Mapoly0168s0007



Description

HISTONE-LIKE TRANSCRIPTION FACTOR CCAAT-RELATED // SUBFAMILY NOT NAMED

Reference DB

Database ID Description
GO GO:0005622 Intracellular
GO GO:0043565 Sequence-specific DNA binding
OrthoMCL OG5_132682
PFAM PF00808 Histone-like transcription factor (CBF/NF-Y) and archaeal histone
PANTHER PTHR10252 HISTONE-LIKE TRANSCRIPTION FACTOR CCAAT-RELATED
PANTHER PTHR10252:SF25 SUBFAMILY NOT NAMED

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpCCAAT-NFYC3 transcription factor, CCAAT-NFYC Mapoly0168s0007.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0168s0007.1 scaffold_168:87006..90248  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0168s0007.1  

Gene structure:

mRNA scaffold_168:87006..90248  ( - strand )
three_prime_UTR scaffold_168:87006..87490  ( - strand )
CDS scaffold_168:87491..87555  ( - strand )
CDS scaffold_168:87768..87809  ( - strand )
CDS scaffold_168:88157..88241  ( - strand )
CDS scaffold_168:89617..89892  ( - strand )
five_prime_UTR scaffold_168:89893..90248  ( - strand )

Sequences:

Gene

>Mapoly0168s0007.1
CTATTTCAACATTTTCAATTTTTTTGCAAGCTGGTCGTATCAAGAATGCAGATCAAGATCTGTGAGTTCACACACTGGTCTTCTCAAAATTTCAGGTTTTGACCGTGGAAACTCTGAAGGCTACAAAGGAAAAGGGAGAAGAAGTGCAGAACGCTGAAATTAGTTTCGTGTACGTGTAGTCAGACTCGGCGCTGCTCCCGTCACGAAGTGGGATTTGCCCAGAGGATTCGGATTGCAGGCCTTTTCAAATTTGTGCGTCATGAATTGAGGAGCTCAGAACTGAATCTGGGGATACTCATTTTGAGCTACCTACATAGTTTTGGTTGCATCACAAGGATTCCAGAAGGTCAGTTGATATGAGCAGCAGCGATGAGTCCGATTCTGGGAGAAGATCATCGGATGCAGAAGAGGATGAGAAAATGGACGAGGAGAAAGAAGAAGTTGATTCTCAATCACAAGATGACTCCCCATCTCCGTCCCCTGTTCGGTCCCAGACGCACTCGGCTCGGTCCAAGTCTGCCTCCCTCAACGCCTTGGCTTTCCCCATTTCTAGAGTGAGGCGGTTGGTGAAGAGCGAGGGGGATATGCAGTGGGTCGGCGTTGAGGCCGGTTTTCTCATTGCGAAAGCAGCGGTAAGATTAAGATCGTTGATTCTGAATTTTTTTAGTTGGCTTTTGTTTTCCATTCCTGATCCTCTGAGAAAATTGCTGGCCATTCAAGTTCATTCAGACCTGGACTTGATATCAACAGCCTGCTGAACTGCCTGACATTTGAAAGCTTTCACGTAGTTATTATGAACGAAGAATTAAAGCAAAATACTTCTTATCGTGCAATATATGAATCGCAATTCAGAGATCACACTCGGTATCTGTATTCGTTGCTGTCGAGTGTATAGAACACGTCAAGACGTAAATGATTTAGCTCATAAGTTAGAGCAGCCGCTGAAATTGCCGAGCTCTGGAGAGAATGCAGTTTCTTGAAAGTCTTAGCCAGATTCGTTTCAGCCGCTGGAAATATTGGCCGTCATGGAAGCTTTGCCTTTCTGGAAGAGGAGAAATTTCATCCCATTCAACCTATTTGCGCAATTAGGAAATTGAGGGGTATCCTGCTGTTTTAGTGCTCTTTTTGCTTAATTTTGAGTTGGGAAGCAAGGCTCAACCGGGCATGGACGTCATGTGCTCTTTGAAATCATATACTTACGACAATTTCAATGCTGATGTTTATCTGAATGGAAATTCCTGGACCGGAGTTTTTCCCAGAATGAACAGTCAGGTCCAATGAAATTCCTTCACCTTCTTTGACTTGCCGCCCAAAAGAGCCGTGCGAATAGACTGAGAAAGCTCTGTCAGTACACTGAGCGTGGAATGATAAGACTCTGGTCACGGGAAATTAATTGGGTAATTTGTTTATTTTTCATCCACTCTACTTGATCTTACAGGTTTTAATGTATTCTGGATATAGGTTTTTGTTTTAAATTAAACATAGATGGATACAGTTAATAAAAAATCACTTCTATTTCTTTGGACTCTGAACCAACCTCAGGAGACGAAGCAGAAATTCATATGCGGGGACTGATCAAAACAGTGCTAATGTGCACATGAACCTGGCAAATTTGTATGATTTCGTATGACATCATTCAATTTTCTTCTTGGTAGCCTTTATATGTTCAATGCTCTCTCTTTAGTGAGGGTCTGATGGATGGGGTCATCGTGACTATTCTGTCACTTAGAAAGGTGCACTGGAATTGCTTACGGTCATGTTGTAGCAGACTGCGTGCAATTCATGAATGCTATCCATCAGGGCATCAATTTTTTTTGCTGCCTAGAAGTAGCTGTTACCCTTGAATCTTTGAGTCCTCCAAGGTTTCAGTCATGAGATGCCCATGTCTTTGTTCTGTTGCAGCTGTTTTTGGACACGAAATATGTGATGTAGGACAGTCGTCGGTGCTCTGCTTAGAAGTTATGGCCACTCTGGTTTTGTTGCTGCTGAATTTGGACAACATCACAGGAGCTTTTCTTGGAGAAATTTGTGGAGGAAGCTTTTGAAAAGATGACAGAAGAGGACAGGACCACCCTACACTACAAAGATTTAGGTACTTCTTATGAATTGCTGTCTTAAATTAAAAGTTAAAATTTTGATAGTTCAGTCTGGTGACTTAACCTGGATGAAAGGTGATCTCATCGTAAGACGAGACCACCTTGCATCTAGGTTCGTGAAGGATGAGCTTTAATTTGTTATTTAAATATCTTTAAGATCCAAGATAGTCTGATTTTGATGTTGTGTTTGTGGCGTTTTAATTTTCTGTTCGTGGACGGTTGATAAACAAGAGTATCCAATGAAGGTTTATTGATATCTGAATCACATAATGTAAATGCCACTCTTAGAGTGATACCAATCTTCAATACTGAAATGATATGTATTGATGGATTATCTTTGCAGCCGAACATGTTACTTGTGCGGAGAGAATGGACTTTCTTGCAGGTTGGTGTTCCTCTCCTTCTTACCAGAGATTATCAAGCTGTTGATGCGCATGTTCACATGTACCTTTTACAGTGCTTCTGTAACCTTGTTCACTTCTTTCAAATATTGTAGCTCACAGTCATTGTGATTCGCAACGACGCGACCTGCGGGTCGGTCTCTTCACTCCTCGTGTTGTAGGACAACAAACTTCTAACTATTAAATATTGCTGCAGATTTTGTTCCAGAGATGGTACTCGCGTCCACTGCAACATCAGCAAAAGCAATGGCTGATAGATAGTCCACCTTATGAAAGAACAGTTTTGGAAGGCTTTCTCAGTAAGTCATTTTTCTAGATAAATTCCATCGGGAGCGCAATGATCAAGATTTTACCTGAAGAGAAAACTACCATCACTACTAGGATAGGACTATTGAAAGTTCATATGCCTGTTGTAAATGTCAATCCCACCTTTCTCACAATTTTGATACGGGCCTTGTAGAGATAGCTGTGTGTATTCCTTATCCTGAGGTCTTATCTGTGCATACCTCAGAATAAGGGTCTGCAGAGGTCATAAGTTTCATGTTGAATAAGTACATCTCACAGCTGACCTTTGGCCCCACCACTAGGATTGCATTCAATTGATCCTTTGCTGGTGACACGGGACTTTACTGGAAATTGACTCGATTCTCTTCGCAAAGTGGAACCGTTTAATCAGTTCTATGTGTGTCTCAATCGAGCGAACTTAACCAAATACATCTTTGCAGCAGGTTTTGCTGCAAACATGT

mRNA

>Mapoly0168s0007.1
CTATTTCAACATTTTCAATTTTTTTGCAAGCTGGTCGTATCAAGAATGCAGATCAAGATCTGTGAGTTCACACACTGGTCTTCTCAAAATTTCAGGTTTTGACCGTGGAAACTCTGAAGGCTACAAAGGAAAAGGGAGAAGAAGTGCAGAACGCTGAAATTAGTTTCGTGTACGTGTAGTCAGACTCGGCGCTGCTCCCGTCACGAAGTGGGATTTGCCCAGAGGATTCGGATTGCAGGCCTTTTCAAATTTGTGCGTCATGAATTGAGGAGCTCAGAACTGAATCTGGGGATACTCATTTTGAGCTACCTACATAGTTTTGGTTGCATCACAAGGATTCCAGAAGGTCAGTTGATATGAGCAGCAGCGATGAGTCCGATTCTGGGAGAAGATCATCGGATGCAGAAGAGGATGAGAAAATGGACGAGGAGAAAGAAGAAGTTGATTCTCAATCACAAGATGACTCCCCATCTCCGTCCCCTGTTCGGTCCCAGACGCACTCGGCTCGGTCCAAGTCTGCCTCCCTCAACGCCTTGGCTTTCCCCATTTCTAGAGTGAGGCGGTTGGTGAAGAGCGAGGGGGATATGCAGTGGGTCGGCGTTGAGGCCGGTTTTCTCATTGCGAAAGCAGCGGAGCTTTTCTTGGAGAAATTTGTGGAGGAAGCTTTTGAAAAGATGACAGAAGAGGACAGGACCACCCTACACTACAAAGATTTAGCCGAACATGTTACTTGTGCGGAGAGAATGGACTTTCTTGCAGATTTTGTTCCAGAGATGGTACTCGCGTCCACTGCAACATCAGCAAAAGCAATGGCTGATAGATAGTCCACCTTATGAAAGAACAGTTTTGGAAGGCTTTCTCAGTAAGTCATTTTTCTAGATAAATTCCATCGGGAGCGCAATGATCAAGATTTTACCTGAAGAGAAAACTACCATCACTACTAGGATAGGACTATTGAAAGTTCATATGCCTGTTGTAAATGTCAATCCCACCTTTCTCACAATTTTGATACGGGCCTTGTAGAGATAGCTGTGTGTATTCCTTATCCTGAGGTCTTATCTGTGCATACCTCAGAATAAGGGTCTGCAGAGGTCATAAGTTTCATGTTGAATAAGTACATCTCACAGCTGACCTTTGGCCCCACCACTAGGATTGCATTCAATTGATCCTTTGCTGGTGACACGGGACTTTACTGGAAATTGACTCGATTCTCTTCGCAAAGTGGAACCGTTTAATCAGTTCTATGTGTGTCTCAATCGAGCGAACTTAACCAAATACATCTTTGCAGCAGGTTTTGCTGCAAACATGT

CDS

>Mapoly0168s0007.1
ATGAGCAGCAGCGATGAGTCCGATTCTGGGAGAAGATCATCGGATGCAGAAGAGGATGAGAAAATGGACGAGGAGAAAGAAGAAGTTGATTCTCAATCACAAGATGACTCCCCATCTCCGTCCCCTGTTCGGTCCCAGACGCACTCGGCTCGGTCCAAGTCTGCCTCCCTCAACGCCTTGGCTTTCCCCATTTCTAGAGTGAGGCGGTTGGTGAAGAGCGAGGGGGATATGCAGTGGGTCGGCGTTGAGGCCGGTTTTCTCATTGCGAAAGCAGCGGAGCTTTTCTTGGAGAAATTTGTGGAGGAAGCTTTTGAAAAGATGACAGAAGAGGACAGGACCACCCTACACTACAAAGATTTAGCCGAACATGTTACTTGTGCGGAGAGAATGGACTTTCTTGCAGATTTTGTTCCAGAGATGGTACTCGCGTCCACTGCAACATCAGCAAAAGCAATGGCTGATAGATAG

Protein

>Mapoly0168s0007.1
MSSSDESDSGRRSSDAEEDEKMDEEKEEVDSQSQDDSPSPSPVRSQTHSARSKSASLNALAFPISRVRRLVKSEGDMQWVGVEAGFLIAKAAELFLEKFVEEAFEKMTEEDRTTLHYKDLAEHVTCAERMDFLADFVPEMVLASTATSAKAMADR

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>