Mapoly0183s0010



Description

B3 DNA binding domain

Reference DB

Database ID Description
GO GO:0003677 DNA binding
OrthoMCL OG5_144888
PFAM PF02362 B3 DNA binding domain

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
MpB3-7 transcription factor, B3 Mapoly0183s0010.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0183s0010.1 scaffold_183:77363..78173  ( + strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0183s0010.1  

Gene structure:

mRNA scaffold_183:77363..78173  ( + strand )
five_prime_UTR scaffold_183:77363..77445  ( + strand )
CDS scaffold_183:77446..77634  ( + strand )
CDS scaffold_183:77748..78107  ( + strand )
three_prime_UTR scaffold_183:78108..78173  ( + strand )

Sequences:

Gene

>Mapoly0183s0010.1
TCCATCTTTTGTCCTCTCTTAGACATCTAAAATAGTTCAGTTTGCTTGCTTTTATCACAGTGAGAATTCTTCTGTTTACTGCAATGGATTCTGAAAATTTCAAGATGAACGTGAGAAGAAAGACGCGGGCTCAACTGACAAAGGAGTCAGTATTTCTTAAGAGAGATGCTTGGAATCATCTGGAGAAAATACACACATTCCCATGTCTCATCAAAGGCCCCAACATATTCAGAGTGATGGACAAAACAAGTGTTCATCATTGTTTTTTGATGGTGAGCTACATTGTTGCTGAGTGGAGTGTTTTAGTTATGAATGTTGTAATTTAGGCATTTGTCTCAAAGTTCATTTATCTAAATTCTCATTTTGTTTGATACATTTGCTTCAGGGCCTTGATCCTACATTCTGCAGACTGTTTCTTCCTGGAGAAGATACAAACGTCACGCTCATATACGACAAGGACGAAACCAGTTGGCCTGTGAAGTTCTTCTCTCGTCGTCGTCTCTTCAGTGGAGGCTGGATAAAATTTGTCAAGGCGTACGGATTTGAAGTGGGACAACTTCTGAATTTTGAGGTAGAAAGTCCTAAAACACTCAGAGTGAGATCGTACGACAATCTTGGACCAAATTGTGTCCGCTCTAGAGAGCAAATAGAAGCAAAGATTCGCCGCCCAAAACCAGATCCCATAGTGATGAAAGTGGTAGAGTATCCTGAAGGTCCTAGACTGTGCATCATTCCAAGAGATTAAGCTGAGATTACATGTAAGCAAGTACATATACACGTATGGTTTAGAAATCACAAGTGTTAGATGAGG

mRNA

>Mapoly0183s0010.1
TCCATCTTTTGTCCTCTCTTAGACATCTAAAATAGTTCAGTTTGCTTGCTTTTATCACAGTGAGAATTCTTCTGTTTACTGCAATGGATTCTGAAAATTTCAAGATGAACGTGAGAAGAAAGACGCGGGCTCAACTGACAAAGGAGTCAGTATTTCTTAAGAGAGATGCTTGGAATCATCTGGAGAAAATACACACATTCCCATGTCTCATCAAAGGCCCCAACATATTCAGAGTGATGGACAAAACAAGTGTTCATCATTGTTTTTTGATGGGCCTTGATCCTACATTCTGCAGACTGTTTCTTCCTGGAGAAGATACAAACGTCACGCTCATATACGACAAGGACGAAACCAGTTGGCCTGTGAAGTTCTTCTCTCGTCGTCGTCTCTTCAGTGGAGGCTGGATAAAATTTGTCAAGGCGTACGGATTTGAAGTGGGACAACTTCTGAATTTTGAGGTAGAAAGTCCTAAAACACTCAGAGTGAGATCGTACGACAATCTTGGACCAAATTGTGTCCGCTCTAGAGAGCAAATAGAAGCAAAGATTCGCCGCCCAAAACCAGATCCCATAGTGATGAAAGTGGTAGAGTATCCTGAAGGTCCTAGACTGTGCATCATTCCAAGAGATTAAGCTGAGATTACATGTAAGCAAGTACATATACACGTATGGTTTAGAAATCACAAGTGTTAGATGAGG

CDS

>Mapoly0183s0010.1
ATGGATTCTGAAAATTTCAAGATGAACGTGAGAAGAAAGACGCGGGCTCAACTGACAAAGGAGTCAGTATTTCTTAAGAGAGATGCTTGGAATCATCTGGAGAAAATACACACATTCCCATGTCTCATCAAAGGCCCCAACATATTCAGAGTGATGGACAAAACAAGTGTTCATCATTGTTTTTTGATGGGCCTTGATCCTACATTCTGCAGACTGTTTCTTCCTGGAGAAGATACAAACGTCACGCTCATATACGACAAGGACGAAACCAGTTGGCCTGTGAAGTTCTTCTCTCGTCGTCGTCTCTTCAGTGGAGGCTGGATAAAATTTGTCAAGGCGTACGGATTTGAAGTGGGACAACTTCTGAATTTTGAGGTAGAAAGTCCTAAAACACTCAGAGTGAGATCGTACGACAATCTTGGACCAAATTGTGTCCGCTCTAGAGAGCAAATAGAAGCAAAGATTCGCCGCCCAAAACCAGATCCCATAGTGATGAAAGTGGTAGAGTATCCTGAAGGTCCTAGACTGTGCATCATTCCAAGAGATTAA

Protein

>Mapoly0183s0010.1
MDSENFKMNVRRKTRAQLTKESVFLKRDAWNHLEKIHTFPCLIKGPNIFRVMDKTSVHHCFLMGLDPTFCRLFLPGEDTNVTLIYDKDETSWPVKFFSRRRLFSGGWIKFVKAYGFEVGQLLNFEVESPKTLRVRSYDNLGPNCVRSREQIEAKIRRPKPDPIVMKVVEYPEGPRLCIIPRD

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>