Mapoly0150s0001



Description

MYB-LIKE DNA-BINDING PROTEIN MYB

Reference DB

Database ID Description
GO GO:0003682 Chromatin binding
KOG KOG0048 Transcription factor, Myb superfamily
OrthoMCL OG5_127030
PFAM PF00249 Myb-like DNA-binding domain
PFAM PF13921 Myb-like DNA-binding domain
PANTHER PTHR10641 MYB-LIKE DNA-BINDING PROTEIN MYB
PANTHER PTHR10641:SF221

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
Mp3R-MYB5 transcription factor, MYB Mapoly0150s0001.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0150s0001.1 scaffold_150:8282..11748  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
Mapoly0150s0001.2 scaffold_150:8301..15455  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0150s0001.1  

Gene structure:

mRNA scaffold_150:8282..11748  ( - strand )
three_prime_UTR scaffold_150:8282..8841  ( - strand )
CDS scaffold_150:8842..9166  ( - strand )
CDS scaffold_150:9284..9412  ( - strand )
CDS scaffold_150:9627..9730  ( - strand )
CDS scaffold_150:9834..9928  ( - strand )
CDS scaffold_150:10250..10307  ( - strand )
CDS scaffold_150:10765..10831  ( - strand )
CDS scaffold_150:10950..11071  ( - strand )
five_prime_UTR scaffold_150:11072..11099  ( - strand )
five_prime_UTR scaffold_150:11323..11748  ( - strand )

Sequences:

Gene

>Mapoly0150s0001.1
TTCTCGCCACAATGCCAGTAGGAGGTAAGTCTGACCTACCAACAGGAATTCCTTGATGCAATATCTAGAAGGTAGACATCTGTCACAAGATTGACAAGATTTATTAGATTGCCAAAAGCTTCCCTAATCTTTGTGGCAAGTTCATGAAATCAGCCAGATCTTCTGATGATTTATGTTCAGTTCCTTTTCAGAAGTAATATATTGAAAAATGATCATGATTATCAGTAACCTATCACTGCTTTATGTCGTTTCAATATAAATACTTCATCAGTTAATGAGACAAGCGTAAATTATGTCTCCTGGAAATTTTTTATTTTGAATTAGATAGCATGACAAGAGACAATGAAATAACTAACCACATGTATTTGTTGACTCCCAGATCCATCCATAAATCTTGTAAGATCTTTGCATCAGATCCGAGCACAAGTGAGTGTAAGCATGAATAATACATTAATAGTTGTAGGGTCTGGCTGAGTCATCGTAATCAATTTCAATCATAAACTCCTCAATAATGCAGGTCATATAATCAGATATGTTTCTCTCTGATAATTCGCACCCTCGGAGTTGGCCATGTGTGTCATCTACATTAATTTGTGTGCTTCTAAGTTACCAGTTTCGTGAAACTAACAACTTTATGACTAAACTTCAGAGTTCTCAAGGATTCGAAGTTGGAGAAAATGGAGGGTTCTTCGACACTACCAAAGTTTTCTCAGAGGAGATGCCTCGAAGAGATAATCAATTCTAGCGAGGACAACCTCCCTTCTGCGGCAGTCGTGGATTTTCCCCTTGACAGAAAAGGGTAAGCACAATTTATTTTCCTCGAAATTACACAGCGTTTTGTAGTTGTCTTCATGTAGATCCGAACGACGCATGGTCTCTGAAGCCGAATATTCTTGTAACTTCTATGGATGTAACAGGAAGAAGATGAGAGTTTATCATGCTCCGCAACCAAGGAAGCCAAGCACGTCTTGGACGGCGGAAGAGGTGAGTAAACCATTGTTTGATAACTAATACTGGTGTAGAATCTATGTAGACAAATCAGTCTTAGGAAAGTTTGAAGACTCGACAAATTCAATGTGGATTCTGTCACGATTTTGAAGCCATGATGCTCATGACCTTCAGAAGAAGCACTCGAGTTCCTCCAAGTATGAATGATGTTTTAGGTTCAATTTGTTGATAAATTATGCTTAGATTGGCGAATACAACTGAAGGTAAGTTTTTCGATTCATTATCAGGCTGTCACAGGATATATTTTCTCGCTCCGATATTTGACTTGCCCTGCACCATCTGTAGTATGCTTAAGTAGGGTCTGGTTCTCTGACCACTGTTATTCAATGTAACATCTGATTAACATCCACAGGTGTTCTGAAGTGAATATCTGCAATGACTGAGTTTTACAACTAATCTGAACCCAAGGAGACTGTTTACTTCATTGCTACAGGACGAAACATTACGAGCAGCAGTCGAGAAATTCAAGGGCCGAAATTGGAAACAGATTGGTGAGTATCAGAAACCGTTGGGGGCGCGTCCATCAAATTCAAATTTGAATTTGAACTACCCGCTAGATGTGATACGCGTGTGCCCTTGTCATCGGGACTTGTACATATTTTGGCGGGCGTAGTTCCTCAAAGTAGTTGCTCAAAGGAGTATTGATCTCGAGGCTGCAATAGTGGATTGATCTCAGCATTTGCACGACGGCGCAGACGAAGAGAATTGAGACAAAGATGACGAAGAGAATTGAGACAGAGATGACGCAAAAGGTGACCACAACTCTTCTTTGTAATATCTGAATTTATGTATTGGACTGATGGCATGTGCAGCTGCGAGTTTACCGAATCGGTCAGATGCTCAGTGCCTTCACCGCTGGCAAAAGGTTCTTAATCCTATCCTGGTTAAAGGATACTGGAGCAAAGAGGTAAGTGACTCTTATATAAGCACATATTAAATTACGAGAGTGAGGTATCCCAGATACCACGTTCGACAAATGTGATGATTGATTTAAGTAGCTATTTTCGCAGGAGGACGACAAGATGCTCGAATTGGTCAAAACGTTCGGCACGAAGAGATGGGCTGCCATCGCTCGGGCAATGCCTGGCAGAAATAGCAAGCAGTGTCGAGAGAGGTGCGTATGAAGTATGTGGCTGATTTATATGTTCCTAACCTAATACGATAGTCCCTGAAATATACTATTGATGGTAATGCTGCTAGCATGAGAATTTTGAGCTGCAACCGTGAGTGTATAGGAAACGTGAGGACTGAATGTGTGCTTTACTTCAAATGTGGAACTAAATTATTCACAAGAAATCTCTCTAACTTGCTCATTTATTGCTACAAAGATGGTGCAATCATCTGGATCCCAAGATAAAAAAGGAGCCGTGGAGTGAAGAAGAGGACATGATGTTGGTTATGGCTCACCAGAGGTTAGGCAACAGATGGGCAGAGATCGCAAAGATCATTCCTGGCAGGTAATTTCAGTATATTTGCAAAATTTAGATTTTATGAGGCCAAGCTCTATTATAATTTTTCGTTAGCAATTTTCTCATGTAATTCTTCTGATTGTATTACATTTACACAATTATCAGGTCGGACAATGCCATAAAGAATAGGTGGAACACGGCAAAGAATAAACGGTCGGATGCACTGGAACAATCCAGTGAGAATTGGATCAACAGTAGCACATTTGGAGATATGTCTTCCTTTACCGAAGATGTGGCTCAAAGAGACCTTGACGCTAATCAACATGTTCTGGCATGGAATGGCGAGCCCAATGTTATGACATGGAATGGCGAGTCCAATATCGACATTCAAGATTCGAATGCGGCGGAGGACCTTGCATTGAACAGCGTGTTCGGACCGGATAAGATTGAGGATGAAGATTGGTTCCCGGACTTTGATTTTTGTCTTTAATGTCAAGTTTTTTACAGCTAATCCCTACAAGGACCATGTAAATGTAATACTTTGTGGAACTAATCATGCCTTTATGCCTATGGTTGTAGAGGCTGTTTCCTTGGATGATTATGTTTCTTGGGTATCCAATAAATTAGACTAGAAAGCACTATGTTGCATAAAAGGGGGCCAACCCCTGTGCCCTCGGCTCCGGCCCTTAGGCTCGTTTTTATCTCTTTTTGAACTAGGTTCAAGAATCTGTTGTCTCGAATTCTTCGCCGCATGAGGCCTATAAGCACTTGCTTATCTATTTTATTGAAGTATTGCGAGGTTTCACCTTGTATGAACCAGACGGTCCCCACAAAGTCACGGCGTATCCTTTTTTTGGCCGTGGCAGATGTGCGGCCAAACTAGTTCTTTACAAGTTGAAACAGCTCAGCGAAGCTAAGCTTTTGGGTCCGAAGGAGACTTCTTTGGCTTTACGCGGGTGTTTAGGTTTGAAGAAGCTCGGTGAGAGACCACTTAGTTCTTATTATTTTCTGTGAGACTTGCTGTACATCACAATATTATAATTGAGATTT

mRNA

>Mapoly0150s0001.1
TTCTCGCCACAATGCCAGTAGGAGGTAAGTCTGACCTACCAACAGGAATTCCTTGATGCAATATCTAGAAGGTAGACATCTGTCACAAGATTGACAAGATTTATTAGATTGCCAAAAGCTTCCCTAATCTTTGTGGCAAGTTCATGAAATCAGCCAGATCTTCTGATGATTTATGTTCAGTTCCTTTTCAGAAGTAATATATTGAAAAATGATCATGATTATCAGTAACCTATCACTGCTTTATGTCGTTTCAATATAAATACTTCATCAGTTAATGAGACAAGCGTAAATTATGTCTCCTGGAAATTTTTTATTTTGAATTAGATAGCATGACAAGAGACAATGAAATAACTAACCACATGTATTTGTTGACTCCCAGATCCATCCATAAATCTTGTAAGATCTTTGCATCAGATCCGAGCACAAAGTTCTCAAGGATTCGAAGTTGGAGAAAATGGAGGGTTCTTCGACACTACCAAAGTTTTCTCAGAGGAGATGCCTCGAAGAGATAATCAATTCTAGCGAGGACAACCTCCCTTCTGCGGCAGTCGTGGATTTTCCCCTTGACAGAAAAGGGAAGAAGATGAGAGTTTATCATGCTCCGCAACCAAGGAAGCCAAGCACGTCTTGGACGGCGGAAGAGGACGAAACATTACGAGCAGCAGTCGAGAAATTCAAGGGCCGAAATTGGAAACAGATTGCTGCGAGTTTACCGAATCGGTCAGATGCTCAGTGCCTTCACCGCTGGCAAAAGGTTCTTAATCCTATCCTGGTTAAAGGATACTGGAGCAAAGAGGAGGACGACAAGATGCTCGAATTGGTCAAAACGTTCGGCACGAAGAGATGGGCTGCCATCGCTCGGGCAATGCCTGGCAGAAATAGCAAGCAGTGTCGAGAGAGATGGTGCAATCATCTGGATCCCAAGATAAAAAAGGAGCCGTGGAGTGAAGAAGAGGACATGATGTTGGTTATGGCTCACCAGAGGTTAGGCAACAGATGGGCAGAGATCGCAAAGATCATTCCTGGCAGGTCGGACAATGCCATAAAGAATAGGTGGAACACGGCAAAGAATAAACGGTCGGATGCACTGGAACAATCCAGTGAGAATTGGATCAACAGTAGCACATTTGGAGATATGTCTTCCTTTACCGAAGATGTGGCTCAAAGAGACCTTGACGCTAATCAACATGTTCTGGCATGGAATGGCGAGCCCAATGTTATGACATGGAATGGCGAGTCCAATATCGACATTCAAGATTCGAATGCGGCGGAGGACCTTGCATTGAACAGCGTGTTCGGACCGGATAAGATTGAGGATGAAGATTGGTTCCCGGACTTTGATTTTTGTCTTTAATGTCAAGTTTTTTACAGCTAATCCCTACAAGGACCATGTAAATGTAATACTTTGTGGAACTAATCATGCCTTTATGCCTATGGTTGTAGAGGCTGTTTCCTTGGATGATTATGTTTCTTGGGTATCCAATAAATTAGACTAGAAAGCACTATGTTGCATAAAAGGGGGCCAACCCCTGTGCCCTCGGCTCCGGCCCTTAGGCTCGTTTTTATCTCTTTTTGAACTAGGTTCAAGAATCTGTTGTCTCGAATTCTTCGCCGCATGAGGCCTATAAGCACTTGCTTATCTATTTTATTGAAGTATTGCGAGGTTTCACCTTGTATGAACCAGACGGTCCCCACAAAGTCACGGCGTATCCTTTTTTTGGCCGTGGCAGATGTGCGGCCAAACTAGTTCTTTACAAGTTGAAACAGCTCAGCGAAGCTAAGCTTTTGGGTCCGAAGGAGACTTCTTTGGCTTTACGCGGGTGTTTAGGTTTGAAGAAGCTCGGTGAGAGACCACTTAGTTCTTATTATTTTCTGTGAGACTTGCTGTACATCACAATATTATAATTGAGATTT

CDS

>Mapoly0150s0001.1
ATGGAGGGTTCTTCGACACTACCAAAGTTTTCTCAGAGGAGATGCCTCGAAGAGATAATCAATTCTAGCGAGGACAACCTCCCTTCTGCGGCAGTCGTGGATTTTCCCCTTGACAGAAAAGGGAAGAAGATGAGAGTTTATCATGCTCCGCAACCAAGGAAGCCAAGCACGTCTTGGACGGCGGAAGAGGACGAAACATTACGAGCAGCAGTCGAGAAATTCAAGGGCCGAAATTGGAAACAGATTGCTGCGAGTTTACCGAATCGGTCAGATGCTCAGTGCCTTCACCGCTGGCAAAAGGTTCTTAATCCTATCCTGGTTAAAGGATACTGGAGCAAAGAGGAGGACGACAAGATGCTCGAATTGGTCAAAACGTTCGGCACGAAGAGATGGGCTGCCATCGCTCGGGCAATGCCTGGCAGAAATAGCAAGCAGTGTCGAGAGAGATGGTGCAATCATCTGGATCCCAAGATAAAAAAGGAGCCGTGGAGTGAAGAAGAGGACATGATGTTGGTTATGGCTCACCAGAGGTTAGGCAACAGATGGGCAGAGATCGCAAAGATCATTCCTGGCAGGTCGGACAATGCCATAAAGAATAGGTGGAACACGGCAAAGAATAAACGGTCGGATGCACTGGAACAATCCAGTGAGAATTGGATCAACAGTAGCACATTTGGAGATATGTCTTCCTTTACCGAAGATGTGGCTCAAAGAGACCTTGACGCTAATCAACATGTTCTGGCATGGAATGGCGAGCCCAATGTTATGACATGGAATGGCGAGTCCAATATCGACATTCAAGATTCGAATGCGGCGGAGGACCTTGCATTGAACAGCGTGTTCGGACCGGATAAGATTGAGGATGAAGATTGGTTCCCGGACTTTGATTTTTGTCTTTAA

Protein

>Mapoly0150s0001.1
MEGSSTLPKFSQRRCLEEIINSSEDNLPSAAVVDFPLDRKGKKMRVYHAPQPRKPSTSWTAEEDETLRAAVEKFKGRNWKQIAASLPNRSDAQCLHRWQKVLNPILVKGYWSKEEDDKMLELVKTFGTKRWAAIARAMPGRNSKQCRERWCNHLDPKIKKEPWSEEEDMMLVMAHQRLGNRWAEIAKIIPGRSDNAIKNRWNTAKNKRSDALEQSSENWINSSTFGDMSSFTEDVAQRDLDANQHVLAWNGEPNVMTWNGESNIDIQDSNAAEDLALNSVFGPDKIEDEDWFPDFDFCL

Mapoly0150s0001.2  

Gene structure:

mRNA scaffold_150:8301..15455  ( - strand )
three_prime_UTR scaffold_150:8301..8841  ( - strand )
CDS scaffold_150:8842..9166  ( - strand )
CDS scaffold_150:9284..9412  ( - strand )
CDS scaffold_150:9627..9730  ( - strand )
CDS scaffold_150:9834..9928  ( - strand )
CDS scaffold_150:10250..10307  ( - strand )
CDS scaffold_150:10765..10831  ( - strand )
CDS scaffold_150:10950..11071  ( - strand )
five_prime_UTR scaffold_150:11072..11099  ( - strand )
five_prime_UTR scaffold_150:11323..11369  ( - strand )
five_prime_UTR scaffold_150:15286..15455  ( - strand )

Sequences:

Gene

>Mapoly0150s0001.2
TTTAGTTCAATGTGTTCAATTCAGTTCACGAGACGATCGTCTAGACAGATTGCTTGACTTTCCAACTTGTGACATACGCGATTCCTTAGCGATCATTCGCATACTACTTTCTTGCTGCTGAGCTACTGATCGAGTTGCTCTGAGAGACACAGAGTTGTGATCTAGCTCAGGTTTGTTGACATTTCAAAATCATCAACAAAATTTCAGTAAAATAGTATAATAGTAGGAGAGTAATAAACCTTTCGTTTTTTGGCAATTACTAATCTGATTAATGTTATGTGGTTACTCTACTGACATGGTTTATCTCAGCTCAATGACCCTTTCGACGCTATATAATCATAAAGTTTGCACAGAAGATGTGAACAGTGTAAATAGAATGTGTTTAGAAGGATTATTCTTTTCTCGCGAACTTATTTGCCCAATTACAAATTTTAATGGCTTCATTCCTAGATTAATCTACTACTTCAACAATAAAGGTTGATCCAAAGATGTCAAAAGGTAATTTTTCAATCGGTGCATTTCACTGCGTTTCCTCAGTCTGCCATGGTGACATATATTGTGGTTTATGTAAGTACTTTGCATGGCCACGGTTGAGTTTTAAACTTATAAAACCTATCAAAAAATCTTGATCAGATTTGTGAAAGTACATGCAGGTATTCCCATAGTTGTGTTTGAAACTTACAAACTAACACAAAGATTGATTAGATTTGTGAAAGTACATGTAATTATTTCGATGGTTGTGTTTGAAACTTACAAACTAACAAAAAGATTGATTAGATTTTTGAAAGTAATTGTAAGTGTTGCCATAATTGTGTTTGAAACTTACAAATTAACACAAAGATTGATTAGATTTGTGAAAGTACATGTAATTACTGCGATGGTTGTGTTTGAAACTTACAAACTAACAAAAAGCTTGATTAGATTTTTGAAAGTAATTGTAAGTGTTGCCATAGTTGTGTCTGAAACTTAAAAGCTATAAAATAATCTGATAAGACTTGTAACAGTAATTGTAAGTATTGTCATGGTTGCGTCGAAAACGTAGAAACTAACAAAATATCTTGTCACATCTGGGAAAGTACTTTTGTTTATTGCCATGGTTGGTTCGAAACCTACAAGCTATAAACAATTTGATAAGATTCGTAAAAGTACTTGTAAGTATCGTTATGGTTGTGTCTGAAAGGTTAAAACTATCAAAAATCTGGTCATCTTAGTATTGCTGTAAATCTTTATCTTGCCTTTTACATTGTTCAATTATCTTAATTGAATGAAAACAAACGATGCGATTTGTTCAATTATTCACGTCTTCTTGCTAATTTCAACCAACTTCAAGTAATTTACAAGATTCATTCGACCATATAAAAGTTATTTGTTGCTTCATAATGCCATATTGAGTTAGAAGACCTCTTAGGATCTCCTTAGTCCCTTTCAAGGGTCGAAAGAATCTCTTTTGAGATTCTTTCTTACATACTCTACCGCCTTGACATAGCAAATTCATAGGAAACTATTCAACTTCTTCTTCTCCATATATGAAGAATATGAATGCAAACATCCAAGAAAAGTAGATATCTGGAATCTATTTTCCGACTGATTCATAAAGATGATGAAACAAATCTGTTTATATGCTGTAGAAACTTCGTACGTTTGACCATACTATTCACTATACCCATACAAGAAAAGTACTTATCCAACTCAGAAATAGTTGTCAGGTATCATTCGATTTCATGACTAACATCCAAAATGTTGTCATATAACCTTGTGTAGTGTTGTAGCATTCGCTTTCTAAGAAAACAGAAACCTCTTGGTTGAAGAAAACCCACATCGTCTCTCGTTCCATGTGAATTAGTATTTCATGCAGATAAGATTGTGAAATTTCGACAGATGGAGTGTTGATAAACAATCCATTGTCACCAGATCTCACTATTTGAAGGATATTATTTTCAAAATAAGCCAAGAGAGATGATTCTAACTTAGAAAAGATACACATCAGAAAGACTAAAGTCATTTTTTCCTGATTTTCAACCTTTTTTCTCTTAGGAAAGCCTATACCAAAGAAGCCTCAATGAAACGAGTTTTTTTCTTATAAAATTTGTACTGATTTTATCATGTAGATACCAGTTTTTTGGATTTATTTTACAATTCATCGCTTGAATCCATTCCTCTGCTTGATATTTGATATGTTGTAAAATTATATGGGTCCTTGTAATTAGAATCTTCTGAGAAAGTGTTTTTTTTTGTGAAGGAAGGATTCTTGCTTATTGCTTCTATCATCCATTTGCTGGTGTTTAGCGAGATCATATATGAATAAGTTTATGGAATCTTCTACAGCCTCCTCAACACCTGAAGGAAACATTGAAAATAAGAGTTAAACTTGTTTAAAATAACCTGTATCAGACTGTTTAGACACTACTGTTTAGACACTACATGTGTTGAGGTCAAGGTTTTTACATTTGACGACACATATTTAAACTTGACTTTCAAATATAATGGTGCAGTTCAGCAGGTGAGGAAGTTTCCGACTTTTTATATCCTTCAATATCTTTATTTTTATGTGGTTTTAGGATTTCATGTTTTCTAGGAAGTTCAAGCAAGATAACTTCTAGTTGATGATTGACAAGCTATGATTCAAACGACCAAGCTTTACTTATCACGCCATTTTTGGTGCTCATTAATTAGATCATCCATGTTTCTTGTGTGTAGTAATTGCATAACAAAAAAATGGTTTTACTGAGAACTATATGTTCTCAAATTTGAAATTAGACCCATAGGAATTCTGATTCTATCAACTAAATTAAATTGGTAAGTGTTTTTCTTCTCTTATCTCACATCATTCCAGACGATAGGCTCCTTCCCAAATCTTACTCCAATTATACGTTACACCAGTCTACACGAACAATGACGATCATAAAGCCTCTCATATCTTGTTTAGATACTTAATCAAACTTTCCATACCCCTTACTTCTTGATAGTATCTTTTTGTAGAGATTCCCACCTTACTGTTGAATAATACCTCTCATATCTTGTTTAGATACTTAATCAAACTTTTCATACCCCTTACTTCTTGATGGTGTGTTTTTGTCGAGATTCCCACATTACTGTTGAATATTACGTCACATTGGAATCTGCCTAGTTCCTAGACCCTAGATCAAAAAGGTCACTTGTCTTCATGAGATCAATTCTTTAATTCATATTCATAGAATATATGTTGGTTTGCCCATTGTGATATTGCAATGGAATATTTCTGGCTATTTCAAGATCGCTGAAGCAATCAAATTTGTCTAATATGACAAATATTCCGACTAACGCATAGACGAGAGAAGAGCGATATTATGTTGTTGAACATCTCACTTCCTTGGATCAGTTCTTTTCACATCTTGCACGCTTATCTGACAAAGGGATGCACGAGAGATCAATATGAATTATCCTCTTTACTGAATTCTCTTGTTGATCACTTCGATAGGATCAGACTAAGATACATTTGTTACAGTTATTCATCTCTTTCCAGATGACACCAGATATGTTTTCCATATGGGAAATTTTTCTGTCTAAAGGATGGAATAATAAGGGTAGAGATGCCAGTTTTTTTACCAGATCCTGAAGTTCATAAATGTTAATCCTAAACCTAGGGAATTGTCCCTAGGTTTAAGATTTCTTTGGTAGCTTAGACTTAGGGTGTTTGATATATCTTGGATTCTAACTGTATCTAAGAGTTCTCGCCACAATGCCAGTAGGAGGTAAGTCTGACCTACCAACAGGAATTCCTTGATGCAATATCTAGAAGGTAGACATCTGTCACAAGATTGACAAGATTTATTAGATTGCCAAAAGCTTCCCTAATCTTTGTGGCAAGTTCATGAAATCAGCCAGATCTTCTGATGATTTATGTTCAGTTCCTTTTCAGAAGTAATATATTGAAAAATGATCATGATTATCAGTAACCTATCACTGCTTTATGTCGTTTCAATATAAATACTTCATCAGTTAATGAGACAAGCGTAAATTATGTCTCCTGGAAATTTTTTATTTTGAATTAGATAGCATGACAAGAGACAATGAAATAACTAACCACATGTATTTGTTGACTCCCAGATCCATCCATAAATCTTGTAAGATCTTTGCATCAGATCCGAGCACAAGTGAGTGTAAGCATGAATAATACATTAATAGTTGTAGGGTCTGGCTGAGTCATCGTAATCAATTTCAATCATAAACTCCTCAATAATGCAGGTCATATAATCAGATATGTTTCTCTCTGATAATTCGCACCCTCGGAGTTGGCCATGTGTGTCATCTACATTAATTTGTGTGCTTCTAAGTTACCAGTTTCGTGAAACTAACAACTTTATGACTAAACTTCAGAGTTCTCAAGGATTCGAAGTTGGAGAAAATGGAGGGTTCTTCGACACTACCAAAGTTTTCTCAGAGGAGATGCCTCGAAGAGATAATCAATTCTAGCGAGGACAACCTCCCTTCTGCGGCAGTCGTGGATTTTCCCCTTGACAGAAAAGGGTAAGCACAATTTATTTTCCTCGAAATTACACAGCGTTTTGTAGTTGTCTTCATGTAGATCCGAACGACGCATGGTCTCTGAAGCCGAATATTCTTGTAACTTCTATGGATGTAACAGGAAGAAGATGAGAGTTTATCATGCTCCGCAACCAAGGAAGCCAAGCACGTCTTGGACGGCGGAAGAGGTGAGTAAACCATTGTTTGATAACTAATACTGGTGTAGAATCTATGTAGACAAATCAGTCTTAGGAAAGTTTGAAGACTCGACAAATTCAATGTGGATTCTGTCACGATTTTGAAGCCATGATGCTCATGACCTTCAGAAGAAGCACTCGAGTTCCTCCAAGTATGAATGATGTTTTAGGTTCAATTTGTTGATAAATTATGCTTAGATTGGCGAATACAACTGAAGGTAAGTTTTTCGATTCATTATCAGGCTGTCACAGGATATATTTTCTCGCTCCGATATTTGACTTGCCCTGCACCATCTGTAGTATGCTTAAGTAGGGTCTGGTTCTCTGACCACTGTTATTCAATGTAACATCTGATTAACATCCACAGGTGTTCTGAAGTGAATATCTGCAATGACTGAGTTTTACAACTAATCTGAACCCAAGGAGACTGTTTACTTCATTGCTACAGGACGAAACATTACGAGCAGCAGTCGAGAAATTCAAGGGCCGAAATTGGAAACAGATTGGTGAGTATCAGAAACCGTTGGGGGCGCGTCCATCAAATTCAAATTTGAATTTGAACTACCCGCTAGATGTGATACGCGTGTGCCCTTGTCATCGGGACTTGTACATATTTTGGCGGGCGTAGTTCCTCAAAGTAGTTGCTCAAAGGAGTATTGATCTCGAGGCTGCAATAGTGGATTGATCTCAGCATTTGCACGACGGCGCAGACGAAGAGAATTGAGACAAAGATGACGAAGAGAATTGAGACAGAGATGACGCAAAAGGTGACCACAACTCTTCTTTGTAATATCTGAATTTATGTATTGGACTGATGGCATGTGCAGCTGCGAGTTTACCGAATCGGTCAGATGCTCAGTGCCTTCACCGCTGGCAAAAGGTTCTTAATCCTATCCTGGTTAAAGGATACTGGAGCAAAGAGGTAAGTGACTCTTATATAAGCACATATTAAATTACGAGAGTGAGGTATCCCAGATACCACGTTCGACAAATGTGATGATTGATTTAAGTAGCTATTTTCGCAGGAGGACGACAAGATGCTCGAATTGGTCAAAACGTTCGGCACGAAGAGATGGGCTGCCATCGCTCGGGCAATGCCTGGCAGAAATAGCAAGCAGTGTCGAGAGAGGTGCGTATGAAGTATGTGGCTGATTTATATGTTCCTAACCTAATACGATAGTCCCTGAAATATACTATTGATGGTAATGCTGCTAGCATGAGAATTTTGAGCTGCAACCGTGAGTGTATAGGAAACGTGAGGACTGAATGTGTGCTTTACTTCAAATGTGGAACTAAATTATTCACAAGAAATCTCTCTAACTTGCTCATTTATTGCTACAAAGATGGTGCAATCATCTGGATCCCAAGATAAAAAAGGAGCCGTGGAGTGAAGAAGAGGACATGATGTTGGTTATGGCTCACCAGAGGTTAGGCAACAGATGGGCAGAGATCGCAAAGATCATTCCTGGCAGGTAATTTCAGTATATTTGCAAAATTTAGATTTTATGAGGCCAAGCTCTATTATAATTTTTCGTTAGCAATTTTCTCATGTAATTCTTCTGATTGTATTACATTTACACAATTATCAGGTCGGACAATGCCATAAAGAATAGGTGGAACACGGCAAAGAATAAACGGTCGGATGCACTGGAACAATCCAGTGAGAATTGGATCAACAGTAGCACATTTGGAGATATGTCTTCCTTTACCGAAGATGTGGCTCAAAGAGACCTTGACGCTAATCAACATGTTCTGGCATGGAATGGCGAGCCCAATGTTATGACATGGAATGGCGAGTCCAATATCGACATTCAAGATTCGAATGCGGCGGAGGACCTTGCATTGAACAGCGTGTTCGGACCGGATAAGATTGAGGATGAAGATTGGTTCCCGGACTTTGATTTTTGTCTTTAATGTCAAGTTTTTTACAGCTAATCCCTACAAGGACCATGTAAATGTAATACTTTGTGGAACTAATCATGCCTTTATGCCTATGGTTGTAGAGGCTGTTTCCTTGGATGATTATGTTTCTTGGGTATCCAATAAATTAGACTAGAAAGCACTATGTTGCATAAAAGGGGGCCAACCCCTGTGCCCTCGGCTCCGGCCCTTAGGCTCGTTTTTATCTCTTTTTGAACTAGGTTCAAGAATCTGTTGTCTCGAATTCTTCGCCGCATGAGGCCTATAAGCACTTGCTTATCTATTTTATTGAAGTATTGCGAGGTTTCACCTTGTATGAACCAGACGGTCCCCACAAAGTCACGGCGTATCCTTTTTTTGGCCGTGGCAGATGTGCGGCCAAACTAGTTCTTTACAAGTTGAAACAGCTCAGCGAAGCTAAGCTTTTGGGTCCGAAGGAGACTTCTTTGGCTTTACGCGGGTGTTTAGGTTTGAAGAAGCTCGGTGAGAGACCACTTAGTTCTTATTATTTTCTGTGAGACTTGCTGTACATCAC

mRNA

>Mapoly0150s0001.2
TTTAGTTCAATGTGTTCAATTCAGTTCACGAGACGATCGTCTAGACAGATTGCTTGACTTTCCAACTTGTGACATACGCGATTCCTTAGCGATCATTCGCATACTACTTTCTTGCTGCTGAGCTACTGATCGAGTTGCTCTGAGAGACACAGAGTTGTGATCTAGCTCAGATCCATCCATAAATCTTGTAAGATCTTTGCATCAGATCCGAGCACAAAGTTCTCAAGGATTCGAAGTTGGAGAAAATGGAGGGTTCTTCGACACTACCAAAGTTTTCTCAGAGGAGATGCCTCGAAGAGATAATCAATTCTAGCGAGGACAACCTCCCTTCTGCGGCAGTCGTGGATTTTCCCCTTGACAGAAAAGGGAAGAAGATGAGAGTTTATCATGCTCCGCAACCAAGGAAGCCAAGCACGTCTTGGACGGCGGAAGAGGACGAAACATTACGAGCAGCAGTCGAGAAATTCAAGGGCCGAAATTGGAAACAGATTGCTGCGAGTTTACCGAATCGGTCAGATGCTCAGTGCCTTCACCGCTGGCAAAAGGTTCTTAATCCTATCCTGGTTAAAGGATACTGGAGCAAAGAGGAGGACGACAAGATGCTCGAATTGGTCAAAACGTTCGGCACGAAGAGATGGGCTGCCATCGCTCGGGCAATGCCTGGCAGAAATAGCAAGCAGTGTCGAGAGAGATGGTGCAATCATCTGGATCCCAAGATAAAAAAGGAGCCGTGGAGTGAAGAAGAGGACATGATGTTGGTTATGGCTCACCAGAGGTTAGGCAACAGATGGGCAGAGATCGCAAAGATCATTCCTGGCAGGTCGGACAATGCCATAAAGAATAGGTGGAACACGGCAAAGAATAAACGGTCGGATGCACTGGAACAATCCAGTGAGAATTGGATCAACAGTAGCACATTTGGAGATATGTCTTCCTTTACCGAAGATGTGGCTCAAAGAGACCTTGACGCTAATCAACATGTTCTGGCATGGAATGGCGAGCCCAATGTTATGACATGGAATGGCGAGTCCAATATCGACATTCAAGATTCGAATGCGGCGGAGGACCTTGCATTGAACAGCGTGTTCGGACCGGATAAGATTGAGGATGAAGATTGGTTCCCGGACTTTGATTTTTGTCTTTAATGTCAAGTTTTTTACAGCTAATCCCTACAAGGACCATGTAAATGTAATACTTTGTGGAACTAATCATGCCTTTATGCCTATGGTTGTAGAGGCTGTTTCCTTGGATGATTATGTTTCTTGGGTATCCAATAAATTAGACTAGAAAGCACTATGTTGCATAAAAGGGGGCCAACCCCTGTGCCCTCGGCTCCGGCCCTTAGGCTCGTTTTTATCTCTTTTTGAACTAGGTTCAAGAATCTGTTGTCTCGAATTCTTCGCCGCATGAGGCCTATAAGCACTTGCTTATCTATTTTATTGAAGTATTGCGAGGTTTCACCTTGTATGAACCAGACGGTCCCCACAAAGTCACGGCGTATCCTTTTTTTGGCCGTGGCAGATGTGCGGCCAAACTAGTTCTTTACAAGTTGAAACAGCTCAGCGAAGCTAAGCTTTTGGGTCCGAAGGAGACTTCTTTGGCTTTACGCGGGTGTTTAGGTTTGAAGAAGCTCGGTGAGAGACCACTTAGTTCTTATTATTTTCTGTGAGACTTGCTGTACATCAC

CDS

>Mapoly0150s0001.2
ATGGAGGGTTCTTCGACACTACCAAAGTTTTCTCAGAGGAGATGCCTCGAAGAGATAATCAATTCTAGCGAGGACAACCTCCCTTCTGCGGCAGTCGTGGATTTTCCCCTTGACAGAAAAGGGAAGAAGATGAGAGTTTATCATGCTCCGCAACCAAGGAAGCCAAGCACGTCTTGGACGGCGGAAGAGGACGAAACATTACGAGCAGCAGTCGAGAAATTCAAGGGCCGAAATTGGAAACAGATTGCTGCGAGTTTACCGAATCGGTCAGATGCTCAGTGCCTTCACCGCTGGCAAAAGGTTCTTAATCCTATCCTGGTTAAAGGATACTGGAGCAAAGAGGAGGACGACAAGATGCTCGAATTGGTCAAAACGTTCGGCACGAAGAGATGGGCTGCCATCGCTCGGGCAATGCCTGGCAGAAATAGCAAGCAGTGTCGAGAGAGATGGTGCAATCATCTGGATCCCAAGATAAAAAAGGAGCCGTGGAGTGAAGAAGAGGACATGATGTTGGTTATGGCTCACCAGAGGTTAGGCAACAGATGGGCAGAGATCGCAAAGATCATTCCTGGCAGGTCGGACAATGCCATAAAGAATAGGTGGAACACGGCAAAGAATAAACGGTCGGATGCACTGGAACAATCCAGTGAGAATTGGATCAACAGTAGCACATTTGGAGATATGTCTTCCTTTACCGAAGATGTGGCTCAAAGAGACCTTGACGCTAATCAACATGTTCTGGCATGGAATGGCGAGCCCAATGTTATGACATGGAATGGCGAGTCCAATATCGACATTCAAGATTCGAATGCGGCGGAGGACCTTGCATTGAACAGCGTGTTCGGACCGGATAAGATTGAGGATGAAGATTGGTTCCCGGACTTTGATTTTTGTCTTTAA

Protein

>Mapoly0150s0001.2
MEGSSTLPKFSQRRCLEEIINSSEDNLPSAAVVDFPLDRKGKKMRVYHAPQPRKPSTSWTAEEDETLRAAVEKFKGRNWKQIAASLPNRSDAQCLHRWQKVLNPILVKGYWSKEEDDKMLELVKTFGTKRWAAIARAMPGRNSKQCRERWCNHLDPKIKKEPWSEEEDMMLVMAHQRLGNRWAEIAKIIPGRSDNAIKNRWNTAKNKRSDALEQSSENWINSSTFGDMSSFTEDVAQRDLDANQHVLAWNGEPNVMTWNGESNIDIQDSNAAEDLALNSVFGPDKIEDEDWFPDFDFCL

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>