Mapoly0166s0022



Description

MYB-LIKE DNA-BINDING PROTEIN MYB

Reference DB

Database ID Description
GO GO:0003682 Chromatin binding
OrthoMCL OG5_127030
PFAM PF00249 Myb-like DNA-binding domain
PANTHER PTHR10641 MYB-LIKE DNA-BINDING PROTEIN MYB
PANTHER PTHR10641:SF221

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
Mp3R-MYB6 transcription factor, MYB Mapoly0166s0022.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0166s0022.1 scaffold_166:259559..264384  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0166s0022.1  

Gene structure:

mRNA scaffold_166:259559..264384  ( + strand )
five_prime_UTR scaffold_166:259559..259823  ( + strand )
five_prime_UTR scaffold_166:261593..261638  ( + strand )
five_prime_UTR scaffold_166:262059..262061  ( + strand )
CDS scaffold_166:262062..262240  ( + strand )
CDS scaffold_166:262354..262447  ( + strand )
CDS scaffold_166:262780..262837  ( + strand )
CDS scaffold_166:262954..263048  ( + strand )
CDS scaffold_166:263166..263269  ( + strand )
CDS scaffold_166:263719..263847  ( + strand )
CDS scaffold_166:263952..264204  ( + strand )
three_prime_UTR scaffold_166:264205..264384  ( + strand )

Sequences:

Gene

>Mapoly0166s0022.1
ATCCGCGCCACGCTGCAGCGCAACACTCGTGTGCAGCGGGAGGCGGACGATGATTATTTCAAGCAACAGATGAGTATCGAATCCCATTATGCTCTCGCTGTTCAAGCTCTTTGCACGAAGCTCTCTCGTCGAGAATACTCATCACAATCTTCTTGATTAATCCAATCCACGTACATAACAATAGAGGACAATAGATCTTGACCTGACACAGTCTTCACATATTGTTGCCATTTTACTTGTGCTTCATATTATCGACTGAACTGCTGTAAGTGTCACAGACAATAAGTTAGAACTCACACAGACAGGTTTGCTCACATTTTACATACAAAGTCTGAATCTTCCGTCAACATTTGGATGTGAAGTAATGAAACATTGACTAATTTCTATAACTTTCTGAAATTATTTTGATGGAGGTTGGAATCATACACCATTCAACTTGAAATGCATCAGTTGCGAGTTTCAACACGTTATACAACCAATTGTAGAATTTTTTAATGTTGGCGTTAACGAATTATTAGCCAGAGTTGCAGATTATATCAACCTTCAGTACACTGAGTGAATTATTAACTGATTATATTTTCTCAGGCTCACTTTCATCTTCTGTCCACGCTGACCTTTTGAATGTTTTTTTCTCAACTCTTCTACACATTTCTCTCAAGAGCTACTGTGCTAAACTCTTTTGGTTTATGTATATTTCACTACTTCTATGTGAGGCTTTATAAAATCAAATTTTAGTTGACTAAAGTAAGAACTCTTCTGATAGAGATGACAAATCTAAAGAACTTTCCTACTGTAGTCATGTTTAATGCTTTGTAGATATCGAAATGAAAATTGAAGGCTTGTAAATAGATTACTATTTTGACGCAGATCTTTCCTTGTTCATCAATTATACAAAGAATGTGAATACATCGAAGTAAAATTTGAGAAATTAAATGTATTTTAGTTTATCTTCCACTTCAATATATATGTTTTTTACATATGCTCTTCTATATGATAATGGTGTTTGAATGTAAACGATTTAATGCAGTTTACAGAATCTTCACTTTTCAAAACATTGCATTAAGGAGTTTACTGATAAAATGTAATCTTTGTCTTATGTAGCATTCAGATGGTGAAATTTAATGAAAAAGTTTTTGATCTAAATCAATGTTTATACAAATGAATCGATTTTTTTAAAATCGATTCATTTATATAAAAAAAATCAATGTTGAATTTTGACTTTGATTTAATATGATTGATTCTTGCATATGATATATGATCAATACATATGTTAATGTACATTTGACTGCTCTTTGAACTTATTATTTCTCAGAGATATATATATATTTATATACATATATATAATTTTTTACATATAGATTCTTACTCGATGCAATGACTTATCAATTGTAAATTAAAATGAAGTCAAAAAATCGTTGATTTCTAAGTAACAATTTTCTTGAAAATAGAAATATCAATCATTAATTAATGATTGATAATAATGTTGAAGTTTTATCTTTTGAAAGTTTTAACTCAACTAGATTTTTTTCGCAAAGAGATACTTAATGATTGTAAATATTTTACTATGCATTTCCAATTTACTGTAGTGCTCAAGTGAATCTCTAAGAATTTAAAATGTTTTACATAGTTAAAAAATGTCATGAGTATGTACAAAAGTAATCTTTGTACTAGAAATTCTAATTCAAACTCTGTGATTTTATTAAAATTAAATTTTACTAAATGAAGCTTGTAATACTATCTAATTTGTACGGTTGATTCTCATATAATATTTCATTTTTTGCCAATTCTTGTGATAATTTTTGAATCCATTACATGGATTCAAGCTTGGCTCAAAGCACACCACTTTGAGCGAAGTCCAAAGTGAAGTTTAGACTTGTATCTTATGGAATTTTCATTTAAGTAAAGTTCTTGGCATTCAAATTTTTAATTTTTTTAACACAAACCAATATCTTTCATTTCAGATTATGGTTAATTCAATAAATAAAGTTTCTATCAACAAAATTTCTATCTACCACTGATTATGTTGATTTGTAGGTTCATCCGTTTACTTTCTATCTCAACGCATTCAAAATCAGCACAGGTGAGTGTTGCAAAATATCTCAATGGCAACTGGTGTGTGATAGTACACAATATAAAAGCTAGAAGTGAATCTTCATCTCTTACTTCCGTTTGTAAACTATTTCATTTTTTTTTTATCTTTACTGTTATACACAGTGAGTATACACATCATTCTATGAATAGATTAAAAAAATTATATTTGTTAGTTATTTGATTTATCCGTAAATGTTGTATCAAACCAATCACATGTGAGAAAAATTTCGATCCATAGCAGCTGGAGGTGTGTCTGCATTGTCATTCTTCTCTTCTTCTTCTTACGTGATTTATTTATTCACTGATGGTTGTTAAGAAACCTTTATTACCAACTGTCTAGAAAAGAAAAAGGTTGTGACTGTGAAAAAAATAAAAATGTGCGTATTAAAATTTTAACTGTGTTTCGAAGACCATGGAGGGCTCGTCATCTCCAGCGGTTTCAAAACTACCAACCAGGCGACGTCCAGAAGATACAGGCAATTCCAGCGTGGCCTATCTGGCTTCTGAGCCAGAAATTAACCTTCCTGAAGATACAGACAATTCCAGCGTGGCCTATCTGGCATCTGAGCCAGAAATTAACCACAAAAAAGCGTGAGCAAATAATCTTTTGTTCTCAGTAACACTGATGTTTTGCACTTAATAGTTTACATCGGTCTATCATGGCAAAGTCAAGGAATCTGAAAATATTCTTGTTATGATTGCAGCGGCCATGAACGCATAAACAGAAAGAGGCATGTATTGTCTCATGTGACTCTTCATCCACCAAAGAAACAATTTATAAGGTGGACGCAGGAGGAGGTTAGTAAGTTTTTATTCAAAAACCCCATTCTGAGTGTCCTGTCACGGATGACTTTATCTAATCATAAGTGACATTCTCTTATGGTCTCACATTATATCTTTGATATGAGTATCGTCATAAGGCTTAATTATAGATCTTTTGCCTGTTTGACTTATCCGGCTCCATCTAAGCTATTCCTACCTGGACTGGGTCTTCTGAAGGCTCATTTCAATATAGGAAGCACGGATTGGACATACTTTAATACTTACTGGCATTCCAAAATGACCATTCGAAGTTTTGTTCTGAACAAAATATTTCAAGCCAAGTCAAATTTTCTGCTTCATAGTTGCAGGATGAAACTTTAAGCGCGGAAGTCGCCCGGCATGGTGGGCGAAACTGGAGGCAAATTGGTGAGTGGAAGAGGTGTATTTATGTTCTATCTGTTTTTTGTGTAAGTGTCTAAGGCTGGACCGTCACGGTCGATTAGAAAGTCTCACTAAATGTGTAAAACTGTTTGTATATGCAGCTACAGCTTTACCAAACCGGTCAGAGGTTCAGTGCCTTCATCGTTGGACGAAAGTAATCCATCCAGGTCTTGTGAAAGGATACTGGACCAAAGAAGTTAGTATACGAAGCCAAGCGCTCGTGGTTTCAACTTGCATGCAAATTAGACTGGAGACACATATGAAACCATATAATGGCAAAATTGGGTATTGATTACAATGGCTGTATCGGCAGGAAGATGATCGCATGATTGAATTGGTAGCGATACTCGGGAATAAGCGATGGGCTGCCGTCGCTCGCTCATTACCGGGCAGAAATGGAAAACAATGTCGCGAACGGTGCGTTTCAGTATCTGAATAACACTTTTTCTTGATGCTTAGTGTAATTCAAGTTACAAAGTCATGGGTGCTTCGAGATGCACTTCTCAGAATAGATGCATGCAACTTGTGCAAGATATGTTCTATGTGCAGAGAGGTGCTTATCGATTTTCCAAGTGATATATTTTAAGCGGTTGTAGTCCAAGCTTACAGTGTTGGAAAATGTAGCTGAACAGTGATGTTTGTTTTGAGGTCTACATCAGCGATTATATGCCTGTATGTTTCTCATTAGATTCTTCTATTTCGATATATGAGAATATTTCGAAACTTCATATAGTTATAAATTGACATCTGGACATTTTGCAATGAAATTCTGAGAAATTCCGATAAGTTATGAAGATTATGAGCTCCTGGACATATATATCATATAATATATAATCAGCTCCTGCACATACTTTATTGCTTGACAGATGGTGCAATCACCTAGATCCCCAGCTAAAAAAAACGCCTTGGACTGGGGCCGAAGATTTGATGCTCTTCTTGGCTCACCAGAGAGTTGGAAATAGGTGGGCTCAAATAGCTAAGCTTCTTCCTGGAAGGTAAGAGAACTTATATCTGCAGTAATCTCAAATATTGTTAGAAGACTGATAAGAAGACTCTCCTTTCCAATTTCCTGATTACACATAATCTACACAAAATACAGGTCGGATAATGGAGTAAAGAACAGGTGGAATACGGCAGTGAGGAAGAAGGAACAACAATTGGAAGAATTCTGTGCGGAATGGGACAGACAGAACGAATCTGGGGAACATCAGTTACTGACTAGAGGCACAGTAATCGGGGACCTCGAGGCATCTGCAAGCTTTTTTCCACCAGAGGCCATTTTTCAAGTTGAGGACTCCAAAGCGGCCCAGGACGATGAAAGCCTGATTTACTTGAATCTAGAGGATTTCTAAGGTTTGAAGTTCATCACGGTATCAATAAGTAGCAAGTCCTGCACTTACAGTTCATGATTAGTTCTTATCTTGATCAGAAACTTGAGTTCTGACGATAATTTAAGGTTTTATCATAGCTTTTAAGAGCTATTTGAGACTATGTGGATGGTTATTCTTTCGTTCGAATATATTTTTTGTAAC

mRNA

>Mapoly0166s0022.1
ATCCGCGCCACGCTGCAGCGCAACACTCGTGTGCAGCGGGAGGCGGACGATGATTATTTCAAGCAACAGATGAGTATCGAATCCCATTATGCTCTCGCTGTTCAAGCTCTTTGCACGAAGCTCTCTCGTCGAGAATACTCATCACAATCTTCTTGATTAATCCAATCCACGTACATAACAATAGAGGACAATAGATCTTGACCTGACACAGTCTTCACATATTGTTGCCATTTTACTTGTGCTTCATATTATCGACTGAACTGCTGTTCATCCGTTTACTTTCTATCTCAACGCATTCAAAATCAGCACAGACCATGGAGGGCTCGTCATCTCCAGCGGTTTCAAAACTACCAACCAGGCGACGTCCAGAAGATACAGGCAATTCCAGCGTGGCCTATCTGGCTTCTGAGCCAGAAATTAACCTTCCTGAAGATACAGACAATTCCAGCGTGGCCTATCTGGCATCTGAGCCAGAAATTAACCACAAAAAAGCCGGCCATGAACGCATAAACAGAAAGAGGCATGTATTGTCTCATGTGACTCTTCATCCACCAAAGAAACAATTTATAAGGTGGACGCAGGAGGAGGATGAAACTTTAAGCGCGGAAGTCGCCCGGCATGGTGGGCGAAACTGGAGGCAAATTGCTACAGCTTTACCAAACCGGTCAGAGGTTCAGTGCCTTCATCGTTGGACGAAAGTAATCCATCCAGGTCTTGTGAAAGGATACTGGACCAAAGAAGAAGATGATCGCATGATTGAATTGGTAGCGATACTCGGGAATAAGCGATGGGCTGCCGTCGCTCGCTCATTACCGGGCAGAAATGGAAAACAATGTCGCGAACGATGGTGCAATCACCTAGATCCCCAGCTAAAAAAAACGCCTTGGACTGGGGCCGAAGATTTGATGCTCTTCTTGGCTCACCAGAGAGTTGGAAATAGGTGGGCTCAAATAGCTAAGCTTCTTCCTGGAAGGTCGGATAATGGAGTAAAGAACAGGTGGAATACGGCAGTGAGGAAGAAGGAACAACAATTGGAAGAATTCTGTGCGGAATGGGACAGACAGAACGAATCTGGGGAACATCAGTTACTGACTAGAGGCACAGTAATCGGGGACCTCGAGGCATCTGCAAGCTTTTTTCCACCAGAGGCCATTTTTCAAGTTGAGGACTCCAAAGCGGCCCAGGACGATGAAAGCCTGATTTACTTGAATCTAGAGGATTTCTAAGGTTTGAAGTTCATCACGGTATCAATAAGTAGCAAGTCCTGCACTTACAGTTCATGATTAGTTCTTATCTTGATCAGAAACTTGAGTTCTGACGATAATTTAAGGTTTTATCATAGCTTTTAAGAGCTATTTGAGACTATGTGGATGGTTATTCTTTCGTTCGAATATATTTTTTGTAAC

CDS

>Mapoly0166s0022.1
ATGGAGGGCTCGTCATCTCCAGCGGTTTCAAAACTACCAACCAGGCGACGTCCAGAAGATACAGGCAATTCCAGCGTGGCCTATCTGGCTTCTGAGCCAGAAATTAACCTTCCTGAAGATACAGACAATTCCAGCGTGGCCTATCTGGCATCTGAGCCAGAAATTAACCACAAAAAAGCCGGCCATGAACGCATAAACAGAAAGAGGCATGTATTGTCTCATGTGACTCTTCATCCACCAAAGAAACAATTTATAAGGTGGACGCAGGAGGAGGATGAAACTTTAAGCGCGGAAGTCGCCCGGCATGGTGGGCGAAACTGGAGGCAAATTGCTACAGCTTTACCAAACCGGTCAGAGGTTCAGTGCCTTCATCGTTGGACGAAAGTAATCCATCCAGGTCTTGTGAAAGGATACTGGACCAAAGAAGAAGATGATCGCATGATTGAATTGGTAGCGATACTCGGGAATAAGCGATGGGCTGCCGTCGCTCGCTCATTACCGGGCAGAAATGGAAAACAATGTCGCGAACGATGGTGCAATCACCTAGATCCCCAGCTAAAAAAAACGCCTTGGACTGGGGCCGAAGATTTGATGCTCTTCTTGGCTCACCAGAGAGTTGGAAATAGGTGGGCTCAAATAGCTAAGCTTCTTCCTGGAAGGTCGGATAATGGAGTAAAGAACAGGTGGAATACGGCAGTGAGGAAGAAGGAACAACAATTGGAAGAATTCTGTGCGGAATGGGACAGACAGAACGAATCTGGGGAACATCAGTTACTGACTAGAGGCACAGTAATCGGGGACCTCGAGGCATCTGCAAGCTTTTTTCCACCAGAGGCCATTTTTCAAGTTGAGGACTCCAAAGCGGCCCAGGACGATGAAAGCCTGATTTACTTGAATCTAGAGGATTTCTAA

Protein

>Mapoly0166s0022.1
MEGSSSPAVSKLPTRRRPEDTGNSSVAYLASEPEINLPEDTDNSSVAYLASEPEINHKKAGHERINRKRHVLSHVTLHPPKKQFIRWTQEEDETLSAEVARHGGRNWRQIATALPNRSEVQCLHRWTKVIHPGLVKGYWTKEEDDRMIELVAILGNKRWAAVARSLPGRNGKQCRERWCNHLDPQLKKTPWTGAEDLMLFLAHQRVGNRWAQIAKLLPGRSDNGVKNRWNTAVRKKEQQLEEFCAEWDRQNESGEHQLLTRGTVIGDLEASASFFPPEAIFQVEDSKAAQDDESLIYLNLEDF

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>