Mapoly0210s0005



Description

MYB-LIKE DNA-BINDING PROTEIN MYB

Reference DB

Database ID Description
GO GO:0003682 Chromatin binding
OrthoMCL OG5_127030
PFAM PF00249 Myb-like DNA-binding domain
PFAM PF13921 Myb-like DNA-binding domain
PANTHER PTHR10641 MYB-LIKE DNA-BINDING PROTEIN MYB
PANTHER PTHR10641:SF221

Nomenclature

[Notice] The nomenclature site is currently operated as a Beta version for testing.

Gene symbol Product Transcript ID Status
Mp3R-MYB7 transcription factor, MYB Mapoly0210s0005.1 Public

Transcript models

Transcript ID Location Sequences Gene model
Mapoly0210s0005.1 scaffold_210:92683..99090  ( - strand ) Gene /  mRNA /  CDS /  Protein
GenBank format (with flanking bases)

Mapoly0210s0005.1  

Gene structure:

mRNA scaffold_210:92683..99090  ( - strand )
three_prime_UTR scaffold_210:92683..92772  ( - strand )
CDS scaffold_210:92773..93076  ( - strand )
CDS scaffold_210:93184..93312  ( - strand )
CDS scaffold_210:93697..93800  ( - strand )
CDS scaffold_210:93897..93991  ( - strand )
CDS scaffold_210:94113..94170  ( - strand )
CDS scaffold_210:94654..94720  ( - strand )
CDS scaffold_210:94839..94975  ( - strand )
five_prime_UTR scaffold_210:94976..94994  ( - strand )
five_prime_UTR scaffold_210:95217..99090  ( - strand )

Sequences:

Gene

>Mapoly0210s0005.1
GACGTTACAACTTGGAACAGATAAGTCCTCAGTTTTGCCTTTCGATCAGTTCAGTGTGTTCAGTGTCAGTGTCAGATTTGTACGAGACGATAGTTTAGGGTATTAGACAGATTGCTCGAACTTCCTACTACTTGTGACATACCTGAATCCTTAAGCGATCAATCGCATAGTACTTTCTTGCGTGCATTGTCTGCGGTTGAGCTCCTGATTGAAACGCTCTGTGAGTTCGAGAGGTGTGAACTAGCTCAGGTCTGCTCAGCTTCAACATTTGAGCACAATAGGAGTAAAGAAGACATACTTTCTCTATTTTCGCTGACGTGGTTGATCTCAATTCAATGACCCTTTGACGCCATACAACTAGTCGTAAAGTTCGTGAACAGTGTTTGTATGGATGATACTTTTCTGATGAACTTATTTTCCAAATGAAAATATTTAATGACTAACATTCTTGATTAATGTACTACCTCAAAGTCAAAGTTTGATGTTTAGGTTTATCCAAATATTTCAAAAGTTATTTGTTCAATTTGTGTATCTTTCTACGTTTCCTTTGTCTTGCCATGGTGAGATGAAACCACTGCAAATGTCAAACACATATATCGTGGTTTATGTAAGTACTCTGTGTCTTATGCATGGGCACGGTTGATTTTGAAACTTAGACAACTATTAACTAATATTGATTATATTTGTGAAAGTACACGTAAGTATTGCCATGGTTGTGTTTGAAACTTAGAAGCTATAAAATTTTTTTATAAGATTTGTAAAACTGCTGGTTAATATTGTCATGGTTGCGTTTGGAACTTGGAAACTATCATAAATTGATGATATTTGTGAAAGTACGTTTTAGTATCGCTGCAACTCTTCATCTTGCCTTTGAAATTGTTCAAAAATCTTCATTGAATCAAAACAAAGGATGCAATTTGTGAAATTATTCACGGCTTTTAACTAATTTCAACCAACTTCATGTAATTTACAATCTTCATGCGACTTTCAACGCTCAATTATTGCTTCATGTTGCAATATTGAGTTAGAAGACCTCTTAAGATCTCCAGACTTTTTTCAAAGAGTACAAACATTATTTCTTGAATTTTTTTCTTACATACTTTAACTCCTTGACACAGCAATTTCATAGGAAACTATTTAACTTCTTCTACTCCATGAAGTATATGAATTCAAACATCCAAGAAAAGTAGATATTTGAAATGTATTTTCCAAATTGAATAAAAAAGATCATGATACATATACATCTATATATACTAGAAACTTTGTAGGTTTTACCATTCTATACTCTAAACCCACACAAGAAAAATACTTGTCCAACTCAAAAAGTCGTTTTGAGGGATCATTAAATGTGATGACTAACCTCCAAAATGTTGTCGTATAACCTTGTGTGGTGTTGTAGCATTCGGTTTCTAAGAAAGCAGTAACCTCTTCGCTGAAGAAAACCCACATCGCCTCTCCTTACATGTGAATTAGTATTTCATGTAGATACGACTCTCAAATTTAGACAGATGGAATGTCAATCTATTGTCAGCAGATCTCACTATGTGAAGGATACTATTTTCAAAATAAGCTAAGAGAGATGATTCTAACTTAGAAAAGATCCCCATCGGAGAAGACTAAAGTCAATTTGTCCTCATTTTCAACCTTGTTGCTCTCCTAGGCAAGCCTTTACCAAAGAAGCCTCAATGAAACGTTTTTCTCTAAAAAAATATTGGACCAATTTCATCATGTAGATACGAGTTCTTGAATGTAACTTACAATGCATCGAATTAATTAATTCTTCTGTTTGATAGTTAGAATCTTGTAAAATTATATAGGTTTTTGTAATTAGAATCCTGTAAGGGAGTATTCTTTATTGGAAGCAAGTATTCTTGCTTATTGCTTCCATTATCTACTTGTTGGTGTTTTGCGAGATCGTATATGAATAAGTGTATGGGATCTTCTACAGCCTTCTCAACACTTGAAGGAAACATCGAAAATAAGAGTTCAACCTATTCAAACAGACTTGTATCAGACTGTCTTGACACCACTTACATGTGTTATGGTCCAGGTTTGTACATTTGACGATACATATTAAAAGTTGACCTTTAAATAGAATAGTGCCTCTAACCAGGTGAGGAGTTTTTCAACTTGTTATATCCTTCAGTATCCTTAGCTTAATGTGATTTTAGGATTTCATGTTTGATCATGGTCCTGCATATTAAAAAAAAGTTTTGGCATAATGAGTGGAGTTTATGTCTTTTCTGAACCATAGATATATGTACGAGTCCAATTTATCCTCACTCCGACATTTTTCTCTATTGTGTTCGTCGTGGTACATTTTCCGATATTTCACTGTATTTTGTATTATTTTTTTCTTTTTTCTCTTATCACAATATTATCACTTAAATTTAGTCTTTTGATCAACATATTTCCTTTCGAGGAAGTTCAAGCAAGATAACTTCTAGTTCATGATAGACAGAGATCTCATTCACAGCATCAAGTTTTACATATCACGCCAGTCAGTGCTCATTTTTTAGATTATTCATGTTTCCTATGTGTAGTAATTGCATAACCACAGAATGCTTTTACTGAGAACTATATGTTCTTCAATTTGAAAATAGACCTATGTTTCTTCTCTTATCTAACATGATTTCAGACAATAGGCTTCTTGCCAAATCTTACTCCTATTATACATGACACCACTCCATAAAGCCTCTCCTTTCTTGTATAGATACTAAATCAAACTTTCCACACCCCTTACTTCTTGATGGTAACTTTTTGCCGACATTCCCACCTTACTGTTGATATAAATACGAAACATTGGAATATTCCTAATTCCTAGACCCTAGATCAAAAACTTTACTTATCTTCATAAAATCAATCCTTTCATTGATGTTTATCGAGTCTATGTTGGTTTGCCCCTTGTTAAAACCGTTAAGAATTAACCTTGTTAAAGATCGCTGAAGAAATCAAAGTTTTCTACTATGACAAATAATCCGACTAACGCATAAACGCGAGAAGAATGATATTATGCTGTTCAACATCTCACTTCTTTAGATCACTTCTGTTCAAATGTTACACGCTTATTGGACTAATGGATTCACGAGAGATAGATATCAATTATGCTCTTTACCGAATCCTCTTGTTGATCATTTCGAAGGGATCAGCATAAAATACATTTGTTACATATATCCATCTGTTTGCGAATTTACACCAGATTTGCGTTGTCCATGTGGGAAATTTTACTGTCTAACGGATGGAGTAGTAAGGGTGAAGATGACAATTTTTTACCAGATCCTGAAATTAATCAGTCTTGTCCCTAGGTATAAGCTTACCTTGGTAGCTCAGACTTAGTGTGTTTGATGAATCTTGGAATATACTAAAATTCTAACTTTATCGTAGTTTCTTAAGAGGTAAGAGTTCTCGCAACAATACGATGAGGAGGTAAGTTTGACCTACCACTAGGAATTTTTTGATGCAATATCTAGTAGGTAGACTTCTGTCACAGGATTGACAAGATAGACAAGATTTATTAGATTGCCAAAAGCTTCCTTAATCCAAGTTCATGCATGATGAAAATCAAGCAGATCTTCCGATGGTTTCTGTTCTTCTCCTTTTCAGAAATAATAAATTTTAGTAATGATCATGAGAATAAGTAAACTTTCATTGTTTCAAGTGATTTCAATATCAATAATTCATTCGTTAATGAGACAAGCGTAAATTGGTAAAGGTAATAGTGAGATGTCGTTAATAAGACAAGCGTAAATTATGTCCCTAATTTGGGAACCAGATAGCATGAAAAGAGACCATGAAATATCTTACCACCTGTATGTGTTGACTCCCAGATCCATCTGTAGATCGTCTAAGATCTGTGCATCAGATCCGAGCATAGGTGAGTGTACCAATGAAATAATACATTAACAATTGTACGTTCTGGCCGAGTCATCGCAATCAAGCTCAATTATAAACTGCTTGATAGTCTAGGTCATACAATTAGATAGTTTTCTCTCTTATACTTCGCACCATCCGAGTTGGCCATGTATGTCATCTACATTAATTTTGTGCTTCTTTTTTTTCAGTTTAGTGAAACTAACAAAAACTGACTAAACTTCAGAGTTGTTTCCGATTCGAATATGGAGAAAATGGAGGCCTCCACATCTTCGACACTACCAAAGTTGCCACTCAGGAGATGCCTCGAAGACATCAGCAATTCTAGCGAGCCCAATCTGCCTTCTGCTGCAGTCGTGGATGTTACCCTCGGCACAAAAGGGTGATCACAATTTATTTTGCTCGCAATTACACTGCGTTTTGTAGTTGTCTCCATGTAGATCCAAATGACGCATGATCTCTGAAGCCGAATATTCTTGTCGGTTCTATGAATGAAACAGGAAGAAGCTGAGAGTTTATCATGCTCCGCGACGAAGGAGGCCATACACGTCGTGGACGGAGGAAGAAGTGAGTACACCATTGGTTGATAACTGATACTGTTTTAGCCTCTATGTAGACGAATCAGTCTTAGGAATGTTAGAAACATCGACAGGCCCAATGTCGATTCTGTCACGATTTTGAAACCATGATGTTCACGACCTTCAGAGGAAGCACTCGAGTTCCTCCAAGTAGGAGTGATGATTTTGGTTCATATTGTTTAGATTGGACAGTACAACTTAAGTGTTAATACTGTGCTTAGATTAGCGAATACAACTTAAGGTAATTTTTCGATTCATTATCAGGCTTAGTCACAGGATATATTTTCTCACTCCGATAGTTGACTTGCCCTGCAACATCTGTAGTATTTTTAAGTAGGGTCTGTTTCTCTGACCACTCGTATTCAATGTAACATTTGATGAACATCCACAGGTGTTCTGAACTGAATATCTGCAGTGACTGAGTTTTACAATTAATCTGAAGCCAAGGCGACTGTCTACTTCATTGTTACAGGACACAGCATTGCGAGCAGCAGTTGAGCAGTTCAAAGGAAGAAATTGGAAAAAAATTGGTGAGTACACATGTACGAGTTTTTTTAGATGAGTTCATTATTTTGGTAACTTTCAACTGCTATGACCACAACTCTTCTGTGTAAAATCTCAAGATATGTATTGGACTGATGGCATGTGCAGCTGCGAATGTACCGAATCGGTCAGATAATCAGTGCCTTAACCGCTGGCAGAAGGTCCTTGATCCTGCCCTCGTCAAGGGATCCTGGACGAAAGAGGTAAGTGCCTCTTATATAAATAGATTACAAGAGTGAGTTACCCAAGATCCCACGTTCAAGAAACGTGATGATTGATATAAGTAGCTTATTTCGCAGGAGGACGATAAGTTGCTCGAAATGGTCAACGAGTTCGGCACCAAGACATGGGCTGCCATCGCTAGGTCATTGCCGAGCAGAAACGGCAAGCAGTGTCGAGAGAGGTGCGTATCAAATATGTGGTGATTTTTATGTTCCGACACTTAATAATCTCACTATAGTCTCTGAAATCTCCTACTGATGGTAATCCTGCTAATCATGGGAATTTTGAGGTGCACCTGTGAGTTTATGTGAAATGTTATTATTCGTGTTGTTGTTCTAAAATTTTGTTGTTTCAGAAAAATGAGTCGTTCAAACAGTAGCTTGAGAGAAAGAGTACTTTAAATAACATGTTACTAGTGTTAATATCTCTTTGATTGATGTGAAATAGTTCACCATGGATATTTCTGTAATTTCGAAGTTATTAATTTTAAATTTACTCCAAATTTGCGAACTAAAAGTTTCACAAAACATTATTCTAACCTGCTTGGTAATTTATTACTTTACAGATGGTGCAATAATCTTGATCCCCAGATCAAGAAGGAGCCGTGGAATGAAGAAGAAGACATGAAGTTGTTTTTGGCTCACAAGAGGTTCGGCAACAGCTGGTCAAAGATCGCAAAGCTAATTCCTGGCAGGTAAAGTCATTATATTCGGAAGATTTAATTTGTGTGGTTACCTTGTATTATAAATGTTACTTAGCAATTTCCTCATCTAATTCTTTTGCACACAATGAATTCCACAGGTCGGAAAATGGTATCAAGAACAGGTGGAACATAACAATCCAAAAACGTGCGGATGCACTCGAACAATCCACTGAGAACTGGATAAATAGGAACACATTTGAGGATATGTTATCCATTATTGACGATGTGGCTCCAACAGAGCTTGATGTTTCTGAAGATCATCTGGCATTGAATGGCGAGGCCAATATCGATCTTCAAGACTCGAATGCTGCGAAAGACCTTATAGCATGGAACTTAGAGTTTGATATGGATGTTGATGTAGATAACTTCTTAGACCTCCCAGACTTGAACCTCTCTCCTTGATATCAAATTGTTACAGTTCATGTGAAGATACCTTATTGCAAAAATATAATGCATGTACTTTATTTTTTAAAATGATTAGCACTTGAATGG

mRNA

>Mapoly0210s0005.1
GACGTTACAACTTGGAACAGATAAGTCCTCAGTTTTGCCTTTCGATCAGTTCAGTGTGTTCAGTGTCAGTGTCAGATTTGTACGAGACGATAGTTTAGGGTATTAGACAGATTGCTCGAACTTCCTACTACTTGTGACATACCTGAATCCTTAAGCGATCAATCGCATAGTACTTTCTTGCGTGCATTGTCTGCGGTTGAGCTCCTGATTGAAACGCTCTGTGAGTTCGAGAGGTGTGAACTAGCTCAGGTCTGCTCAGCTTCAACATTTGAGCACAATAGGAGTAAAGAAGACATACTTTCTCTATTTTCGCTGACGTGGTTGATCTCAATTCAATGACCCTTTGACGCCATACAACTAGTCGTAAAGTTCGTGAACAGTGTTTGTATGGATGATACTTTTCTGATGAACTTATTTTCCAAATGAAAATATTTAATGACTAACATTCTTGATTAATGTACTACCTCAAAGTCAAAGTTTGATGTTTAGGTTTATCCAAATATTTCAAAAGTTATTTGTTCAATTTGTGTATCTTTCTACGTTTCCTTTGTCTTGCCATGGTGAGATGAAACCACTGCAAATGTCAAACACATATATCGTGGTTTATGTAAGTACTCTGTGTCTTATGCATGGGCACGGTTGATTTTGAAACTTAGACAACTATTAACTAATATTGATTATATTTGTGAAAGTACACGTAAGTATTGCCATGGTTGTGTTTGAAACTTAGAAGCTATAAAATTTTTTTATAAGATTTGTAAAACTGCTGGTTAATATTGTCATGGTTGCGTTTGGAACTTGGAAACTATCATAAATTGATGATATTTGTGAAAGTACGTTTTAGTATCGCTGCAACTCTTCATCTTGCCTTTGAAATTGTTCAAAAATCTTCATTGAATCAAAACAAAGGATGCAATTTGTGAAATTATTCACGGCTTTTAACTAATTTCAACCAACTTCATGTAATTTACAATCTTCATGCGACTTTCAACGCTCAATTATTGCTTCATGTTGCAATATTGAGTTAGAAGACCTCTTAAGATCTCCAGACTTTTTTCAAAGAGTACAAACATTATTTCTTGAATTTTTTTCTTACATACTTTAACTCCTTGACACAGCAATTTCATAGGAAACTATTTAACTTCTTCTACTCCATGAAGTATATGAATTCAAACATCCAAGAAAAGTAGATATTTGAAATGTATTTTCCAAATTGAATAAAAAAGATCATGATACATATACATCTATATATACTAGAAACTTTGTAGGTTTTACCATTCTATACTCTAAACCCACACAAGAAAAATACTTGTCCAACTCAAAAAGTCGTTTTGAGGGATCATTAAATGTGATGACTAACCTCCAAAATGTTGTCGTATAACCTTGTGTGGTGTTGTAGCATTCGGTTTCTAAGAAAGCAGTAACCTCTTCGCTGAAGAAAACCCACATCGCCTCTCCTTACATGTGAATTAGTATTTCATGTAGATACGACTCTCAAATTTAGACAGATGGAATGTCAATCTATTGTCAGCAGATCTCACTATGTGAAGGATACTATTTTCAAAATAAGCTAAGAGAGATGATTCTAACTTAGAAAAGATCCCCATCGGAGAAGACTAAAGTCAATTTGTCCTCATTTTCAACCTTGTTGCTCTCCTAGGCAAGCCTTTACCAAAGAAGCCTCAATGAAACGTTTTTCTCTAAAAAAATATTGGACCAATTTCATCATGTAGATACGAGTTCTTGAATGTAACTTACAATGCATCGAATTAATTAATTCTTCTGTTTGATAGTTAGAATCTTGTAAAATTATATAGGTTTTTGTAATTAGAATCCTGTAAGGGAGTATTCTTTATTGGAAGCAAGTATTCTTGCTTATTGCTTCCATTATCTACTTGTTGGTGTTTTGCGAGATCGTATATGAATAAGTGTATGGGATCTTCTACAGCCTTCTCAACACTTGAAGGAAACATCGAAAATAAGAGTTCAACCTATTCAAACAGACTTGTATCAGACTGTCTTGACACCACTTACATGTGTTATGGTCCAGGTTTGTACATTTGACGATACATATTAAAAGTTGACCTTTAAATAGAATAGTGCCTCTAACCAGGTGAGGAGTTTTTCAACTTGTTATATCCTTCAGTATCCTTAGCTTAATGTGATTTTAGGATTTCATGTTTGATCATGGTCCTGCATATTAAAAAAAAGTTTTGGCATAATGAGTGGAGTTTATGTCTTTTCTGAACCATAGATATATGTACGAGTCCAATTTATCCTCACTCCGACATTTTTCTCTATTGTGTTCGTCGTGGTACATTTTCCGATATTTCACTGTATTTTGTATTATTTTTTTCTTTTTTCTCTTATCACAATATTATCACTTAAATTTAGTCTTTTGATCAACATATTTCCTTTCGAGGAAGTTCAAGCAAGATAACTTCTAGTTCATGATAGACAGAGATCTCATTCACAGCATCAAGTTTTACATATCACGCCAGTCAGTGCTCATTTTTTAGATTATTCATGTTTCCTATGTGTAGTAATTGCATAACCACAGAATGCTTTTACTGAGAACTATATGTTCTTCAATTTGAAAATAGACCTATGTTTCTTCTCTTATCTAACATGATTTCAGACAATAGGCTTCTTGCCAAATCTTACTCCTATTATACATGACACCACTCCATAAAGCCTCTCCTTTCTTGTATAGATACTAAATCAAACTTTCCACACCCCTTACTTCTTGATGGTAACTTTTTGCCGACATTCCCACCTTACTGTTGATATAAATACGAAACATTGGAATATTCCTAATTCCTAGACCCTAGATCAAAAACTTTACTTATCTTCATAAAATCAATCCTTTCATTGATGTTTATCGAGTCTATGTTGGTTTGCCCCTTGTTAAAACCGTTAAGAATTAACCTTGTTAAAGATCGCTGAAGAAATCAAAGTTTTCTACTATGACAAATAATCCGACTAACGCATAAACGCGAGAAGAATGATATTATGCTGTTCAACATCTCACTTCTTTAGATCACTTCTGTTCAAATGTTACACGCTTATTGGACTAATGGATTCACGAGAGATAGATATCAATTATGCTCTTTACCGAATCCTCTTGTTGATCATTTCGAAGGGATCAGCATAAAATACATTTGTTACATATATCCATCTGTTTGCGAATTTACACCAGATTTGCGTTGTCCATGTGGGAAATTTTACTGTCTAACGGATGGAGTAGTAAGGGTGAAGATGACAATTTTTTACCAGATCCTGAAATTAATCAGTCTTGTCCCTAGGTATAAGCTTACCTTGGTAGCTCAGACTTAGTGTGTTTGATGAATCTTGGAATATACTAAAATTCTAACTTTATCGTAGTTTCTTAAGAGGTAAGAGTTCTCGCAACAATACGATGAGGAGGTAAGTTTGACCTACCACTAGGAATTTTTTGATGCAATATCTAGTAGGTAGACTTCTGTCACAGGATTGACAAGATAGACAAGATTTATTAGATTGCCAAAAGCTTCCTTAATCCAAGTTCATGCATGATGAAAATCAAGCAGATCTTCCGATGGTTTCTGTTCTTCTCCTTTTCAGAAATAATAAATTTTAGTAATGATCATGAGAATAAGTAAACTTTCATTGTTTCAAGTGATTTCAATATCAATAATTCATTCGTTAATGAGACAAGCGTAAATTGGTAAAGGTAATAGTGAGATGTCGTTAATAAGACAAGCGTAAATTATGTCCCTAATTTGGGAACCAGATAGCATGAAAAGAGACCATGAAATATCTTACCACCTGTATGTGTTGACTCCCAGATCCATCTGTAGATCGTCTAAGATCTGTGCATCAGATCCGAGCATAGAGTTGTTTCCGATTCGAATATGGAGAAAATGGAGGCCTCCACATCTTCGACACTACCAAAGTTGCCACTCAGGAGATGCCTCGAAGACATCAGCAATTCTAGCGAGCCCAATCTGCCTTCTGCTGCAGTCGTGGATGTTACCCTCGGCACAAAAGGGAAGAAGCTGAGAGTTTATCATGCTCCGCGACGAAGGAGGCCATACACGTCGTGGACGGAGGAAGAAGACACAGCATTGCGAGCAGCAGTTGAGCAGTTCAAAGGAAGAAATTGGAAAAAAATTGCTGCGAATGTACCGAATCGGTCAGATAATCAGTGCCTTAACCGCTGGCAGAAGGTCCTTGATCCTGCCCTCGTCAAGGGATCCTGGACGAAAGAGGAGGACGATAAGTTGCTCGAAATGGTCAACGAGTTCGGCACCAAGACATGGGCTGCCATCGCTAGGTCATTGCCGAGCAGAAACGGCAAGCAGTGTCGAGAGAGATGGTGCAATAATCTTGATCCCCAGATCAAGAAGGAGCCGTGGAATGAAGAAGAAGACATGAAGTTGTTTTTGGCTCACAAGAGGTTCGGCAACAGCTGGTCAAAGATCGCAAAGCTAATTCCTGGCAGGTCGGAAAATGGTATCAAGAACAGGTGGAACATAACAATCCAAAAACGTGCGGATGCACTCGAACAATCCACTGAGAACTGGATAAATAGGAACACATTTGAGGATATGTTATCCATTATTGACGATGTGGCTCCAACAGAGCTTGATGTTTCTGAAGATCATCTGGCATTGAATGGCGAGGCCAATATCGATCTTCAAGACTCGAATGCTGCGAAAGACCTTATAGCATGGAACTTAGAGTTTGATATGGATGTTGATGTAGATAACTTCTTAGACCTCCCAGACTTGAACCTCTCTCCTTGATATCAAATTGTTACAGTTCATGTGAAGATACCTTATTGCAAAAATATAATGCATGTACTTTATTTTTTAAAATGATTAGCACTTGAATGG

CDS

>Mapoly0210s0005.1
ATGGAGAAAATGGAGGCCTCCACATCTTCGACACTACCAAAGTTGCCACTCAGGAGATGCCTCGAAGACATCAGCAATTCTAGCGAGCCCAATCTGCCTTCTGCTGCAGTCGTGGATGTTACCCTCGGCACAAAAGGGAAGAAGCTGAGAGTTTATCATGCTCCGCGACGAAGGAGGCCATACACGTCGTGGACGGAGGAAGAAGACACAGCATTGCGAGCAGCAGTTGAGCAGTTCAAAGGAAGAAATTGGAAAAAAATTGCTGCGAATGTACCGAATCGGTCAGATAATCAGTGCCTTAACCGCTGGCAGAAGGTCCTTGATCCTGCCCTCGTCAAGGGATCCTGGACGAAAGAGGAGGACGATAAGTTGCTCGAAATGGTCAACGAGTTCGGCACCAAGACATGGGCTGCCATCGCTAGGTCATTGCCGAGCAGAAACGGCAAGCAGTGTCGAGAGAGATGGTGCAATAATCTTGATCCCCAGATCAAGAAGGAGCCGTGGAATGAAGAAGAAGACATGAAGTTGTTTTTGGCTCACAAGAGGTTCGGCAACAGCTGGTCAAAGATCGCAAAGCTAATTCCTGGCAGGTCGGAAAATGGTATCAAGAACAGGTGGAACATAACAATCCAAAAACGTGCGGATGCACTCGAACAATCCACTGAGAACTGGATAAATAGGAACACATTTGAGGATATGTTATCCATTATTGACGATGTGGCTCCAACAGAGCTTGATGTTTCTGAAGATCATCTGGCATTGAATGGCGAGGCCAATATCGATCTTCAAGACTCGAATGCTGCGAAAGACCTTATAGCATGGAACTTAGAGTTTGATATGGATGTTGATGTAGATAACTTCTTAGACCTCCCAGACTTGAACCTCTCTCCTTGA

Protein

>Mapoly0210s0005.1
MEKMEASTSSTLPKLPLRRCLEDISNSSEPNLPSAAVVDVTLGTKGKKLRVYHAPRRRRPYTSWTEEEDTALRAAVEQFKGRNWKKIAANVPNRSDNQCLNRWQKVLDPALVKGSWTKEEDDKLLEMVNEFGTKTWAAIARSLPSRNGKQCRERWCNNLDPQIKKEPWNEEEDMKLFLAHKRFGNSWSKIAKLIPGRSENGIKNRWNITIQKRADALEQSTENWINRNTFEDMLSIIDDVAPTELDVSEDHLALNGEANIDLQDSNAAKDLIAWNLEFDMDVDVDNFLDLPDLNLSP

MarpolBase: Marchantia Genome Database / Genome Informatics Laboratory, NIG. <mpgdb'@'ynlab.info>