Mapoly0151s0042



Description

Domain of unknown function (DUF296)

Reference DB

Database ID Description
OrthoMCL OG5_139537
PFAM PF03479 Domain of unknown function (DUF296)
PANTHER PTHR31500 FAMILY NOT NAMED
PANTHER PTHR31500:SF0 SUBFAMILY NOT NAMED

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpATHOOK3 transcription factor, AThook Mapoly0151s0042.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0151s0042.1 scaffold_151:369835..375624  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)
Mapoly0151s0042.2 scaffold_151:369882..375624  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0151s0042.1  

Gene structure:

mRNA scaffold_151:369835..375624  ( + strand )
five_prime_UTR scaffold_151:369835..370350  ( + strand )
five_prime_UTR scaffold_151:370743..371077  ( + strand )
CDS scaffold_151:371078..371594  ( + strand )
CDS scaffold_151:371785..371796  ( + strand )
CDS scaffold_151:372110..372177  ( + strand )
CDS scaffold_151:372277..372408  ( + strand )
CDS scaffold_151:372730..372891  ( + strand )
CDS scaffold_151:374049..374438  ( + strand )
three_prime_UTR scaffold_151:374439..375624  ( + strand )

Sequences:

Gene

>Mapoly0151s0042.1
GGGGCTGCTGGGGGACGAAGACGGGGAGCGGACGGCTGAAAGAGCCAGGAGTGGCGCAGAATTAGGCTTTCTCCTCTCTGTCGCTCCCATGGTTCCTTTGTTTTCTGGAGCGGAGGTGAGGGGGGAGAGGATTGCGAGCGAGAGGGGAGGGAGGGGAGGGGAAGCGAGAGGGAGAGGAGGGGGAGGGAGGGAGGAAGGGGCGAGAGGCGGTAGGTGAAGAGGGGAGGGGGAGAGACGAGATGGGATCATTTCTTGAGGAAATTTATTTTGGGGGAGTAACGGAGGCCCTTCTCCCGAGAGAGTGTCGTGAGAGGAGGAGAAATTAAAAAATGGTGAGGAAATGGAATTGCGAGCATTGTTAAATATTCAAATGATTCTACATTAGGGTCGAATTTCTTTTCAGCTGATCCGGAGATAGTTTAGTCCTTTACTACCCCGTGCTTTGTTTTATTGGCATATAATCAATCTCCTGGACTAAGAGTTATATCCCCTACTTCTCCTCATTCTGTTCCGAAGGTAAGTTCTTCCTTCTACTGCTGATTCTGCTTTTGCATTGTAACGAAGAGAATGCTGCTGTGTATCGAGTCTATTGTATTTCGCGCGTGCTTGAACCCGATCTCATAGCCCACAAGAAAGAGCGTCGTAGATTGTGTCCAGGGCGCGCAATGAATATCGCGGACTCGATTCCGCGGTGGTGTCGCGGAACCCAAGTTCCCATGGGCTGGAGAATGAGAGTGGGCAGGAGATCGAAGGGCTATGCGATGTTGGACGATGAGGATAGGAGGGGTTTAGTTAAACATCGTTGTGCCCAAAGACACTAGTCCAGTCGCAGGCACGCGTTGTGGGGCGCCGGCAATGAGATGGAGTCTAACAATGTGCGCGGTTTGTGCGTCTGTGACATGTTGCAGACTGTCAGTCAGCTGGGTTGTTTGCGCAGGAGGCATCTCAGACGTCTTCGAGGTCATGAATCACTGCTACCATGTTCCTCGAGGGTTTGGAGTGCAGATGGGGCTCTGCGGGCTGATTAGATAGCTGTCGCACTCTCGCGCTCCTTCAAATCCTCTTTCGAACTCCGAGGGCAAGAGGCCAGGAACCGCAGAGCGACGCCGGGGCCCAGAGCCAAAGAAGTCGAGGGAGAAGCCGACGACCGAAGTAGGAATAGTTAGCTGACATCTTCAGCTGAAGAGCAGTGTGTGCGGATCGAAGCGGTTTCAGCCGGCGGGCCGGATCAGTTAGTACATGCATGGAAGGCAGGGATGGAGTCAGTTCAGGAGGAGGCGGGAGCATGCCGGGAAGTTTGGGCCTTCACTTGCAACAAAGACCTGCTGGCTCGGCCGTGACGTCGCCCTCTGGCTTGCACACTCCCGCCCCTCTGCGGCCCGCCCCTGCTGCAACTGCTATCACCCTCGCTAGCCCGAGCCCCAGTCCCGCGACCAACAGCAGCACCTCTCCGTCAGATGGTATTGCAACAACTCCGCACTCTGCAATCATGAGTATGAATATCGGACAAGCAGGCAGTTACACTCCCATCGCTTCGTCAGGAATGGTGGCAGCGAGTTTAGGAGCCCGCCCCGAGCCTCCCAAGAGAAAAAGGGGGAGGCCTAGAAAATATCCTGGCGCAGATGCCAGCCCAGGAGGCAGCCTGGGAGTGTCGCTTGCCTTGACTCCCATCGCTGCCAAATCGCCACAATCTCCTACCGAGAAACGTGGGCGAGGGCGACCGCCCGGTTCAGGAAAGAAACAACAGCTCGCCGCCTTAGGTATTCTTGTGATCCTCGCTCTTCTATCGTGCTCGGGATTCCTCCTGTTCGTGCACATCCTTGTAATTTTCTTGTTTGTATGGCATGTTTCATAGACCTTGGAGGTGTGCTTGCTTTTGTATCAATCTTCGTCCGCATGCGGTAAGCCGCACCAGCTTTTCTAATGAATCTTTTTTTTTCTTTCTTGCAGCTACAGCAAACGGTATTTACTCCAACCCTGATCATCGATAAAGCGATGTGATGACTGTGGTCCTTACCGCATGCGTGTCTCTGGAGGAGGCTACTCCTCTTTAGTCTCTTCGTCCGGTCTTTGTCATACTGCATTTTCGAAAGCGGAGGGGCCTTCTCGTCAAGTAGTTCTTGAGAATCTGAAATTTCTGATATGTCTTGTTGTGTCTGTCTCGCTAGTACCTGTTATTGTCGGGCTCTCTTTCTATATTGTCGGCGCCGTGAATTCTTTTTCTGTTTTGGAGCTAGAATCATTCTCGCAATTTGGTTCCAAACCGTGTGTTCAGGTGCTTGGTTGGCAGGAGCAGCCGGAGGAGGTTTCACTCCGCACGTAATCACTATTGCCGCCGGAGAGGTACAAAATAAAAAGCATGTTATGATAATTGCGTTGGGTTCTTGCGACTTGCTGGAAAGTTTTGGCGAACTAACTTGGTGGCCCTCTCTCGCCTCACAGGACGTTGCCAACAAGGTGTTTGGCTTCTCGCAACAAGGACCGCGTGCAGTATGCGTGTTATCGGCGAATGGTTCAATATCAAATGTTACCTTACGTCATGACTCTTCTTTCGGCGGTAACATCACCTACGAGGCGAGTGCTTTCCTAGTTATGAACAATGCCTGGCTTTCTCTCAGAGAGGGCAGGTCTTTCTCGGTTTATGAACTAATGATTTGTACATTCTAGGAATGTGTAATTCCCGTGGATATGGATACGATGCAGCTGTGATTCTTACCTTTTTGATGCTACATTCTCTCAGGGAGGTTTCTGAATTTTAGACTAGAGAATTTTACGCATGTAGAGAATTTAGGACGATTTTTGGTCTGAGCATCAGCATGATGAGCTTCTCAACCAGAGTAGCCCTTTTTCGGAGCTGCTTTACTGACGAAATAATCACTTTCGCTGGTCAAGCAGGGTCGTTATGAGATTCTTTCCTTGTCAGGTTCGTTTCTACCCACTGACGTCGGAGGCACTCGTAGTCGGACTGGTGGTTTGAGCGTGTCGTTGGCCGCTAACGACGGGAAAGTGGTAGGAGGAAGTGTGTCGGGATTACTGGTCGCGGCTACGCCAGTACAGGTAATTTTTCGACAAATTGTTCGAATTATTGATGTGCCTATCTTTTCTTTGGGTTCTTGAACCACTATCCGAAGTCGTAGTAGCCAGACAAAGCTAGTGTTGTGCATGTGCCACGAACACTTCATTGATCCAATCATAGCTCCTGGACCTACGAGACTGATCTTCTTACGTGATTTTGCTGACACAGTGTGACATATGGTCTAGCATGTCTATATTTTCTAGAACACATAGTTATTAGCCACGTTTACGCCGAACGTAAGAGCTGGCGTGCGAGGAGATGAGTGAACGAGCCGATGTTTGATCTTGCTCTCCATTCTCTCAAACCAGTAGATGAAACTAGAAGGCCTTCATCTGGTTTGGTCTGTTGGTTTGTAATGTAGTTCATTCGTTCTTGTCTCCTCGGCCGTGGATAGGTGTTGTTAACACTTCCATTTTCTGCTGCCGCCAGTTCTTGAAAGGTCCTTTTAAATTATACGTTCTTTGATTGTCGGTAAGAATCCTTTTGTCCATTCTAAGCCGGCGAGCTCATGGCCTTTACTAAAGATCGAAACCGCTTTTTCCGGTGGTATAGTGCCGTCCAGTTTACTTGGAGTCTTGTAATGAGTGTCCTGAGCTTTCGAGTTATCAAGCACTCCTTCCAGTATTGACGATGATGCTACTATCATCCTTACGAGTTGTCCGCTAGAACGAGATCTAGTTTTTGGTCCTTCAGTTTTCTAACTAAAGGTTTATACTCATTCTGTCAATGACTTGTTGTAAATTGTAGATACCCTCCCACAATATAGTAGCCATGGTGTATGTCTCATTCAGTGTTCTCGAGAAATTAAGAGTAGGAAATACATTGTTCCATCTCTATTCGCGTGTATGTGCCACACTTGGAACGCACCTGGCATCTATACGCGACCGCACTATCTGTCACAAATGGGAGCCATTTCTCACCACCAGGGAATGGGATACCTGGTCACGGTTATGCCTCTCGCACTAACGTCTGTGGCGTCAGTACAGATGGAGAAATCCTTTGTAGTGTCGGTCGCAATAGTTGTATAGGTGGAATATAATGTCTTGAATACTTCTTTCTTCTTTCCCGTCTTTATCATTTGGCGATGGATCAGCAAGAGACTCAAGTCATTTTTCTCTTACTGTGATTGAGCCTGCAGATTGTCGTCGGGAGTTTTGTTCCCGACTCTGGAATAAAGCCCACGAGACTTCCGACCTCACCTGCGCCTGCGGGAAACGGGGAATCGAATAGCGCAATGATGACGTCGATCGGGCTGGCACCGGCGATGGGATCCACGGGTGTGACGGTGGCCTCGCCTCCCGCGTCGGCAGCTCGGCTGTCGAAAACCGAACCGCCGTCGGCCGTGAAGGTAGCATCGAGCTCAGCTCCGAGCGCAACGCCGAACCACCAGGGAGGGAGTGCTAGCAGCGCAGCCGGGTCGACGCCCCAGAGCATGGGACTGTTCCAAACCGGAGGCTGGCAACCGACCCAAGTGGGAGCCGAGAGGCGGACTCCGACGGACATCAACATTTCGCTGCCGGGTGGGTAACTGCAAGAGTAAGACCAATTTTGGGACACCATCTATCTTCCGGAACTGTGGACAAGCCGAGTCGGTCCAGCACCAGGACCGAAAGTGTGATCAAGTCTGTGAAGTTGTTCAAGTGGCCACTGAGAGGTGTATAATCTCGCATCAGTCGTACCCCTGCCTGATTGACATTAGGGGGTTTTGCCATGAATTGTTCATCTTGACAGTGGCAACGTTGTGCTCCCGTTGGCAGATTTAGAGAGATTAGCTGCACGGTAATATCTGCTCCTTTTCCTTCGTGTTCTTTTGTTGGGGTTGGGACGACCTCATTCAGCGACCTTGAGAAGGTTCAACAGCTGGGGATTAGATATTTGCTCCTATTTCATCAGGTTCTTTTGTTGGGGGTGGTAGGACAGACGACCTCACCCAGCGACCTTTGTGCAAGGTACAAAAGTTCGGGATTAGAGCGACTTCATATCCCACATACAGTCGGAAGATGGGATGAAGATTCAGGATGTTTTAAATCCTCCCACCATCAAAATATCTACTTGTATTGAGACGAAGTTAGGCTTTGAAATGATGGTAGAACATGTCAGGAGTTCTTGCATGTTTCTTCTGCTGATGTGAGTTCCTAGAGCACTGTGATATGAGCCCTTAGCGGTCGAGACAGTTTCATTGTGACCTCGAGATTATTGTCCTTCTTTCAGCCGGTCACAGTCAAATGCCGCATGATTTTTTCCTCCATATTCACTCATGTGTACATTGTTCTGATAAGTAATTCCCTTCGCCTTTCATGAAAAGTCCCTTTTTTCCTCTGGTCTCCGATTGATATCGGTTCACGGAATATGCTTGTGACACTCTTTGTGCCACAGTTGTGCTTCAACTAGATACTGCTCAAAACCGGTAGCCTTTATTCGGTGAGATCTGACAATTTTCAACTGACTTGTTCTGTAAACAGACTGAAGTCTTTTCCAAATTCTAAGTACAGTAAGTGAACATGCGCAAGAGGCTCTCGTGTGCGAAGCACACTGTTCCATCTGAACGTGGCTGAGCATTTAGCAGGTAGTTAAACAGGATAACGCTTAGATGTCAGTTTTGGGTTTCAGCAGTAAAACACTTCTGAGCCATCAGTAGTTGTGCACTGTGCAACTATTTTATGTGTCAGTACTATTACTTAAACACATCAATTGAGATATCTTTTGCCGAGGAA

mRNA

>Mapoly0151s0042.1
GGGGCTGCTGGGGGACGAAGACGGGGAGCGGACGGCTGAAAGAGCCAGGAGTGGCGCAGAATTAGGCTTTCTCCTCTCTGTCGCTCCCATGGTTCCTTTGTTTTCTGGAGCGGAGGTGAGGGGGGAGAGGATTGCGAGCGAGAGGGGAGGGAGGGGAGGGGAAGCGAGAGGGAGAGGAGGGGGAGGGAGGGAGGAAGGGGCGAGAGGCGGTAGGTGAAGAGGGGAGGGGGAGAGACGAGATGGGATCATTTCTTGAGGAAATTTATTTTGGGGGAGTAACGGAGGCCCTTCTCCCGAGAGAGTGTCGTGAGAGGAGGAGAAATTAAAAAATGGTGAGGAAATGGAATTGCGAGCATTGTTAAATATTCAAATGATTCTACATTAGGGTCGAATTTCTTTTCAGCTGATCCGGAGATAGTTTAGTCCTTTACTACCCCGTGCTTTGTTTTATTGGCATATAATCAATCTCCTGGACTAAGAGTTATATCCCCTACTTCTCCTCATTCTGTTCCGAAGACTGTCAGTCAGCTGGGTTGTTTGCGCAGGAGGCATCTCAGACGTCTTCGAGGTCATGAATCACTGCTACCATGTTCCTCGAGGGTTTGGAGTGCAGATGGGGCTCTGCGGGCTGATTAGATAGCTGTCGCACTCTCGCGCTCCTTCAAATCCTCTTTCGAACTCCGAGGGCAAGAGGCCAGGAACCGCAGAGCGACGCCGGGGCCCAGAGCCAAAGAAGTCGAGGGAGAAGCCGACGACCGAAGTAGGAATAGTTAGCTGACATCTTCAGCTGAAGAGCAGTGTGTGCGGATCGAAGCGGTTTCAGCCGGCGGGCCGGATCAGTTAGTACATGCATGGAAGGCAGGGATGGAGTCAGTTCAGGAGGAGGCGGGAGCATGCCGGGAAGTTTGGGCCTTCACTTGCAACAAAGACCTGCTGGCTCGGCCGTGACGTCGCCCTCTGGCTTGCACACTCCCGCCCCTCTGCGGCCCGCCCCTGCTGCAACTGCTATCACCCTCGCTAGCCCGAGCCCCAGTCCCGCGACCAACAGCAGCACCTCTCCGTCAGATGGTATTGCAACAACTCCGCACTCTGCAATCATGAGTATGAATATCGGACAAGCAGGCAGTTACACTCCCATCGCTTCGTCAGGAATGGTGGCAGCGAGTTTAGGAGCCCGCCCCGAGCCTCCCAAGAGAAAAAGGGGGAGGCCTAGAAAATATCCTGGCGCAGATGCCAGCCCAGGAGGCAGCCTGGGAGTGTCGCTTGCCTTGACTCCCATCGCTGCCAAATCGCCACAATCTCCTACCGAGAAACGTGGGCGAGGGCGACCGCCCGGTTCAGGAAAGAAACAACAGCTCGCCGCCTTAGCTACAGCAAACGGTGCTTGGTTGGCAGGAGCAGCCGGAGGAGGTTTCACTCCGCACGTAATCACTATTGCCGCCGGAGAGGACGTTGCCAACAAGGTGTTTGGCTTCTCGCAACAAGGACCGCGTGCAGTATGCGTGTTATCGGCGAATGGTTCAATATCAAATGTTACCTTACGTCATGACTCTTCTTTCGGCGGTAACATCACCTACGAGGGTCGTTATGAGATTCTTTCCTTGTCAGGTTCGTTTCTACCCACTGACGTCGGAGGCACTCGTAGTCGGACTGGTGGTTTGAGCGTGTCGTTGGCCGCTAACGACGGGAAAGTGGTAGGAGGAAGTGTGTCGGGATTACTGGTCGCGGCTACGCCAGTACAGATTGTCGTCGGGAGTTTTGTTCCCGACTCTGGAATAAAGCCCACGAGACTTCCGACCTCACCTGCGCCTGCGGGAAACGGGGAATCGAATAGCGCAATGATGACGTCGATCGGGCTGGCACCGGCGATGGGATCCACGGGTGTGACGGTGGCCTCGCCTCCCGCGTCGGCAGCTCGGCTGTCGAAAACCGAACCGCCGTCGGCCGTGAAGGTAGCATCGAGCTCAGCTCCGAGCGCAACGCCGAACCACCAGGGAGGGAGTGCTAGCAGCGCAGCCGGGTCGACGCCCCAGAGCATGGGACTGTTCCAAACCGGAGGCTGGCAACCGACCCAAGTGGGAGCCGAGAGGCGGACTCCGACGGACATCAACATTTCGCTGCCGGGTGGGTAACTGCAAGAGTAAGACCAATTTTGGGACACCATCTATCTTCCGGAACTGTGGACAAGCCGAGTCGGTCCAGCACCAGGACCGAAAGTGTGATCAAGTCTGTGAAGTTGTTCAAGTGGCCACTGAGAGGTGTATAATCTCGCATCAGTCGTACCCCTGCCTGATTGACATTAGGGGGTTTTGCCATGAATTGTTCATCTTGACAGTGGCAACGTTGTGCTCCCGTTGGCAGATTTAGAGAGATTAGCTGCACGGTAATATCTGCTCCTTTTCCTTCGTGTTCTTTTGTTGGGGTTGGGACGACCTCATTCAGCGACCTTGAGAAGGTTCAACAGCTGGGGATTAGATATTTGCTCCTATTTCATCAGGTTCTTTTGTTGGGGGTGGTAGGACAGACGACCTCACCCAGCGACCTTTGTGCAAGGTACAAAAGTTCGGGATTAGAGCGACTTCATATCCCACATACAGTCGGAAGATGGGATGAAGATTCAGGATGTTTTAAATCCTCCCACCATCAAAATATCTACTTGTATTGAGACGAAGTTAGGCTTTGAAATGATGGTAGAACATGTCAGGAGTTCTTGCATGTTTCTTCTGCTGATGTGAGTTCCTAGAGCACTGTGATATGAGCCCTTAGCGGTCGAGACAGTTTCATTGTGACCTCGAGATTATTGTCCTTCTTTCAGCCGGTCACAGTCAAATGCCGCATGATTTTTTCCTCCATATTCACTCATGTGTACATTGTTCTGATAAGTAATTCCCTTCGCCTTTCATGAAAAGTCCCTTTTTTCCTCTGGTCTCCGATTGATATCGGTTCACGGAATATGCTTGTGACACTCTTTGTGCCACAGTTGTGCTTCAACTAGATACTGCTCAAAACCGGTAGCCTTTATTCGGTGAGATCTGACAATTTTCAACTGACTTGTTCTGTAAACAGACTGAAGTCTTTTCCAAATTCTAAGTACAGTAAGTGAACATGCGCAAGAGGCTCTCGTGTGCGAAGCACACTGTTCCATCTGAACGTGGCTGAGCATTTAGCAGGTAGTTAAACAGGATAACGCTTAGATGTCAGTTTTGGGTTTCAGCAGTAAAACACTTCTGAGCCATCAGTAGTTGTGCACTGTGCAACTATTTTATGTGTCAGTACTATTACTTAAACACATCAATTGAGATATCTTTTGCCGAGGAA

CDS

>Mapoly0151s0042.1
ATGGAAGGCAGGGATGGAGTCAGTTCAGGAGGAGGCGGGAGCATGCCGGGAAGTTTGGGCCTTCACTTGCAACAAAGACCTGCTGGCTCGGCCGTGACGTCGCCCTCTGGCTTGCACACTCCCGCCCCTCTGCGGCCCGCCCCTGCTGCAACTGCTATCACCCTCGCTAGCCCGAGCCCCAGTCCCGCGACCAACAGCAGCACCTCTCCGTCAGATGGTATTGCAACAACTCCGCACTCTGCAATCATGAGTATGAATATCGGACAAGCAGGCAGTTACACTCCCATCGCTTCGTCAGGAATGGTGGCAGCGAGTTTAGGAGCCCGCCCCGAGCCTCCCAAGAGAAAAAGGGGGAGGCCTAGAAAATATCCTGGCGCAGATGCCAGCCCAGGAGGCAGCCTGGGAGTGTCGCTTGCCTTGACTCCCATCGCTGCCAAATCGCCACAATCTCCTACCGAGAAACGTGGGCGAGGGCGACCGCCCGGTTCAGGAAAGAAACAACAGCTCGCCGCCTTAGCTACAGCAAACGGTGCTTGGTTGGCAGGAGCAGCCGGAGGAGGTTTCACTCCGCACGTAATCACTATTGCCGCCGGAGAGGACGTTGCCAACAAGGTGTTTGGCTTCTCGCAACAAGGACCGCGTGCAGTATGCGTGTTATCGGCGAATGGTTCAATATCAAATGTTACCTTACGTCATGACTCTTCTTTCGGCGGTAACATCACCTACGAGGGTCGTTATGAGATTCTTTCCTTGTCAGGTTCGTTTCTACCCACTGACGTCGGAGGCACTCGTAGTCGGACTGGTGGTTTGAGCGTGTCGTTGGCCGCTAACGACGGGAAAGTGGTAGGAGGAAGTGTGTCGGGATTACTGGTCGCGGCTACGCCAGTACAGATTGTCGTCGGGAGTTTTGTTCCCGACTCTGGAATAAAGCCCACGAGACTTCCGACCTCACCTGCGCCTGCGGGAAACGGGGAATCGAATAGCGCAATGATGACGTCGATCGGGCTGGCACCGGCGATGGGATCCACGGGTGTGACGGTGGCCTCGCCTCCCGCGTCGGCAGCTCGGCTGTCGAAAACCGAACCGCCGTCGGCCGTGAAGGTAGCATCGAGCTCAGCTCCGAGCGCAACGCCGAACCACCAGGGAGGGAGTGCTAGCAGCGCAGCCGGGTCGACGCCCCAGAGCATGGGACTGTTCCAAACCGGAGGCTGGCAACCGACCCAAGTGGGAGCCGAGAGGCGGACTCCGACGGACATCAACATTTCGCTGCCGGGTGGGTAA

Protein

>Mapoly0151s0042.1
MEGRDGVSSGGGGSMPGSLGLHLQQRPAGSAVTSPSGLHTPAPLRPAPAATAITLASPSPSPATNSSTSPSDGIATTPHSAIMSMNIGQAGSYTPIASSGMVAASLGARPEPPKRKRGRPRKYPGADASPGGSLGVSLALTPIAAKSPQSPTEKRGRGRPPGSGKKQQLAALATANGAWLAGAAGGGFTPHVITIAAGEDVANKVFGFSQQGPRAVCVLSANGSISNVTLRHDSSFGGNITYEGRYEILSLSGSFLPTDVGGTRSRTGGLSVSLAANDGKVVGGSVSGLLVAATPVQIVVGSFVPDSGIKPTRLPTSPAPAGNGESNSAMMTSIGLAPAMGSTGVTVASPPASAARLSKTEPPSAVKVASSSAPSATPNHQGGSASSAAGSTPQSMGLFQTGGWQPTQVGAERRTPTDINISLPGG

Mapoly0151s0042.2  

Gene structure:

mRNA scaffold_151:369882..375624  ( + strand )
five_prime_UTR scaffold_151:369882..370166  ( + strand )
five_prime_UTR scaffold_151:370743..371077  ( + strand )
CDS scaffold_151:371078..371594  ( + strand )
CDS scaffold_151:371785..371796  ( + strand )
CDS scaffold_151:372110..372177  ( + strand )
CDS scaffold_151:372277..372408  ( + strand )
CDS scaffold_151:372730..372891  ( + strand )
CDS scaffold_151:374049..374438  ( + strand )
three_prime_UTR scaffold_151:374439..375624  ( + strand )

Sequences:

Gene

>Mapoly0151s0042.2
GGAGTGGCGCAGAATTAGGCTTTCTCCTCTCTGTCGCTCCCATGGTTCCTTTGTTTTCTGGAGCGGAGGTGAGGGGGGAGAGGATTGCGAGCGAGAGGGGAGGGAGGGGAGGGGAAGCGAGAGGGAGAGGAGGGGGAGGGAGGGAGGAAGGGGCGAGAGGCGGTAGGTGAAGAGGGGAGGGGGAGAGACGAGATGGGATCATTTCTTGAGGAAATTTATTTTGGGGGAGTAACGGAGGCCCTTCTCCCGAGAGAGTGTCGTGAGAGGAGGAGAAATTAAAAAATGGTGAGGAAATGGAATTGCGAGCATTGTTAAATATTCAAATGATTCTACATTAGGGTCGAATTTCTTTTCAGCTGATCCGGAGATAGTTTAGTCCTTTACTACCCCGTGCTTTGTTTTATTGGCATATAATCAATCTCCTGGACTAAGAGTTATATCCCCTACTTCTCCTCATTCTGTTCCGAAGGTAAGTTCTTCCTTCTACTGCTGATTCTGCTTTTGCATTGTAACGAAGAGAATGCTGCTGTGTATCGAGTCTATTGTATTTCGCGCGTGCTTGAACCCGATCTCATAGCCCACAAGAAAGAGCGTCGTAGATTGTGTCCAGGGCGCGCAATGAATATCGCGGACTCGATTCCGCGGTGGTGTCGCGGAACCCAAGTTCCCATGGGCTGGAGAATGAGAGTGGGCAGGAGATCGAAGGGCTATGCGATGTTGGACGATGAGGATAGGAGGGGTTTAGTTAAACATCGTTGTGCCCAAAGACACTAGTCCAGTCGCAGGCACGCGTTGTGGGGCGCCGGCAATGAGATGGAGTCTAACAATGTGCGCGGTTTGTGCGTCTGTGACATGTTGCAGACTGTCAGTCAGCTGGGTTGTTTGCGCAGGAGGCATCTCAGACGTCTTCGAGGTCATGAATCACTGCTACCATGTTCCTCGAGGGTTTGGAGTGCAGATGGGGCTCTGCGGGCTGATTAGATAGCTGTCGCACTCTCGCGCTCCTTCAAATCCTCTTTCGAACTCCGAGGGCAAGAGGCCAGGAACCGCAGAGCGACGCCGGGGCCCAGAGCCAAAGAAGTCGAGGGAGAAGCCGACGACCGAAGTAGGAATAGTTAGCTGACATCTTCAGCTGAAGAGCAGTGTGTGCGGATCGAAGCGGTTTCAGCCGGCGGGCCGGATCAGTTAGTACATGCATGGAAGGCAGGGATGGAGTCAGTTCAGGAGGAGGCGGGAGCATGCCGGGAAGTTTGGGCCTTCACTTGCAACAAAGACCTGCTGGCTCGGCCGTGACGTCGCCCTCTGGCTTGCACACTCCCGCCCCTCTGCGGCCCGCCCCTGCTGCAACTGCTATCACCCTCGCTAGCCCGAGCCCCAGTCCCGCGACCAACAGCAGCACCTCTCCGTCAGATGGTATTGCAACAACTCCGCACTCTGCAATCATGAGTATGAATATCGGACAAGCAGGCAGTTACACTCCCATCGCTTCGTCAGGAATGGTGGCAGCGAGTTTAGGAGCCCGCCCCGAGCCTCCCAAGAGAAAAAGGGGGAGGCCTAGAAAATATCCTGGCGCAGATGCCAGCCCAGGAGGCAGCCTGGGAGTGTCGCTTGCCTTGACTCCCATCGCTGCCAAATCGCCACAATCTCCTACCGAGAAACGTGGGCGAGGGCGACCGCCCGGTTCAGGAAAGAAACAACAGCTCGCCGCCTTAGGTATTCTTGTGATCCTCGCTCTTCTATCGTGCTCGGGATTCCTCCTGTTCGTGCACATCCTTGTAATTTTCTTGTTTGTATGGCATGTTTCATAGACCTTGGAGGTGTGCTTGCTTTTGTATCAATCTTCGTCCGCATGCGGTAAGCCGCACCAGCTTTTCTAATGAATCTTTTTTTTTCTTTCTTGCAGCTACAGCAAACGGTATTTACTCCAACCCTGATCATCGATAAAGCGATGTGATGACTGTGGTCCTTACCGCATGCGTGTCTCTGGAGGAGGCTACTCCTCTTTAGTCTCTTCGTCCGGTCTTTGTCATACTGCATTTTCGAAAGCGGAGGGGCCTTCTCGTCAAGTAGTTCTTGAGAATCTGAAATTTCTGATATGTCTTGTTGTGTCTGTCTCGCTAGTACCTGTTATTGTCGGGCTCTCTTTCTATATTGTCGGCGCCGTGAATTCTTTTTCTGTTTTGGAGCTAGAATCATTCTCGCAATTTGGTTCCAAACCGTGTGTTCAGGTGCTTGGTTGGCAGGAGCAGCCGGAGGAGGTTTCACTCCGCACGTAATCACTATTGCCGCCGGAGAGGTACAAAATAAAAAGCATGTTATGATAATTGCGTTGGGTTCTTGCGACTTGCTGGAAAGTTTTGGCGAACTAACTTGGTGGCCCTCTCTCGCCTCACAGGACGTTGCCAACAAGGTGTTTGGCTTCTCGCAACAAGGACCGCGTGCAGTATGCGTGTTATCGGCGAATGGTTCAATATCAAATGTTACCTTACGTCATGACTCTTCTTTCGGCGGTAACATCACCTACGAGGCGAGTGCTTTCCTAGTTATGAACAATGCCTGGCTTTCTCTCAGAGAGGGCAGGTCTTTCTCGGTTTATGAACTAATGATTTGTACATTCTAGGAATGTGTAATTCCCGTGGATATGGATACGATGCAGCTGTGATTCTTACCTTTTTGATGCTACATTCTCTCAGGGAGGTTTCTGAATTTTAGACTAGAGAATTTTACGCATGTAGAGAATTTAGGACGATTTTTGGTCTGAGCATCAGCATGATGAGCTTCTCAACCAGAGTAGCCCTTTTTCGGAGCTGCTTTACTGACGAAATAATCACTTTCGCTGGTCAAGCAGGGTCGTTATGAGATTCTTTCCTTGTCAGGTTCGTTTCTACCCACTGACGTCGGAGGCACTCGTAGTCGGACTGGTGGTTTGAGCGTGTCGTTGGCCGCTAACGACGGGAAAGTGGTAGGAGGAAGTGTGTCGGGATTACTGGTCGCGGCTACGCCAGTACAGGTAATTTTTCGACAAATTGTTCGAATTATTGATGTGCCTATCTTTTCTTTGGGTTCTTGAACCACTATCCGAAGTCGTAGTAGCCAGACAAAGCTAGTGTTGTGCATGTGCCACGAACACTTCATTGATCCAATCATAGCTCCTGGACCTACGAGACTGATCTTCTTACGTGATTTTGCTGACACAGTGTGACATATGGTCTAGCATGTCTATATTTTCTAGAACACATAGTTATTAGCCACGTTTACGCCGAACGTAAGAGCTGGCGTGCGAGGAGATGAGTGAACGAGCCGATGTTTGATCTTGCTCTCCATTCTCTCAAACCAGTAGATGAAACTAGAAGGCCTTCATCTGGTTTGGTCTGTTGGTTTGTAATGTAGTTCATTCGTTCTTGTCTCCTCGGCCGTGGATAGGTGTTGTTAACACTTCCATTTTCTGCTGCCGCCAGTTCTTGAAAGGTCCTTTTAAATTATACGTTCTTTGATTGTCGGTAAGAATCCTTTTGTCCATTCTAAGCCGGCGAGCTCATGGCCTTTACTAAAGATCGAAACCGCTTTTTCCGGTGGTATAGTGCCGTCCAGTTTACTTGGAGTCTTGTAATGAGTGTCCTGAGCTTTCGAGTTATCAAGCACTCCTTCCAGTATTGACGATGATGCTACTATCATCCTTACGAGTTGTCCGCTAGAACGAGATCTAGTTTTTGGTCCTTCAGTTTTCTAACTAAAGGTTTATACTCATTCTGTCAATGACTTGTTGTAAATTGTAGATACCCTCCCACAATATAGTAGCCATGGTGTATGTCTCATTCAGTGTTCTCGAGAAATTAAGAGTAGGAAATACATTGTTCCATCTCTATTCGCGTGTATGTGCCACACTTGGAACGCACCTGGCATCTATACGCGACCGCACTATCTGTCACAAATGGGAGCCATTTCTCACCACCAGGGAATGGGATACCTGGTCACGGTTATGCCTCTCGCACTAACGTCTGTGGCGTCAGTACAGATGGAGAAATCCTTTGTAGTGTCGGTCGCAATAGTTGTATAGGTGGAATATAATGTCTTGAATACTTCTTTCTTCTTTCCCGTCTTTATCATTTGGCGATGGATCAGCAAGAGACTCAAGTCATTTTTCTCTTACTGTGATTGAGCCTGCAGATTGTCGTCGGGAGTTTTGTTCCCGACTCTGGAATAAAGCCCACGAGACTTCCGACCTCACCTGCGCCTGCGGGAAACGGGGAATCGAATAGCGCAATGATGACGTCGATCGGGCTGGCACCGGCGATGGGATCCACGGGTGTGACGGTGGCCTCGCCTCCCGCGTCGGCAGCTCGGCTGTCGAAAACCGAACCGCCGTCGGCCGTGAAGGTAGCATCGAGCTCAGCTCCGAGCGCAACGCCGAACCACCAGGGAGGGAGTGCTAGCAGCGCAGCCGGGTCGACGCCCCAGAGCATGGGACTGTTCCAAACCGGAGGCTGGCAACCGACCCAAGTGGGAGCCGAGAGGCGGACTCCGACGGACATCAACATTTCGCTGCCGGGTGGGTAACTGCAAGAGTAAGACCAATTTTGGGACACCATCTATCTTCCGGAACTGTGGACAAGCCGAGTCGGTCCAGCACCAGGACCGAAAGTGTGATCAAGTCTGTGAAGTTGTTCAAGTGGCCACTGAGAGGTGTATAATCTCGCATCAGTCGTACCCCTGCCTGATTGACATTAGGGGGTTTTGCCATGAATTGTTCATCTTGACAGTGGCAACGTTGTGCTCCCGTTGGCAGATTTAGAGAGATTAGCTGCACGGTAATATCTGCTCCTTTTCCTTCGTGTTCTTTTGTTGGGGTTGGGACGACCTCATTCAGCGACCTTGAGAAGGTTCAACAGCTGGGGATTAGATATTTGCTCCTATTTCATCAGGTTCTTTTGTTGGGGGTGGTAGGACAGACGACCTCACCCAGCGACCTTTGTGCAAGGTACAAAAGTTCGGGATTAGAGCGACTTCATATCCCACATACAGTCGGAAGATGGGATGAAGATTCAGGATGTTTTAAATCCTCCCACCATCAAAATATCTACTTGTATTGAGACGAAGTTAGGCTTTGAAATGATGGTAGAACATGTCAGGAGTTCTTGCATGTTTCTTCTGCTGATGTGAGTTCCTAGAGCACTGTGATATGAGCCCTTAGCGGTCGAGACAGTTTCATTGTGACCTCGAGATTATTGTCCTTCTTTCAGCCGGTCACAGTCAAATGCCGCATGATTTTTTCCTCCATATTCACTCATGTGTACATTGTTCTGATAAGTAATTCCCTTCGCCTTTCATGAAAAGTCCCTTTTTTCCTCTGGTCTCCGATTGATATCGGTTCACGGAATATGCTTGTGACACTCTTTGTGCCACAGTTGTGCTTCAACTAGATACTGCTCAAAACCGGTAGCCTTTATTCGGTGAGATCTGACAATTTTCAACTGACTTGTTCTGTAAACAGACTGAAGTCTTTTCCAAATTCTAAGTACAGTAAGTGAACATGCGCAAGAGGCTCTCGTGTGCGAAGCACACTGTTCCATCTGAACGTGGCTGAGCATTTAGCAGGTAGTTAAACAGGATAACGCTTAGATGTCAGTTTTGGGTTTCAGCAGTAAAACACTTCTGAGCCATCAGTAGTTGTGCACTGTGCAACTATTTTATGTGTCAGTACTATTACTTAAACACATCAATTGAGATATCTTTTGCCGAGGAA

mRNA

>Mapoly0151s0042.2
GGAGTGGCGCAGAATTAGGCTTTCTCCTCTCTGTCGCTCCCATGGTTCCTTTGTTTTCTGGAGCGGAGGTGAGGGGGGAGAGGATTGCGAGCGAGAGGGGAGGGAGGGGAGGGGAAGCGAGAGGGAGAGGAGGGGGAGGGAGGGAGGAAGGGGCGAGAGGCGGTAGGTGAAGAGGGGAGGGGGAGAGACGAGATGGGATCATTTCTTGAGGAAATTTATTTTGGGGGAGTAACGGAGGCCCTTCTCCCGAGAGAGTGTCGTGAGAGGAGGAGAAATTAAAAAATGACTGTCAGTCAGCTGGGTTGTTTGCGCAGGAGGCATCTCAGACGTCTTCGAGGTCATGAATCACTGCTACCATGTTCCTCGAGGGTTTGGAGTGCAGATGGGGCTCTGCGGGCTGATTAGATAGCTGTCGCACTCTCGCGCTCCTTCAAATCCTCTTTCGAACTCCGAGGGCAAGAGGCCAGGAACCGCAGAGCGACGCCGGGGCCCAGAGCCAAAGAAGTCGAGGGAGAAGCCGACGACCGAAGTAGGAATAGTTAGCTGACATCTTCAGCTGAAGAGCAGTGTGTGCGGATCGAAGCGGTTTCAGCCGGCGGGCCGGATCAGTTAGTACATGCATGGAAGGCAGGGATGGAGTCAGTTCAGGAGGAGGCGGGAGCATGCCGGGAAGTTTGGGCCTTCACTTGCAACAAAGACCTGCTGGCTCGGCCGTGACGTCGCCCTCTGGCTTGCACACTCCCGCCCCTCTGCGGCCCGCCCCTGCTGCAACTGCTATCACCCTCGCTAGCCCGAGCCCCAGTCCCGCGACCAACAGCAGCACCTCTCCGTCAGATGGTATTGCAACAACTCCGCACTCTGCAATCATGAGTATGAATATCGGACAAGCAGGCAGTTACACTCCCATCGCTTCGTCAGGAATGGTGGCAGCGAGTTTAGGAGCCCGCCCCGAGCCTCCCAAGAGAAAAAGGGGGAGGCCTAGAAAATATCCTGGCGCAGATGCCAGCCCAGGAGGCAGCCTGGGAGTGTCGCTTGCCTTGACTCCCATCGCTGCCAAATCGCCACAATCTCCTACCGAGAAACGTGGGCGAGGGCGACCGCCCGGTTCAGGAAAGAAACAACAGCTCGCCGCCTTAGCTACAGCAAACGGTGCTTGGTTGGCAGGAGCAGCCGGAGGAGGTTTCACTCCGCACGTAATCACTATTGCCGCCGGAGAGGACGTTGCCAACAAGGTGTTTGGCTTCTCGCAACAAGGACCGCGTGCAGTATGCGTGTTATCGGCGAATGGTTCAATATCAAATGTTACCTTACGTCATGACTCTTCTTTCGGCGGTAACATCACCTACGAGGGTCGTTATGAGATTCTTTCCTTGTCAGGTTCGTTTCTACCCACTGACGTCGGAGGCACTCGTAGTCGGACTGGTGGTTTGAGCGTGTCGTTGGCCGCTAACGACGGGAAAGTGGTAGGAGGAAGTGTGTCGGGATTACTGGTCGCGGCTACGCCAGTACAGATTGTCGTCGGGAGTTTTGTTCCCGACTCTGGAATAAAGCCCACGAGACTTCCGACCTCACCTGCGCCTGCGGGAAACGGGGAATCGAATAGCGCAATGATGACGTCGATCGGGCTGGCACCGGCGATGGGATCCACGGGTGTGACGGTGGCCTCGCCTCCCGCGTCGGCAGCTCGGCTGTCGAAAACCGAACCGCCGTCGGCCGTGAAGGTAGCATCGAGCTCAGCTCCGAGCGCAACGCCGAACCACCAGGGAGGGAGTGCTAGCAGCGCAGCCGGGTCGACGCCCCAGAGCATGGGACTGTTCCAAACCGGAGGCTGGCAACCGACCCAAGTGGGAGCCGAGAGGCGGACTCCGACGGACATCAACATTTCGCTGCCGGGTGGGTAACTGCAAGAGTAAGACCAATTTTGGGACACCATCTATCTTCCGGAACTGTGGACAAGCCGAGTCGGTCCAGCACCAGGACCGAAAGTGTGATCAAGTCTGTGAAGTTGTTCAAGTGGCCACTGAGAGGTGTATAATCTCGCATCAGTCGTACCCCTGCCTGATTGACATTAGGGGGTTTTGCCATGAATTGTTCATCTTGACAGTGGCAACGTTGTGCTCCCGTTGGCAGATTTAGAGAGATTAGCTGCACGGTAATATCTGCTCCTTTTCCTTCGTGTTCTTTTGTTGGGGTTGGGACGACCTCATTCAGCGACCTTGAGAAGGTTCAACAGCTGGGGATTAGATATTTGCTCCTATTTCATCAGGTTCTTTTGTTGGGGGTGGTAGGACAGACGACCTCACCCAGCGACCTTTGTGCAAGGTACAAAAGTTCGGGATTAGAGCGACTTCATATCCCACATACAGTCGGAAGATGGGATGAAGATTCAGGATGTTTTAAATCCTCCCACCATCAAAATATCTACTTGTATTGAGACGAAGTTAGGCTTTGAAATGATGGTAGAACATGTCAGGAGTTCTTGCATGTTTCTTCTGCTGATGTGAGTTCCTAGAGCACTGTGATATGAGCCCTTAGCGGTCGAGACAGTTTCATTGTGACCTCGAGATTATTGTCCTTCTTTCAGCCGGTCACAGTCAAATGCCGCATGATTTTTTCCTCCATATTCACTCATGTGTACATTGTTCTGATAAGTAATTCCCTTCGCCTTTCATGAAAAGTCCCTTTTTTCCTCTGGTCTCCGATTGATATCGGTTCACGGAATATGCTTGTGACACTCTTTGTGCCACAGTTGTGCTTCAACTAGATACTGCTCAAAACCGGTAGCCTTTATTCGGTGAGATCTGACAATTTTCAACTGACTTGTTCTGTAAACAGACTGAAGTCTTTTCCAAATTCTAAGTACAGTAAGTGAACATGCGCAAGAGGCTCTCGTGTGCGAAGCACACTGTTCCATCTGAACGTGGCTGAGCATTTAGCAGGTAGTTAAACAGGATAACGCTTAGATGTCAGTTTTGGGTTTCAGCAGTAAAACACTTCTGAGCCATCAGTAGTTGTGCACTGTGCAACTATTTTATGTGTCAGTACTATTACTTAAACACATCAATTGAGATATCTTTTGCCGAGGAA

CDS

>Mapoly0151s0042.2
ATGGAAGGCAGGGATGGAGTCAGTTCAGGAGGAGGCGGGAGCATGCCGGGAAGTTTGGGCCTTCACTTGCAACAAAGACCTGCTGGCTCGGCCGTGACGTCGCCCTCTGGCTTGCACACTCCCGCCCCTCTGCGGCCCGCCCCTGCTGCAACTGCTATCACCCTCGCTAGCCCGAGCCCCAGTCCCGCGACCAACAGCAGCACCTCTCCGTCAGATGGTATTGCAACAACTCCGCACTCTGCAATCATGAGTATGAATATCGGACAAGCAGGCAGTTACACTCCCATCGCTTCGTCAGGAATGGTGGCAGCGAGTTTAGGAGCCCGCCCCGAGCCTCCCAAGAGAAAAAGGGGGAGGCCTAGAAAATATCCTGGCGCAGATGCCAGCCCAGGAGGCAGCCTGGGAGTGTCGCTTGCCTTGACTCCCATCGCTGCCAAATCGCCACAATCTCCTACCGAGAAACGTGGGCGAGGGCGACCGCCCGGTTCAGGAAAGAAACAACAGCTCGCCGCCTTAGCTACAGCAAACGGTGCTTGGTTGGCAGGAGCAGCCGGAGGAGGTTTCACTCCGCACGTAATCACTATTGCCGCCGGAGAGGACGTTGCCAACAAGGTGTTTGGCTTCTCGCAACAAGGACCGCGTGCAGTATGCGTGTTATCGGCGAATGGTTCAATATCAAATGTTACCTTACGTCATGACTCTTCTTTCGGCGGTAACATCACCTACGAGGGTCGTTATGAGATTCTTTCCTTGTCAGGTTCGTTTCTACCCACTGACGTCGGAGGCACTCGTAGTCGGACTGGTGGTTTGAGCGTGTCGTTGGCCGCTAACGACGGGAAAGTGGTAGGAGGAAGTGTGTCGGGATTACTGGTCGCGGCTACGCCAGTACAGATTGTCGTCGGGAGTTTTGTTCCCGACTCTGGAATAAAGCCCACGAGACTTCCGACCTCACCTGCGCCTGCGGGAAACGGGGAATCGAATAGCGCAATGATGACGTCGATCGGGCTGGCACCGGCGATGGGATCCACGGGTGTGACGGTGGCCTCGCCTCCCGCGTCGGCAGCTCGGCTGTCGAAAACCGAACCGCCGTCGGCCGTGAAGGTAGCATCGAGCTCAGCTCCGAGCGCAACGCCGAACCACCAGGGAGGGAGTGCTAGCAGCGCAGCCGGGTCGACGCCCCAGAGCATGGGACTGTTCCAAACCGGAGGCTGGCAACCGACCCAAGTGGGAGCCGAGAGGCGGACTCCGACGGACATCAACATTTCGCTGCCGGGTGGGTAA

Protein

>Mapoly0151s0042.2
MEGRDGVSSGGGGSMPGSLGLHLQQRPAGSAVTSPSGLHTPAPLRPAPAATAITLASPSPSPATNSSTSPSDGIATTPHSAIMSMNIGQAGSYTPIASSGMVAASLGARPEPPKRKRGRPRKYPGADASPGGSLGVSLALTPIAAKSPQSPTEKRGRGRPPGSGKKQQLAALATANGAWLAGAAGGGFTPHVITIAAGEDVANKVFGFSQQGPRAVCVLSANGSISNVTLRHDSSFGGNITYEGRYEILSLSGSFLPTDVGGTRSRTGGLSVSLAANDGKVVGGSVSGLLVAATPVQIVVGSFVPDSGIKPTRLPTSPAPAGNGESNSAMMTSIGLAPAMGSTGVTVASPPASAARLSKTEPPSAVKVASSSAPSATPNHQGGSASSAAGSTPQSMGLFQTGGWQPTQVGAERRTPTDINISLPGG

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>