Mapoly0153s0039



Description

Protein of unknown function DUF260

Reference DB

Database ID Description
OrthoMCL OG5_147276
PFAM PF03195 Protein of unknown function DUF260
PANTHER PTHR31301 FAMILY NOT NAMED
PANTHER PTHR31301:SF1

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpASLBD15 transcription factor, ASL/LBD Mapoly0153s0039.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0153s0039.1 scaffold_153:329146..330532  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0153s0039.1  

Gene structure:

mRNA scaffold_153:329146..330532  ( - strand )
three_prime_UTR scaffold_153:329146..329438  ( - strand )
CDS scaffold_153:329439..329833  ( - strand )
CDS scaffold_153:330311..330335  ( - strand )
five_prime_UTR scaffold_153:330336..330532  ( - strand )

Sequences:

Gene

>Mapoly0153s0039.1
AGCTACTGATATGGCAAAATATAATTCATTCTCTGTTGGTTCATGGTACATTGCCTTTTCGTACTTTAGTTCTTTGAAGTTTCAGGTCACTGCAGTATAAATAATCTTCTCGACACTCTGGAAACCTTTGTTTGGATATTGATCATTCGGAGAGGAAGTAGAGAGGAGTGAAGTGAACTCGCCCAGGTCTGCAATCAATGAATCGATTGGAACCAAACCAAGGTACAAGCTTCGATAAGGGTACATGTTGATTCAGTCTTTCTGTGCTGTACTTTGAATATCGTTCACCTCGTTCTTCCTTCTTGTAGAGCTTGCTTCTCCCCGCGCCTGCCAGTAATCATCAGTTTTGCTTCAATCTATTCTGATTCTCCTGATGCATTCTTCTGTCTGTAAAGGTACTGTCCAATCATTGCACAGTTCCTTACAGACTTGTTTTGTAGCATTCGCCCCATCAACATGCATCTTCAATTGAGCATAACTTCTGATTTCTTTTGCAGTTTAATTCAGATCGAGCATGCACCATAGCATTCGAGTTATCATTCATTCATTCCAGTTCTTATTCCATTCTTCTCTGTACCTACGTTATGAGATATCATTGATCTCAGCTGTACTACTAACGTCTGTTGATCAACATTTCTGTGTTGTCCAGATTTACTCTGAATGTATTCTTATTTCCTCTTCTTCGTGTTTGTTTTCCAGTTATGGGCTCCAACCATGATGATGTGCGAGCTGAGAAGAACATCGAAACTTTTGCACTTGGTCGATGTGCTCGGTGCAAATATTTCGATAAAATGTGTGACGAATTTTGTGTATTCGCCCAGATCTTCCCTGAGGCAAAAAGACAAAGCTTTCTACTCGTGAATGATGTATATGGTGAGGAGCAAGTGGAAAACATCTTACACGATGTTGAGCCAAGGTTACGTGAAACTGCTGCTGCGACTTTGGTTCTCGAGGCAGAAGCACGAAAGAAAGACCCGGTACATGGAATTACAGGAATTATTGAGGAACTCAATCGTCAAATTGATACCCTCAAGAAAGATCTTACAAAAGCACAATACACTCTTTTATTTGGGAAACCAAATGCTGCTCTTTAGTGAAACTAGAAGGAAATTATATATTATATACATTATTTTCTGCACCAGTACCGATCACTATAGGCTCGACAGTACTTCCAAATTACCATCCAAGCGAAGGTCAATGTGTATAGTTAACATGGCCCGTCGCTGAAGGAAGTTAATACTAATCATACTATCTCAAAACGAATTGTTGTGAATCGCGAACCATTGAATCGAACCTATTTCGCGTTATGGCCTTCTGAACGCCCTTGGGTATGAAAGCTTGGATCATCCACTCCTTTCACCCCATCATTATTGATTTTTCTCAGAGC

mRNA

>Mapoly0153s0039.1
AGCTACTGATATGGCAAAATATAATTCATTCTCTGTTGGTTCATGGTACATTGCCTTTTCGTACTTTAGTTCTTTGAAGTTTCAGGTCACTGCAGTATAAATAATCTTCTCGACACTCTGGAAACCTTTGTTTGGATATTGATCATTCGGAGAGGAAGTAGAGAGGAGTGAAGTGAACTCGCCCAGGTCTGCAATCAATGAATCGATTGGAACCAAACCAAGTTATGGGCTCCAACCATGATGATGTGCGAGCTGAGAAGAACATCGAAACTTTTGCACTTGGTCGATGTGCTCGGTGCAAATATTTCGATAAAATGTGTGACGAATTTTGTGTATTCGCCCAGATCTTCCCTGAGGCAAAAAGACAAAGCTTTCTACTCGTGAATGATGTATATGGTGAGGAGCAAGTGGAAAACATCTTACACGATGTTGAGCCAAGGTTACGTGAAACTGCTGCTGCGACTTTGGTTCTCGAGGCAGAAGCACGAAAGAAAGACCCGGTACATGGAATTACAGGAATTATTGAGGAACTCAATCGTCAAATTGATACCCTCAAGAAAGATCTTACAAAAGCACAATACACTCTTTTATTTGGGAAACCAAATGCTGCTCTTTAGTGAAACTAGAAGGAAATTATATATTATATACATTATTTTCTGCACCAGTACCGATCACTATAGGCTCGACAGTACTTCCAAATTACCATCCAAGCGAAGGTCAATGTGTATAGTTAACATGGCCCGTCGCTGAAGGAAGTTAATACTAATCATACTATCTCAAAACGAATTGTTGTGAATCGCGAACCATTGAATCGAACCTATTTCGCGTTATGGCCTTCTGAACGCCCTTGGGTATGAAAGCTTGGATCATCCACTCCTTTCACCCCATCATTATTGATTTTTCTCAGAGC

CDS

>Mapoly0153s0039.1
ATGAATCGATTGGAACCAAACCAAGTTATGGGCTCCAACCATGATGATGTGCGAGCTGAGAAGAACATCGAAACTTTTGCACTTGGTCGATGTGCTCGGTGCAAATATTTCGATAAAATGTGTGACGAATTTTGTGTATTCGCCCAGATCTTCCCTGAGGCAAAAAGACAAAGCTTTCTACTCGTGAATGATGTATATGGTGAGGAGCAAGTGGAAAACATCTTACACGATGTTGAGCCAAGGTTACGTGAAACTGCTGCTGCGACTTTGGTTCTCGAGGCAGAAGCACGAAAGAAAGACCCGGTACATGGAATTACAGGAATTATTGAGGAACTCAATCGTCAAATTGATACCCTCAAGAAAGATCTTACAAAAGCACAATACACTCTTTTATTTGGGAAACCAAATGCTGCTCTTTAG

Protein

>Mapoly0153s0039.1
MNRLEPNQVMGSNHDDVRAEKNIETFALGRCARCKYFDKMCDEFCVFAQIFPEAKRQSFLLVNDVYGEEQVENILHDVEPRLRETAAATLVLEAEARKKDPVHGITGIIEELNRQIDTLKKDLTKAQYTLLFGKPNAAL

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>