTRSRNSAPRLWRNRIEKLPKTLFLDGNSGLPELRKLTTVSSPLKQASRGQVSASLPVPGPASVELAANLFTLATAIVVPFYTVMILAPKWEWTDRLMRSEIPYLILGAGYIYLLALSWTPETLGLMFSSKYWLPELPGITRMFSSTITVASAWLHLLAADLFAGRQVFLDGAKHNVETRHSLVLCLMMCPIGIFSHLITKNLTLFMRRRNEGENVKKVKQIPPY

Mapoly0134s0007.3  

Gene structure:

mRNA scaffold_134:65257..69418  ( - strand )
three_prime_UTR scaffold_134:65257..66063  ( - strand )
CDS scaffold_134:66064..66138  ( - strand )
CDS scaffold_134:66338..66443  ( - strand )
CDS scaffold_134:66593..66681  ( - strand )
CDS scaffold_134:66877..67005  ( - strand )
CDS scaffold_134:67257..67369  ( - strand )
CDS scaffold_134:67692..67923  ( - strand )
CDS scaffold_134:68758..68802  ( - strand )
five_prime_UTR scaffold_134:68803..69018  ( - strand )
five_prime_UTR scaffold_134:69158..69418  ( - strand )

Sequences:

Gene

>Mapoly0134s0007.3
GGGGAATTGCTCGTCGCTGTGGTGCTCGTCTTGCGCAGGCAGCAAGGCAGGCAGGAGGCGGCGGCAGCAGCAGCAGCAGCAGGACCACAATCCTGATGGTGGTCGAGATGATGCACGGGCCTCTCTTCTAAATTTATCAGCTGCGCTCGCACGGACAATTCTTTTGTCCTCGACCTCGGCTCTTTCATTTTAGCGGCACCGAGTGGTCGTCGTCGTCGTCGAGGATTCGACATTCTAAATGTTCTAGCTCACGATGTGACAGCGGAGGAGCATAGAGAGAGAGAGAAGTCAACAAGTACAGTGACAGTGTCGGACAGAGAGGAAGACCGAACCGAGACGCCAAATCGAGAGTGGCCTTTGATAGGCTCGTGCGCGGGAGCTCGAGAATTCTGTTTCGCAGGAGGAGGAGGAGTATAAATAGGCAGAAGATGGCCGAGCGAGGCCGAGTGAGTTCAATCGCTGCTGCTGCTGCTGCTGCTGCTGACAGCTGAGGAGCCCACATTGGCCCGGTCGGTCGCGAGCATCGGACAAGCAGCTGGGAACTGTGCAGAGGCCAGGAGGCAGCTGCTCGTTGCAGAATTGCAACAGTCGACGGTCCTGTGGATGCGATATTTCCATGGCGCAGTCTCTGTGCATCGCGAGTGCTCCTGTGGCGACTCAGGTACCGATTATCTGGGGGCCCCTCATCTGCTGTTAGGTCCTGTGAGCGAGCGAGCGAGTGATCGACTGATTGCATCATCGGCTCACGCTTGCATGCACGTCGGCCCCGGGCCTTCTCTTCGTCGTCGTCGACGATGGAGTATGTGGGTCGCATGCTGCGAGAGTCGGCTGTCGCTCACAGTGCCGTGACGACCGAGGGGGTGATCTGTCGCCTCGTCTTTGGTCCTCCCGGATTCACAAATCCTGCCACTCGGTGCAAACCAGGGACGGGAGCTCGCCCCTCCTCGCCTCTGGATGTCGATGTCGATGATCCTCACGACAGGAAATCCGGCTCCGCTTTTTCTCGCCCCCCCGCATAAATTCGCGCGCTGCGCTCGCTCTGTCCACACCTGCTTGCGCTTTACGCTGCGCTTCGTCTGCACTTTTGCGAGGAAAAGTTTCGTGTGCACGTAGCTCGCTCAAAGCGCAAAAGCGCATGCGCCAGCGCCGAGGCCTTCGTTCGTTCGAGCGCATTTTTTGTTGGCGGGAAGGGTTGGGTTTGCGCGTTCGAACTTGAATTCAGGGAATGCGAGTTCGATGACGATTATGAACACCCTCTGCTCCAGAGCCCTCCAGTTGTCGAATGCATTAGTGACCACGAATCAGGCGAAGATGCAGGTCCATATCCTGGCGACGACGTCTTCGGTGTTGGTCCGGTTTATGAGCGATTGCAATTTCGGGTTAGGCCTCGCAGTTGTGCATGCTGTCAGTGCTCACGGGAAGACCCCAAATCCTTCTCCGGAGGTCTAATTCATGTCGTTGGTTCCCTTCTTGCTTTGGTGATTGTGTTCCCTAGGCCATTAGGAGCGTCAGAGGGGACACGCAAGCTTCGACCTCTGTTCTGCCGTCAGTAGTTCAGTGCAGTACGAGGTCACGCAATTCTGCTCCGAGGTTATGGAGGAATCGAATCGAGAAGCTGCCGAAGACGCTGTTCCTCGACGGAAACTCGGGTCTACCAGAGCTTCGGAAACTCACCACCGTCTCGTCACCCTTGAAGCAAGCTTCGAGAGGGCAGGTTTCCGCTTCATGTAAGTGGGGTGAAGGAATGAAATTCCTCCCTTGTACTGGCCTTTGATGATTCCCTCGATCGACTGGAGAGATGATAGCCAATTTGAGCTCGAGAAAGTCGTTTTGCAACTCGCCACTGATTCTTGAGAAATGTTTCTTTTCGAGTCCAGTCTCGTCGGTGCCAGTCACCCTCTCGGTCTAACTTGAATCACTACTTCAAATTGTGGTTCCTGGGGACTTTCATGAGCCTTACCGTTTCTTGTTTATAAAAAGTGCCCGTGCCAGGTCCGATCTCGGTGGAGCTAGTCACTCAATCTGACTTATGCTACTTGTCCACAATAGTGCCAGTGCCAGGACCAGCGTCAGTGGAGCTAGCCGCCAACCTGTTCACACTAGCAACTGCGATCGTCGTGCCGTTCTACACGGTCATGATTCTTGCTCCCAAGTGGGAATGGGTAAGCGGTCCGTCAATCACTGCTTTCCCTCCTCATTCGTTGAAAATTGTTGCTCTTCCCGATTCAGGAGCGAGCGCATGTTCCCCACTTTGTCAGCCTATCCCATATCCTGGATCAGTTGCTGACAGGGAGGGAGGACCATGAGAGTTTGCTCTAGTCCTGGCAGCTTGGACAGATCACGTAATGCTTACACTTCGTCTGCATGCTCTCTCTCGGTGATCTGATTGCTTTTACCTTCCGTGATGCCTCAGACCGACAGGTTGATGCGAAGTGAGATACCGTATTTGATTCTCGGAGCTGGTTACATTTACCTTCTGGCTTTATCCTGGACCCCGGAAACTCTGGGACTAATGTTCTCCAGCAAGTACTGGCTCCCTGAGGTAAGAAATTCACCTGAGCATGATTGTGATGCCGTGAGGTATGAGGTAGAGTATAGGACTTGCATATAGTCCACGCGACTGGGTTTGCTTTCTTATCACGTGAGCCACTCGGTTGAAAGATCTGAAGAAGGTGATCAGGATCAGATTTAACAGACGATAATCATAGACCTGCCTTGCCTTCTGGGCGTCTTTCAGCTTCCCGGCATTACTCGGATGTTCTCCAGCACCATAACGGTGGCATCTGCTTGGCTACACTTACTAGCAGCAGACCTTTTTGCTGGCAGGTATGACTGGACTCACCTCTTGTTCAAATCATCACGTTTTTAGCTTAACTTGTTGAAATGCTCATGCCCTGGTAATTCATTCAAAACGTAGATAACGCCTGGATTTGTATGAAACTGCCTGAATTCTGAGTGGAGTGTGTCTTTGCCAGACAAGTTTTCCTCGACGGAGCGAAACATAACGTTGAGACGCGACATTCTTTGGTTCTGTGTTTGATGATGTGCCCCATTGGCATTTTCTCTCATCTAATCACGAAGGTAAGGCACTCTCTTCACCTGCTTACAATGTCCAACTTTTCCGTTCCTGCCCAAAGTGTGTGTTCTCAAGTGGTGTGAAGGATTGCGAAGGTGGGAGCTGTGACACAGTCTGGTCCGGTCTAAAGGGAGTATGATCTTGCTTAGGGGTATGGTCGTCTGCGGCTGATGAAACTGCCTTGCACAATTATTATGCTTGCAGAACTTAACACTCTTCATGCGAAGAAGGAACGAAGGTGAGAACGTGAAGAAAGTGAAGCAGATTCCTCCATACTAGGCTGACATTTTTTCATCAATCTTTTCAACTCGCACATCGTGTCACAACGAAAGCACGAGTTGTATTTGTACACAAAGCATGTATTTTTAATGACTCTACAGAGAAAGAGTACTTTAGCCATTCAGCATGGACTTGCGTCTTGTGGTGAGTACGATTCTGGTGTCGCCTCCTTTCTGTATCACAGTGTACTTCACATGCTTCTGTCTCCTGATCGAGACCGATGCACTGATATCCAACAATTGTCGATCACGGTCTGCTCGGACAGAAGTAAGCAGCGAGATTACATAATTGCAATACTCTACAAACCATCAAGTATTCTAGTGTGAACTCGGTCTAGAAGCTCAAACTCGTGTTAGAACCAGACCAGACCAGAAGGTGTGCTTATCAACATTTCCAAAACCCCCGAGGGCTGTTTTTTCTAAATCACACCTCACAGGTAATTTACATCATCACCTAGGCATACATATCACTCGAAGCCATACATCGATTCCAGAGCTGGACTCATGGTCACGAACCAAAGCAAAATCAGGTTGTTGCTATGTCACAGCAACCTGTAGATGAATTTTCGGCTTACTGTCTTGAGTGTGCTGAGAGGAGAGCTAGGTAGAAGAACCCACTCCACCAGGTCGCAATGCAGACGGACAGCATAACGAAAGGCTTGTTCTCATCGTGGGACTTGCACTGTGTGCCACTGCACGGCACTTTCACAAACCTTTAAGCCATCGTGTACCTTCACTGTACTGCAGTTGGAAACGTCGAACCCAAATTTATGACCTGAGTGCCTCAGTTTAGACCGTACAAGCCAGG

mRNA

>Mapoly0134s0007.3
GGGGAATTGCTCGTCGCTGTGGTGCTCGTCTTGCGCAGGCAGCAAGGCAGGCAGGAGGCGGCGGCAGCAGCAGCAGCAGCAGGACCACAATCCTGATGGTGGTCGAGATGATGCACGGGCCTCTCTTCTAAATTTATCAGCTGCGCTCGCACGGACAATTCTTTTGTCCTCGACCTCGGCTCTTTCATTTTAGCGGCACCGAGTGGTCGTCGTCGTCGTCGAGGATTCGACATTCTAAATGTTCTAGCTCACGATGTGACAGAGGAGGAGGAGTATAAATAGGCAGAAGATGGCCGAGCGAGGCCGAGTGAGTTCAATCGCTGCTGCTGCTGCTGCTGCTGCTGACAGCTGAGGAGCCCACATTGGCCCGGTCGGTCGCGAGCATCGGACAAGCAGCTGGGAACTGTGCAGAGGCCAGGAGGCAGCTGCTCGTTGCAGAATTGCAACAGTCGACGGTCCTGTGGATGCGATATTTCCATGGCGCAGTCTCTGTGCATCGCGAGTGCTCCTGTGGCGACTCAGGCCATTAGGAGCGTCAGAGGGGACACGCAAGCTTCGACCTCTGTTCTGCCGTCAGTAGTTCAGTGCAGTACGAGGTCACGCAATTCTGCTCCGAGGTTATGGAGGAATCGAATCGAGAAGCTGCCGAAGACGCTGTTCCTCGACGGAAACTCGGGTCTACCAGAGCTTCGGAAACTCACCACCGTCTCGTCACCCTTGAAGCAAGCTTCGAGAGGGCAGGTTTCCGCTTCATTGCCAGTGCCAGGACCAGCGTCAGTGGAGCTAGCCGCCAACCTGTTCACACTAGCAACTGCGATCGTCGTGCCGTTCTACACGGTCATGATTCTTGCTCCCAAGTGGGAATGGACCGACAGGTTGATGCGAAGTGAGATACCGTATTTGATTCTCGGAGCTGGTTACATTTACCTTCTGGCTTTATCCTGGACCCCGGAAACTCTGGGACTAATGTTCTCCAGCAAGTACTGGCTCCCTGAGCTTCCCGGCATTACTCGGATGTTCTCCAGCACCATAACGGTGGCATCTGCTTGGCTACACTTACTAGCAGCAGACCTTTTTGCTGGCAGACAAGTTTTCCTCGACGGAGCGAAACATAACGTTGAGACGCGACATTCTTTGGTTCTGTGTTTGATGATGTGCCCCATTGGCATTTTCTCTCATCTAATCACGAAGAACTTAACACTCTTCATGCGAAGAAGGAACGAAGGTGAGAACGTGAAGAAAGTGAAGCAGATTCCTCCATACTAGGCTGACATTTTTTCATCAATCTTTTCAACTCGCACATCGTGTCACAACGAAAGCACGAGTTGTATTTGTACACAAAGCATGTATTTTTAATGACTCTACAGAGAAAGAGTACTTTAGCCATTCAGCATGGACTTGCGTCTTGTGGTGAGTACGATTCTGGTGTCGCCTCCTTTCTGTATCACAGTGTACTTCACATGCTTCTGTCTCCTGATCGAGACCGATGCACTGATATCCAACAATTGTCGATCACGGTCTGCTCGGACAGAAGTAAGCAGCGAGATTACATAATTGCAATACTCTACAAACCATCAAGTATTCTAGTGTGAACTCGGTCTAGAAGCTCAAACTCGTGTTAGAACCAGACCAGACCAGAAGGTGTGCTTATCAACATTTCCAAAACCCCCGAGGGCTGTTTTTTCTAAATCACACCTCACAGGTAATTTACATCATCACCTAGGCATACATATCACTCGAAGCCATACATCGATTCCAGAGCTGGACTCATGGTCACGAACCAAAGCAAAATCAGGTTGTTGCTATGTCACAGCAACCTGTAGATGAATTTTCGGCTTACTGTCTTGAGTGTGCTGAGAGGAGAGCTAGGTAGAAGAACCCACTCCACCAGGTCGCAATGCAGACGGACAGCATAACGAAAGGCTTGTTCTCATCGTGGGACTTGCACTGTGTGCCACTGCACGGCACTTTCACAAACCTTTAAGCCATCGTGTACCTTCACTGTACTGCAGTTGGAAACGTCGAACCCAAATTTATGACCTGAGTGCCTCAGTTTAGACCGTACAAGCCAGG

CDS

>Mapoly0134s0007.3
ATGGCGCAGTCTCTGTGCATCGCGAGTGCTCCTGTGGCGACTCAGGCCATTAGGAGCGTCAGAGGGGACACGCAAGCTTCGACCTCTGTTCTGCCGTCAGTAGTTCAGTGCAGTACGAGGTCACGCAATTCTGCTCCGAGGTTATGGAGGAATCGAATCGAGAAGCTGCCGAAGACGCTGTTCCTCGACGGAAACTCGGGTCTACCAGAGCTTCGGAAACTCACCACCGTCTCGTCACCCTTGAAGCAAGCTTCGAGAGGGCAGGTTTCCGCTTCATTGCCAGTGCCAGGACCAGCGTCAGTGGAGCTAGCCGCCAACCTGTTCACACTAGCAACTGCGATCGTCGTGCCGTTCTACACGGTCATGATTCTTGCTCCCAAGTGGGAATGGACCGACAGGTTGATGCGAAGTGAGATACCGTATTTGATTCTCGGAGCTGGTTACATTTACCTTCTGGCTTTATCCTGGACCCCGGAAACTCTGGGACTAATGTTCTCCAGCAAGTACTGGCTCCCTGAGCTTCCCGGCATTACTCGGATGTTCTCCAGCACCATAACGGTGGCATCTGCTTGGCTACACTTACTAGCAGCAGACCTTTTTGCTGGCAGACAAGTTTTCCTCGACGGAGCGAAACATAACGTTGAGACGCGACATTCTTTGGTTCTGTGTTTGATGATGTGCCCCATTGGCATTTTCTCTCATCTAATCACGAAGAACTTAACACTCTTCATGCGAAGAAGGAACGAAGGTGAGAACGTGAAGAAAGTGAAGCAGATTCCTCCATACTAG

Protein

>Mapoly0134s0007.3
MAQSLCIASAPVATQAIRSVRGDTQASTSVLPSVVQCSTRSRNSAPRLWRNRIEKLPKTLFLDGNSGLPELRKLTTVSSPLKQASRGQVSASLPVPGPASVELAANLFTLATAIVVPFYTVMILAPKWEWTDRLMRSEIPYLILGAGYIYLLALSWTPETLGLMFSSKYWLPELPGITRMFSSTITVASAWLHLLAADLFAGRQVFLDGAKHNVETRHSLVLCLMMCPIGIFSHLITKNLTLFMRRRNEGENVKKVKQIPPY

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>